diff --git a/Godeps/Godeps.json b/Godeps/Godeps.json index e9ba6f00ef7..cb473f64fce 100644 --- a/Godeps/Godeps.json +++ b/Godeps/Godeps.json @@ -430,32 +430,32 @@ }, { "ImportPath": "github.com/containernetworking/cni/libcni", - "Comment": "spec-v0.3.1", + "Comment": "v0.5.2", "Rev": "137b4975ecab6e1f0c24c1e3c228a50a3cfba75e" }, { "ImportPath": "github.com/containernetworking/cni/pkg/invoke", - "Comment": "spec-v0.3.1", + "Comment": "v0.5.2", "Rev": "137b4975ecab6e1f0c24c1e3c228a50a3cfba75e" }, { "ImportPath": "github.com/containernetworking/cni/pkg/types", - "Comment": "spec-v0.3.1", + "Comment": "v0.5.2", "Rev": "137b4975ecab6e1f0c24c1e3c228a50a3cfba75e" }, { "ImportPath": "github.com/containernetworking/cni/pkg/types/020", - "Comment": "spec-v0.3.1", + "Comment": "v0.5.2", "Rev": "137b4975ecab6e1f0c24c1e3c228a50a3cfba75e" }, { "ImportPath": "github.com/containernetworking/cni/pkg/types/current", - "Comment": "spec-v0.3.1", + "Comment": "v0.5.2", "Rev": "137b4975ecab6e1f0c24c1e3c228a50a3cfba75e" }, { "ImportPath": "github.com/containernetworking/cni/pkg/version", - "Comment": "spec-v0.3.1", + "Comment": "v0.5.2", "Rev": "137b4975ecab6e1f0c24c1e3c228a50a3cfba75e" }, { @@ -838,12 +838,12 @@ }, { "ImportPath": "github.com/docker/distribution/digest", - "Comment": "v2.4.0-rc.1-38-gcd27f179", + "Comment": "v2.4.0-rc.1-38-gcd27f17", "Rev": "cd27f179f2c10c5d300e6d09025b538c475b0d51" }, { "ImportPath": "github.com/docker/distribution/reference", - "Comment": "v2.4.0-rc.1-38-gcd27f179", + "Comment": "v2.4.0-rc.1-38-gcd27f17", "Rev": "cd27f179f2c10c5d300e6d09025b538c475b0d51" }, { @@ -1171,127 +1171,127 @@ }, { "ImportPath": "github.com/gogo/protobuf/gogoproto", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/compare", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/defaultcheck", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/description", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/embedcheck", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/enumstringer", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/equal", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/face", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/gostring", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/marshalto", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/oneofcheck", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/populate", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/size", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/stringer", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/testgen", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/union", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/plugin/unmarshal", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/proto", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/protoc-gen-gogo/descriptor", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/protoc-gen-gogo/generator", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/protoc-gen-gogo/grpc", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/protoc-gen-gogo/plugin", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/sortkeys", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/vanity", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { "ImportPath": "github.com/gogo/protobuf/vanity/command", - "Comment": "v0.4-3-gc0656edd", + "Comment": "v0.4-3-gc0656ed", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" }, { @@ -2152,82 +2152,82 @@ }, { "ImportPath": "github.com/opencontainers/runc/libcontainer", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/apparmor", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/cgroups", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/cgroups/fs", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/cgroups/systemd", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/configs", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/configs/validate", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/criurpc", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/keys", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/label", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/seccomp", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/selinux", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/stacktrace", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/system", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/user", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { "ImportPath": "github.com/opencontainers/runc/libcontainer/utils", - "Comment": "v1.0.0-rc2-49-gd223e2ad", + "Comment": "v1.0.0-rc2-49-gd223e2a", "Rev": "d223e2adae83f62d58448a799a5da05730228089" }, { @@ -2298,107 +2298,107 @@ }, { "ImportPath": "github.com/rackspace/gophercloud", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/openstack", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/openstack/blockstorage/v1/volumes", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/openstack/compute/v2/extensions/bootfromvolume", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/openstack/compute/v2/extensions/diskconfig", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/openstack/compute/v2/extensions/volumeattach", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/openstack/compute/v2/flavors", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/openstack/compute/v2/images", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/openstack/compute/v2/servers", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/openstack/identity/v2/tenants", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/openstack/identity/v2/tokens", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/openstack/identity/v3/tokens", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/openstack/utils", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/pagination", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/rackspace", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/rackspace/blockstorage/v1/volumes", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/rackspace/compute/v2/servers", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/rackspace/compute/v2/volumeattach", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/rackspace/identity/v2/tokens", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/testhelper", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { "ImportPath": "github.com/rackspace/gophercloud/testhelper/client", - "Comment": "v1.0.0-1012-ge00690e8", + "Comment": "v1.0.0-1012-ge00690e", "Rev": "e00690e87603abe613e9f02c816c7c4bef82e063" }, { @@ -2715,51 +2715,51 @@ }, { "ImportPath": "golang.org/x/net/context", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/context/ctxhttp", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/html", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/html/atom", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2/hpack", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/idna", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/internal/timeseries", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/lex/httplex", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/proxy", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/trace", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/websocket", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/oauth2", @@ -2791,63 +2791,67 @@ }, { "ImportPath": "golang.org/x/text/cases", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/encoding", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/encoding/internal", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/encoding/internal/identifier", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/encoding/unicode", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "golang.org/x/text/internal", + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/internal/tag", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/internal/utf8internal", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/language", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/runes", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/bidirule", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/precis", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/transform", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/bidi", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/norm", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/width", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/time/rate", @@ -2909,50 +2913,79 @@ "ImportPath": "google.golang.org/api/pubsub/v1", "Rev": "98825bb0065da4054e5da6db34f5fc598e50bc24" }, + { + "ImportPath": "google.golang.org/genproto/googleapis/rpc/status", + "Rev": "09f6ed296fc66555a25fe4ce95173148778dfa85" + }, { "ImportPath": "google.golang.org/grpc", - "Comment": "v1.0.4", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/codes", - "Comment": "v1.0.4", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/credentials", - "Comment": "v1.0.4", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/grpclb/grpc_lb_v1", + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/grpclog", - "Comment": "v1.0.4", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/internal", - "Comment": "v1.0.4", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/keepalive", + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/metadata", - "Comment": "v1.0.4", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/naming", - "Comment": "v1.0.4", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/peer", - "Comment": "v1.0.4", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/stats", + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/status", + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/tap", + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/transport", - "Comment": "v1.0.4", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Comment": "v1.3.0", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "gopkg.in/gcfg.v1", diff --git a/Godeps/LICENSES b/Godeps/LICENSES index b5c59d6a434..6a7d5480e23 100644 --- a/Godeps/LICENSES +++ b/Godeps/LICENSES @@ -86430,6 +86430,41 @@ OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. ================================================================================ +================================================================================ += vendor/golang.org/x/text/internal licensed under: = + +Copyright (c) 2009 The Go Authors. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + += vendor/golang.org/x/text/LICENSE 5d4950ecb7b26d2c5e4e7b4e0dd74707 - +================================================================================ + + ================================================================================ = vendor/golang.org/x/text/internal/tag licensed under: = @@ -87305,6 +87340,216 @@ OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. ================================================================================ +================================================================================ += vendor/google.golang.org/genproto/googleapis/rpc/status licensed under: = + + + Apache License + Version 2.0, January 2004 + http://www.apache.org/licenses/ + + TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION + + 1. Definitions. + + "License" shall mean the terms and conditions for use, reproduction, + and distribution as defined by Sections 1 through 9 of this document. + + "Licensor" shall mean the copyright owner or entity authorized by + the copyright owner that is granting the License. + + "Legal Entity" shall mean the union of the acting entity and all + other entities that control, are controlled by, or are under common + control with that entity. For the purposes of this definition, + "control" means (i) the power, direct or indirect, to cause the + direction or management of such entity, whether by contract or + otherwise, or (ii) ownership of fifty percent (50%) or more of the + outstanding shares, or (iii) beneficial ownership of such entity. + + "You" (or "Your") shall mean an individual or Legal Entity + exercising permissions granted by this License. + + "Source" form shall mean the preferred form for making modifications, + including but not limited to software source code, documentation + source, and configuration files. + + "Object" form shall mean any form resulting from mechanical + transformation or translation of a Source form, including but + not limited to compiled object code, generated documentation, + and conversions to other media types. + + "Work" shall mean the work of authorship, whether in Source or + Object form, made available under the License, as indicated by a + copyright notice that is included in or attached to the work + (an example is provided in the Appendix below). + + "Derivative Works" shall mean any work, whether in Source or Object + form, that is based on (or derived from) the Work and for which the + editorial revisions, annotations, elaborations, or other modifications + represent, as a whole, an original work of authorship. For the purposes + of this License, Derivative Works shall not include works that remain + separable from, or merely link (or bind by name) to the interfaces of, + the Work and Derivative Works thereof. + + "Contribution" shall mean any work of authorship, including + the original version of the Work and any modifications or additions + to that Work or Derivative Works thereof, that is intentionally + submitted to Licensor for inclusion in the Work by the copyright owner + or by an individual or Legal Entity authorized to submit on behalf of + the copyright owner. For the purposes of this definition, "submitted" + means any form of electronic, verbal, or written communication sent + to the Licensor or its representatives, including but not limited to + communication on electronic mailing lists, source code control systems, + and issue tracking systems that are managed by, or on behalf of, the + Licensor for the purpose of discussing and improving the Work, but + excluding communication that is conspicuously marked or otherwise + designated in writing by the copyright owner as "Not a Contribution." + + "Contributor" shall mean Licensor and any individual or Legal Entity + on behalf of whom a Contribution has been received by Licensor and + subsequently incorporated within the Work. + + 2. Grant of Copyright License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + copyright license to reproduce, prepare Derivative Works of, + publicly display, publicly perform, sublicense, and distribute the + Work and such Derivative Works in Source or Object form. + + 3. Grant of Patent License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + (except as stated in this section) patent license to make, have made, + use, offer to sell, sell, import, and otherwise transfer the Work, + where such license applies only to those patent claims licensable + by such Contributor that are necessarily infringed by their + Contribution(s) alone or by combination of their Contribution(s) + with the Work to which such Contribution(s) was submitted. If You + institute patent litigation against any entity (including a + cross-claim or counterclaim in a lawsuit) alleging that the Work + or a Contribution incorporated within the Work constitutes direct + or contributory patent infringement, then any patent licenses + granted to You under this License for that Work shall terminate + as of the date such litigation is filed. + + 4. Redistribution. You may reproduce and distribute copies of the + Work or Derivative Works thereof in any medium, with or without + modifications, and in Source or Object form, provided that You + meet the following conditions: + + (a) You must give any other recipients of the Work or + Derivative Works a copy of this License; and + + (b) You must cause any modified files to carry prominent notices + stating that You changed the files; and + + (c) You must retain, in the Source form of any Derivative Works + that You distribute, all copyright, patent, trademark, and + attribution notices from the Source form of the Work, + excluding those notices that do not pertain to any part of + the Derivative Works; and + + (d) If the Work includes a "NOTICE" text file as part of its + distribution, then any Derivative Works that You distribute must + include a readable copy of the attribution notices contained + within such NOTICE file, excluding those notices that do not + pertain to any part of the Derivative Works, in at least one + of the following places: within a NOTICE text file distributed + as part of the Derivative Works; within the Source form or + documentation, if provided along with the Derivative Works; or, + within a display generated by the Derivative Works, if and + wherever such third-party notices normally appear. The contents + of the NOTICE file are for informational purposes only and + do not modify the License. You may add Your own attribution + notices within Derivative Works that You distribute, alongside + or as an addendum to the NOTICE text from the Work, provided + that such additional attribution notices cannot be construed + as modifying the License. + + You may add Your own copyright statement to Your modifications and + may provide additional or different license terms and conditions + for use, reproduction, or distribution of Your modifications, or + for any such Derivative Works as a whole, provided Your use, + reproduction, and distribution of the Work otherwise complies with + the conditions stated in this License. + + 5. Submission of Contributions. Unless You explicitly state otherwise, + any Contribution intentionally submitted for inclusion in the Work + by You to the Licensor shall be under the terms and conditions of + this License, without any additional terms or conditions. + Notwithstanding the above, nothing herein shall supersede or modify + the terms of any separate license agreement you may have executed + with Licensor regarding such Contributions. + + 6. Trademarks. This License does not grant permission to use the trade + names, trademarks, service marks, or product names of the Licensor, + except as required for reasonable and customary use in describing the + origin of the Work and reproducing the content of the NOTICE file. + + 7. Disclaimer of Warranty. Unless required by applicable law or + agreed to in writing, Licensor provides the Work (and each + Contributor provides its Contributions) on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or + implied, including, without limitation, any warranties or conditions + of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A + PARTICULAR PURPOSE. You are solely responsible for determining the + appropriateness of using or redistributing the Work and assume any + risks associated with Your exercise of permissions under this License. + + 8. Limitation of Liability. In no event and under no legal theory, + whether in tort (including negligence), contract, or otherwise, + unless required by applicable law (such as deliberate and grossly + negligent acts) or agreed to in writing, shall any Contributor be + liable to You for damages, including any direct, indirect, special, + incidental, or consequential damages of any character arising as a + result of this License or out of the use or inability to use the + Work (including but not limited to damages for loss of goodwill, + work stoppage, computer failure or malfunction, or any and all + other commercial damages or losses), even if such Contributor + has been advised of the possibility of such damages. + + 9. Accepting Warranty or Additional Liability. While redistributing + the Work or Derivative Works thereof, You may choose to offer, + and charge a fee for, acceptance of support, warranty, indemnity, + or other liability obligations and/or rights consistent with this + License. However, in accepting such obligations, You may act only + on Your own behalf and on Your sole responsibility, not on behalf + of any other Contributor, and only if You agree to indemnify, + defend, and hold each Contributor harmless for any liability + incurred by, or claims asserted against, such Contributor by reason + of your accepting any such warranty or additional liability. + + END OF TERMS AND CONDITIONS + + APPENDIX: How to apply the Apache License to your work. + + To apply the Apache License to your work, attach the following + boilerplate notice, with the fields enclosed by brackets "[]" + replaced with your own identifying information. (Don't include + the brackets!) The text should be enclosed in the appropriate + comment syntax for the file format. We also recommend that a + file or class name and description of purpose be included on the + same "printed page" as the copyright notice for easier + identification within third-party archives. + + Copyright [yyyy] [name of copyright owner] + + Licensed under the Apache License, Version 2.0 (the "License"); + you may not use this file except in compliance with the License. + You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + + Unless required by applicable law or agreed to in writing, software + distributed under the License is distributed on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + See the License for the specific language governing permissions and + limitations under the License. + += vendor/google.golang.org/genproto/LICENSE 3b83ef96387f14655fc854ddc3c6bd57 - +================================================================================ + + ================================================================================ = vendor/google.golang.org/grpc licensed under: = @@ -87413,6 +87658,42 @@ OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. ================================================================================ +================================================================================ += vendor/google.golang.org/grpc/grpclb/grpc_lb_v1 licensed under: = + +Copyright 2014, Google Inc. +All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + += vendor/google.golang.org/grpc/LICENSE a4bad33881612090c6035d8393175996 - +================================================================================ + + ================================================================================ = vendor/google.golang.org/grpc/grpclog licensed under: = @@ -87485,6 +87766,42 @@ OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. ================================================================================ +================================================================================ += vendor/google.golang.org/grpc/keepalive licensed under: = + +Copyright 2014, Google Inc. +All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + += vendor/google.golang.org/grpc/LICENSE a4bad33881612090c6035d8393175996 - +================================================================================ + + ================================================================================ = vendor/google.golang.org/grpc/metadata licensed under: = @@ -87593,6 +87910,114 @@ OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. ================================================================================ +================================================================================ += vendor/google.golang.org/grpc/stats licensed under: = + +Copyright 2014, Google Inc. +All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + += vendor/google.golang.org/grpc/LICENSE a4bad33881612090c6035d8393175996 - +================================================================================ + + +================================================================================ += vendor/google.golang.org/grpc/status licensed under: = + +Copyright 2014, Google Inc. +All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + += vendor/google.golang.org/grpc/LICENSE a4bad33881612090c6035d8393175996 - +================================================================================ + + +================================================================================ += vendor/google.golang.org/grpc/tap licensed under: = + +Copyright 2014, Google Inc. +All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + += vendor/google.golang.org/grpc/LICENSE a4bad33881612090c6035d8393175996 - +================================================================================ + + ================================================================================ = vendor/google.golang.org/grpc/transport licensed under: = diff --git a/build/root/BUILD.root b/build/root/BUILD.root index 56627f257dd..773defc3b9e 100644 --- a/build/root/BUILD.root +++ b/build/root/BUILD.root @@ -69,7 +69,384 @@ filegroup( "//staging:all-srcs", "//test:all-srcs", "//third_party:all-srcs", - "//vendor:all-srcs", + "//vendor/bitbucket.org/bertimus9/systemstat:all-srcs", + "//vendor/bitbucket.org/ww/goautoneg:all-srcs", + "//vendor/cloud.google.com/go/compute/metadata:all-srcs", + "//vendor/cloud.google.com/go/internal:all-srcs", + "//vendor/github.com/Azure/azure-sdk-for-go/arm/compute:all-srcs", + "//vendor/github.com/Azure/azure-sdk-for-go/arm/containerregistry:all-srcs", + "//vendor/github.com/Azure/azure-sdk-for-go/arm/disk:all-srcs", + "//vendor/github.com/Azure/azure-sdk-for-go/arm/network:all-srcs", + "//vendor/github.com/Azure/azure-sdk-for-go/arm/storage:all-srcs", + "//vendor/github.com/Azure/azure-sdk-for-go/storage:all-srcs", + "//vendor/github.com/Azure/go-ansiterm:all-srcs", + "//vendor/github.com/Azure/go-autorest/autorest:all-srcs", + "//vendor/github.com/MakeNowJust/heredoc:all-srcs", + "//vendor/github.com/Microsoft/go-winio:all-srcs", + "//vendor/github.com/NYTimes/gziphandler:all-srcs", + "//vendor/github.com/PuerkitoBio/purell:all-srcs", + "//vendor/github.com/PuerkitoBio/urlesc:all-srcs", + "//vendor/github.com/Sirupsen/logrus:all-srcs", + "//vendor/github.com/abbot/go-http-auth:all-srcs", + "//vendor/github.com/appc/spec/schema:all-srcs", + "//vendor/github.com/armon/circbuf:all-srcs", + "//vendor/github.com/asaskevich/govalidator:all-srcs", + "//vendor/github.com/aws/aws-sdk-go/aws:all-srcs", + "//vendor/github.com/aws/aws-sdk-go/private/protocol:all-srcs", + "//vendor/github.com/aws/aws-sdk-go/private/waiter:all-srcs", + "//vendor/github.com/aws/aws-sdk-go/service/autoscaling:all-srcs", + "//vendor/github.com/aws/aws-sdk-go/service/ec2:all-srcs", + "//vendor/github.com/aws/aws-sdk-go/service/ecr:all-srcs", + "//vendor/github.com/aws/aws-sdk-go/service/elb:all-srcs", + "//vendor/github.com/aws/aws-sdk-go/service/route53:all-srcs", + "//vendor/github.com/aws/aws-sdk-go/service/sts:all-srcs", + "//vendor/github.com/beorn7/perks/quantile:all-srcs", + "//vendor/github.com/blang/semver:all-srcs", + "//vendor/github.com/boltdb/bolt:all-srcs", + "//vendor/github.com/chai2010/gettext-go/gettext:all-srcs", + "//vendor/github.com/cloudflare/cfssl/auth:all-srcs", + "//vendor/github.com/cloudflare/cfssl/certdb:all-srcs", + "//vendor/github.com/cloudflare/cfssl/config:all-srcs", + "//vendor/github.com/cloudflare/cfssl/crypto/pkcs7:all-srcs", + "//vendor/github.com/cloudflare/cfssl/csr:all-srcs", + "//vendor/github.com/cloudflare/cfssl/errors:all-srcs", + "//vendor/github.com/cloudflare/cfssl/helpers:all-srcs", + "//vendor/github.com/cloudflare/cfssl/info:all-srcs", + "//vendor/github.com/cloudflare/cfssl/log:all-srcs", + "//vendor/github.com/cloudflare/cfssl/ocsp/config:all-srcs", + "//vendor/github.com/cloudflare/cfssl/signer:all-srcs", + "//vendor/github.com/clusterhq/flocker-go:all-srcs", + "//vendor/github.com/codedellemc/goscaleio:all-srcs", + "//vendor/github.com/codegangsta/negroni:all-srcs", + "//vendor/github.com/containernetworking/cni/libcni:all-srcs", + "//vendor/github.com/containernetworking/cni/pkg/invoke:all-srcs", + "//vendor/github.com/containernetworking/cni/pkg/types:all-srcs", + "//vendor/github.com/containernetworking/cni/pkg/version:all-srcs", + "//vendor/github.com/coreos/etcd/alarm:all-srcs", + "//vendor/github.com/coreos/etcd/auth:all-srcs", + "//vendor/github.com/coreos/etcd/client:all-srcs", + "//vendor/github.com/coreos/etcd/clientv3:all-srcs", + "//vendor/github.com/coreos/etcd/compactor:all-srcs", + "//vendor/github.com/coreos/etcd/discovery:all-srcs", + "//vendor/github.com/coreos/etcd/error:all-srcs", + "//vendor/github.com/coreos/etcd/etcdserver:all-srcs", + "//vendor/github.com/coreos/etcd/integration:all-srcs", + "//vendor/github.com/coreos/etcd/lease:all-srcs", + "//vendor/github.com/coreos/etcd/mvcc:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/adt:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/contention:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/cpuutil:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/crc:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/fileutil:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/httputil:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/idutil:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/ioutil:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/logutil:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/monotime:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/netutil:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/pathutil:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/pbutil:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/runtime:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/schedule:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/testutil:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/tlsutil:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/transport:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/types:all-srcs", + "//vendor/github.com/coreos/etcd/pkg/wait:all-srcs", + "//vendor/github.com/coreos/etcd/proxy/grpcproxy:all-srcs", + "//vendor/github.com/coreos/etcd/raft:all-srcs", + "//vendor/github.com/coreos/etcd/rafthttp:all-srcs", + "//vendor/github.com/coreos/etcd/snap:all-srcs", + "//vendor/github.com/coreos/etcd/store:all-srcs", + "//vendor/github.com/coreos/etcd/version:all-srcs", + "//vendor/github.com/coreos/etcd/wal:all-srcs", + "//vendor/github.com/coreos/go-oidc/http:all-srcs", + "//vendor/github.com/coreos/go-oidc/jose:all-srcs", + "//vendor/github.com/coreos/go-oidc/key:all-srcs", + "//vendor/github.com/coreos/go-oidc/oauth2:all-srcs", + "//vendor/github.com/coreos/go-oidc/oidc:all-srcs", + "//vendor/github.com/coreos/go-semver/semver:all-srcs", + "//vendor/github.com/coreos/go-systemd/daemon:all-srcs", + "//vendor/github.com/coreos/go-systemd/dbus:all-srcs", + "//vendor/github.com/coreos/go-systemd/journal:all-srcs", + "//vendor/github.com/coreos/go-systemd/unit:all-srcs", + "//vendor/github.com/coreos/go-systemd/util:all-srcs", + "//vendor/github.com/coreos/pkg/capnslog:all-srcs", + "//vendor/github.com/coreos/pkg/dlopen:all-srcs", + "//vendor/github.com/coreos/pkg/health:all-srcs", + "//vendor/github.com/coreos/pkg/httputil:all-srcs", + "//vendor/github.com/coreos/pkg/timeutil:all-srcs", + "//vendor/github.com/coreos/rkt/api/v1alpha:all-srcs", + "//vendor/github.com/cpuguy83/go-md2man/md2man:all-srcs", + "//vendor/github.com/davecgh/go-spew/spew:all-srcs", + "//vendor/github.com/daviddengcn/go-colortext:all-srcs", + "//vendor/github.com/dgrijalva/jwt-go:all-srcs", + "//vendor/github.com/docker/distribution/digest:all-srcs", + "//vendor/github.com/docker/distribution/reference:all-srcs", + "//vendor/github.com/docker/docker/api/types:all-srcs", + "//vendor/github.com/docker/docker/client:all-srcs", + "//vendor/github.com/docker/docker/pkg/jsonlog:all-srcs", + "//vendor/github.com/docker/docker/pkg/jsonmessage:all-srcs", + "//vendor/github.com/docker/docker/pkg/longpath:all-srcs", + "//vendor/github.com/docker/docker/pkg/mount:all-srcs", + "//vendor/github.com/docker/docker/pkg/stdcopy:all-srcs", + "//vendor/github.com/docker/docker/pkg/symlink:all-srcs", + "//vendor/github.com/docker/docker/pkg/system:all-srcs", + "//vendor/github.com/docker/docker/pkg/term:all-srcs", + "//vendor/github.com/docker/docker/pkg/tlsconfig:all-srcs", + "//vendor/github.com/docker/engine-api/client:all-srcs", + "//vendor/github.com/docker/engine-api/types:all-srcs", + "//vendor/github.com/docker/go-connections/nat:all-srcs", + "//vendor/github.com/docker/go-connections/sockets:all-srcs", + "//vendor/github.com/docker/go-connections/tlsconfig:all-srcs", + "//vendor/github.com/docker/go-units:all-srcs", + "//vendor/github.com/docker/spdystream:all-srcs", + "//vendor/github.com/elazarl/go-bindata-assetfs:all-srcs", + "//vendor/github.com/elazarl/goproxy:all-srcs", + "//vendor/github.com/emicklei/go-restful:all-srcs", + "//vendor/github.com/emicklei/go-restful-swagger12:all-srcs", + "//vendor/github.com/evanphx/json-patch:all-srcs", + "//vendor/github.com/exponent-io/jsonpath:all-srcs", + "//vendor/github.com/fatih/camelcase:all-srcs", + "//vendor/github.com/fsnotify/fsnotify:all-srcs", + "//vendor/github.com/garyburd/redigo/internal:all-srcs", + "//vendor/github.com/garyburd/redigo/redis:all-srcs", + "//vendor/github.com/ghodss/yaml:all-srcs", + "//vendor/github.com/go-ini/ini:all-srcs", + "//vendor/github.com/go-openapi/analysis:all-srcs", + "//vendor/github.com/go-openapi/errors:all-srcs", + "//vendor/github.com/go-openapi/jsonpointer:all-srcs", + "//vendor/github.com/go-openapi/jsonreference:all-srcs", + "//vendor/github.com/go-openapi/loads:all-srcs", + "//vendor/github.com/go-openapi/runtime:all-srcs", + "//vendor/github.com/go-openapi/spec:all-srcs", + "//vendor/github.com/go-openapi/strfmt:all-srcs", + "//vendor/github.com/go-openapi/swag:all-srcs", + "//vendor/github.com/go-openapi/validate:all-srcs", + "//vendor/github.com/godbus/dbus:all-srcs", + "//vendor/github.com/gogo/protobuf/gogoproto:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/compare:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/defaultcheck:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/description:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/embedcheck:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/enumstringer:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/equal:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/face:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/gostring:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/marshalto:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/oneofcheck:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/populate:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/size:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/stringer:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/testgen:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/union:all-srcs", + "//vendor/github.com/gogo/protobuf/plugin/unmarshal:all-srcs", + "//vendor/github.com/gogo/protobuf/proto:all-srcs", + "//vendor/github.com/gogo/protobuf/protoc-gen-gogo/descriptor:all-srcs", + "//vendor/github.com/gogo/protobuf/protoc-gen-gogo/generator:all-srcs", + "//vendor/github.com/gogo/protobuf/protoc-gen-gogo/grpc:all-srcs", + "//vendor/github.com/gogo/protobuf/protoc-gen-gogo/plugin:all-srcs", + "//vendor/github.com/gogo/protobuf/sortkeys:all-srcs", + "//vendor/github.com/gogo/protobuf/vanity:all-srcs", + "//vendor/github.com/golang/glog:all-srcs", + "//vendor/github.com/golang/groupcache/lru:all-srcs", + "//vendor/github.com/golang/mock/gomock:all-srcs", + "//vendor/github.com/golang/protobuf/jsonpb:all-srcs", + "//vendor/github.com/golang/protobuf/proto:all-srcs", + "//vendor/github.com/golang/protobuf/ptypes:all-srcs", + "//vendor/github.com/google/btree:all-srcs", + "//vendor/github.com/google/cadvisor/api:all-srcs", + "//vendor/github.com/google/cadvisor/cache/memory:all-srcs", + "//vendor/github.com/google/cadvisor/client/v2:all-srcs", + "//vendor/github.com/google/cadvisor/collector:all-srcs", + "//vendor/github.com/google/cadvisor/container:all-srcs", + "//vendor/github.com/google/cadvisor/devicemapper:all-srcs", + "//vendor/github.com/google/cadvisor/events:all-srcs", + "//vendor/github.com/google/cadvisor/fs:all-srcs", + "//vendor/github.com/google/cadvisor/healthz:all-srcs", + "//vendor/github.com/google/cadvisor/http:all-srcs", + "//vendor/github.com/google/cadvisor/info/v1:all-srcs", + "//vendor/github.com/google/cadvisor/info/v2:all-srcs", + "//vendor/github.com/google/cadvisor/machine:all-srcs", + "//vendor/github.com/google/cadvisor/manager:all-srcs", + "//vendor/github.com/google/cadvisor/metrics:all-srcs", + "//vendor/github.com/google/cadvisor/pages:all-srcs", + "//vendor/github.com/google/cadvisor/storage:all-srcs", + "//vendor/github.com/google/cadvisor/summary:all-srcs", + "//vendor/github.com/google/cadvisor/utils:all-srcs", + "//vendor/github.com/google/cadvisor/validate:all-srcs", + "//vendor/github.com/google/cadvisor/version:all-srcs", + "//vendor/github.com/google/cadvisor/zfs:all-srcs", + "//vendor/github.com/google/certificate-transparency/go:all-srcs", + "//vendor/github.com/google/gofuzz:all-srcs", + "//vendor/github.com/googleapis/gnostic/OpenAPIv2:all-srcs", + "//vendor/github.com/googleapis/gnostic/compiler:all-srcs", + "//vendor/github.com/googleapis/gnostic/extensions:all-srcs", + "//vendor/github.com/gophercloud/gophercloud:all-srcs", + "//vendor/github.com/gorilla/context:all-srcs", + "//vendor/github.com/gorilla/mux:all-srcs", + "//vendor/github.com/gorilla/websocket:all-srcs", + "//vendor/github.com/grpc-ecosystem/go-grpc-prometheus:all-srcs", + "//vendor/github.com/grpc-ecosystem/grpc-gateway/runtime:all-srcs", + "//vendor/github.com/grpc-ecosystem/grpc-gateway/utilities:all-srcs", + "//vendor/github.com/hashicorp/golang-lru:all-srcs", + "//vendor/github.com/hashicorp/hcl:all-srcs", + "//vendor/github.com/hawkular/hawkular-client-go/metrics:all-srcs", + "//vendor/github.com/heketi/heketi/client/api/go-client:all-srcs", + "//vendor/github.com/heketi/heketi/pkg/glusterfs/api:all-srcs", + "//vendor/github.com/heketi/heketi/pkg/utils:all-srcs", + "//vendor/github.com/howeyc/gopass:all-srcs", + "//vendor/github.com/imdario/mergo:all-srcs", + "//vendor/github.com/inconshreveable/mousetrap:all-srcs", + "//vendor/github.com/influxdata/influxdb/client:all-srcs", + "//vendor/github.com/influxdata/influxdb/models:all-srcs", + "//vendor/github.com/influxdata/influxdb/pkg/escape:all-srcs", + "//vendor/github.com/jmespath/go-jmespath:all-srcs", + "//vendor/github.com/jonboulle/clockwork:all-srcs", + "//vendor/github.com/jteeuwen/go-bindata:all-srcs", + "//vendor/github.com/juju/ratelimit:all-srcs", + "//vendor/github.com/kardianos/osext:all-srcs", + "//vendor/github.com/karlseguin/ccache:all-srcs", + "//vendor/github.com/kr/fs:all-srcs", + "//vendor/github.com/kr/pty:all-srcs", + "//vendor/github.com/libopenstorage/openstorage/api:all-srcs", + "//vendor/github.com/libopenstorage/openstorage/pkg/units:all-srcs", + "//vendor/github.com/libopenstorage/openstorage/volume:all-srcs", + "//vendor/github.com/lpabon/godbc:all-srcs", + "//vendor/github.com/magiconair/properties:all-srcs", + "//vendor/github.com/mailru/easyjson/buffer:all-srcs", + "//vendor/github.com/mailru/easyjson/jlexer:all-srcs", + "//vendor/github.com/mailru/easyjson/jwriter:all-srcs", + "//vendor/github.com/matttproud/golang_protobuf_extensions/pbutil:all-srcs", + "//vendor/github.com/miekg/coredns/middleware/etcd/msg:all-srcs", + "//vendor/github.com/miekg/dns:all-srcs", + "//vendor/github.com/mistifyio/go-zfs:all-srcs", + "//vendor/github.com/mitchellh/go-wordwrap:all-srcs", + "//vendor/github.com/mitchellh/mapstructure:all-srcs", + "//vendor/github.com/mreiferson/go-httpclient:all-srcs", + "//vendor/github.com/mvdan/xurls:all-srcs", + "//vendor/github.com/mxk/go-flowrate/flowrate:all-srcs", + "//vendor/github.com/onsi/ginkgo:all-srcs", + "//vendor/github.com/onsi/gomega:all-srcs", + "//vendor/github.com/opencontainers/runc/libcontainer:all-srcs", + "//vendor/github.com/pborman/uuid:all-srcs", + "//vendor/github.com/pelletier/go-buffruneio:all-srcs", + "//vendor/github.com/pelletier/go-toml:all-srcs", + "//vendor/github.com/pkg/errors:all-srcs", + "//vendor/github.com/pkg/sftp:all-srcs", + "//vendor/github.com/pmezard/go-difflib/difflib:all-srcs", + "//vendor/github.com/prometheus/client_golang/prometheus:all-srcs", + "//vendor/github.com/prometheus/client_model/go:all-srcs", + "//vendor/github.com/prometheus/common/expfmt:all-srcs", + "//vendor/github.com/prometheus/common/internal/bitbucket.org/ww/goautoneg:all-srcs", + "//vendor/github.com/prometheus/common/model:all-srcs", + "//vendor/github.com/prometheus/procfs:all-srcs", + "//vendor/github.com/quobyte/api:all-srcs", + "//vendor/github.com/rackspace/gophercloud:all-srcs", + "//vendor/github.com/rancher/go-rancher/client:all-srcs", + "//vendor/github.com/renstrom/dedent:all-srcs", + "//vendor/github.com/robfig/cron:all-srcs", + "//vendor/github.com/rubiojr/go-vhd/vhd:all-srcs", + "//vendor/github.com/russross/blackfriday:all-srcs", + "//vendor/github.com/satori/uuid:all-srcs", + "//vendor/github.com/seccomp/libseccomp-golang:all-srcs", + "//vendor/github.com/shurcooL/sanitized_anchor_name:all-srcs", + "//vendor/github.com/spf13/afero:all-srcs", + "//vendor/github.com/spf13/cast:all-srcs", + "//vendor/github.com/spf13/cobra:all-srcs", + "//vendor/github.com/spf13/jwalterweatherman:all-srcs", + "//vendor/github.com/spf13/pflag:all-srcs", + "//vendor/github.com/spf13/viper:all-srcs", + "//vendor/github.com/square/go-jose:all-srcs", + "//vendor/github.com/storageos/go-api:all-srcs", + "//vendor/github.com/stretchr/objx:all-srcs", + "//vendor/github.com/stretchr/testify/assert:all-srcs", + "//vendor/github.com/stretchr/testify/mock:all-srcs", + "//vendor/github.com/stretchr/testify/require:all-srcs", + "//vendor/github.com/syndtr/gocapability/capability:all-srcs", + "//vendor/github.com/ugorji/go/codec:all-srcs", + "//vendor/github.com/vishvananda/netlink:all-srcs", + "//vendor/github.com/vmware/govmomi:all-srcs", + "//vendor/github.com/vmware/photon-controller-go-sdk/SSPI:all-srcs", + "//vendor/github.com/vmware/photon-controller-go-sdk/photon:all-srcs", + "//vendor/github.com/xanzy/go-cloudstack/cloudstack:all-srcs", + "//vendor/github.com/xiang90/probing:all-srcs", + "//vendor/github.com/xyproto/simpleredis:all-srcs", + "//vendor/go.pedge.io/pb/go/google/protobuf:all-srcs", + "//vendor/go4.org/errorutil:all-srcs", + "//vendor/golang.org/x/crypto/bcrypt:all-srcs", + "//vendor/golang.org/x/crypto/blowfish:all-srcs", + "//vendor/golang.org/x/crypto/curve25519:all-srcs", + "//vendor/golang.org/x/crypto/ed25519:all-srcs", + "//vendor/golang.org/x/crypto/nacl/secretbox:all-srcs", + "//vendor/golang.org/x/crypto/pkcs12:all-srcs", + "//vendor/golang.org/x/crypto/poly1305:all-srcs", + "//vendor/golang.org/x/crypto/salsa20/salsa:all-srcs", + "//vendor/golang.org/x/crypto/ssh:all-srcs", + "//vendor/golang.org/x/exp/inotify:all-srcs", + "//vendor/golang.org/x/net/context:all-srcs", + "//vendor/golang.org/x/net/html:all-srcs", + "//vendor/golang.org/x/net/http2:all-srcs", + "//vendor/golang.org/x/net/idna:all-srcs", + "//vendor/golang.org/x/net/internal/timeseries:all-srcs", + "//vendor/golang.org/x/net/lex/httplex:all-srcs", + "//vendor/golang.org/x/net/proxy:all-srcs", + "//vendor/golang.org/x/net/trace:all-srcs", + "//vendor/golang.org/x/net/websocket:all-srcs", + "//vendor/golang.org/x/oauth2:all-srcs", + "//vendor/golang.org/x/sys/unix:all-srcs", + "//vendor/golang.org/x/sys/windows:all-srcs", + "//vendor/golang.org/x/text/cases:all-srcs", + "//vendor/golang.org/x/text/encoding:all-srcs", + "//vendor/golang.org/x/text/internal:all-srcs", + "//vendor/golang.org/x/text/language:all-srcs", + "//vendor/golang.org/x/text/runes:all-srcs", + "//vendor/golang.org/x/text/secure/bidirule:all-srcs", + "//vendor/golang.org/x/text/secure/precis:all-srcs", + "//vendor/golang.org/x/text/transform:all-srcs", + "//vendor/golang.org/x/text/unicode/bidi:all-srcs", + "//vendor/golang.org/x/text/unicode/norm:all-srcs", + "//vendor/golang.org/x/text/width:all-srcs", + "//vendor/golang.org/x/time/rate:all-srcs", + "//vendor/golang.org/x/tools/container/intsets:all-srcs", + "//vendor/google.golang.org/api/cloudkms/v1:all-srcs", + "//vendor/google.golang.org/api/cloudmonitoring/v2beta2:all-srcs", + "//vendor/google.golang.org/api/compute/v0.alpha:all-srcs", + "//vendor/google.golang.org/api/compute/v0.beta:all-srcs", + "//vendor/google.golang.org/api/compute/v1:all-srcs", + "//vendor/google.golang.org/api/container/v1:all-srcs", + "//vendor/google.golang.org/api/dns/v1:all-srcs", + "//vendor/google.golang.org/api/gensupport:all-srcs", + "//vendor/google.golang.org/api/googleapi:all-srcs", + "//vendor/google.golang.org/api/logging/v2beta1:all-srcs", + "//vendor/google.golang.org/api/monitoring/v3:all-srcs", + "//vendor/google.golang.org/api/pubsub/v1:all-srcs", + "//vendor/google.golang.org/genproto/googleapis/rpc/status:all-srcs", + "//vendor/google.golang.org/grpc:all-srcs", + "//vendor/gopkg.in/gcfg.v1:all-srcs", + "//vendor/gopkg.in/inf.v0:all-srcs", + "//vendor/gopkg.in/natefinch/lumberjack.v2:all-srcs", + "//vendor/gopkg.in/warnings.v0:all-srcs", + "//vendor/gopkg.in/yaml.v2:all-srcs", + "//vendor/k8s.io/gengo/args:all-srcs", + "//vendor/k8s.io/gengo/examples/deepcopy-gen/generators:all-srcs", + "//vendor/k8s.io/gengo/examples/defaulter-gen/generators:all-srcs", + "//vendor/k8s.io/gengo/examples/import-boss/generators:all-srcs", + "//vendor/k8s.io/gengo/examples/set-gen/generators:all-srcs", + "//vendor/k8s.io/gengo/examples/set-gen/sets:all-srcs", + "//vendor/k8s.io/gengo/generator:all-srcs", + "//vendor/k8s.io/gengo/namer:all-srcs", + "//vendor/k8s.io/gengo/parser:all-srcs", + "//vendor/k8s.io/gengo/types:all-srcs", + "//vendor/k8s.io/heapster/metrics/api/v1/types:all-srcs", + "//vendor/k8s.io/kube-openapi/pkg/aggregator:all-srcs", + "//vendor/k8s.io/kube-openapi/pkg/builder:all-srcs", + "//vendor/k8s.io/kube-openapi/pkg/common:all-srcs", + "//vendor/k8s.io/kube-openapi/pkg/generators:all-srcs", + "//vendor/k8s.io/kube-openapi/pkg/handler:all-srcs", + "//vendor/k8s.io/kube-openapi/pkg/util:all-srcs", + "//vendor/k8s.io/utils/exec:all-srcs", + "//vendor/vbom.ml/util/sortorder:all-srcs", ], tags = ["automanaged"], ) diff --git a/staging/src/k8s.io/api/Godeps/Godeps.json b/staging/src/k8s.io/api/Godeps/Godeps.json index 0da1215b6b4..babb6ba48c0 100644 --- a/staging/src/k8s.io/api/Godeps/Godeps.json +++ b/staging/src/k8s.io/api/Godeps/Godeps.json @@ -84,59 +84,63 @@ }, { "ImportPath": "golang.org/x/net/http2", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2/hpack", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/idna", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/lex/httplex", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/text/cases", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "golang.org/x/text/internal", + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/internal/tag", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/language", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/runes", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/bidirule", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/precis", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/transform", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/bidi", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/norm", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/width", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "gopkg.in/inf.v0", diff --git a/staging/src/k8s.io/apiextensions-apiserver/Godeps/Godeps.json b/staging/src/k8s.io/apiextensions-apiserver/Godeps/Godeps.json index d55a95c8eaf..329d7254238 100644 --- a/staging/src/k8s.io/apiextensions-apiserver/Godeps/Godeps.json +++ b/staging/src/k8s.io/apiextensions-apiserver/Godeps/Godeps.json @@ -304,43 +304,43 @@ }, { "ImportPath": "golang.org/x/net/context", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/html", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/html/atom", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2/hpack", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/idna", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/internal/timeseries", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/lex/httplex", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/trace", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/websocket", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/sys/unix", @@ -348,79 +348,107 @@ }, { "ImportPath": "golang.org/x/text/cases", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "golang.org/x/text/internal", + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/internal/tag", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/language", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/runes", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/bidirule", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/precis", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/transform", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/bidi", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/norm", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/width", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "google.golang.org/genproto/googleapis/rpc/status", + "Rev": "09f6ed296fc66555a25fe4ce95173148778dfa85" }, { "ImportPath": "google.golang.org/grpc", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/codes", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/credentials", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/grpclb/grpc_lb_v1", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/grpclog", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/internal", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/keepalive", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/metadata", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/naming", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/peer", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/stats", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/status", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/tap", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/transport", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "gopkg.in/inf.v0", diff --git a/staging/src/k8s.io/apimachinery/Godeps/Godeps.json b/staging/src/k8s.io/apimachinery/Godeps/Godeps.json index 8793842a07c..50b644b46b7 100644 --- a/staging/src/k8s.io/apimachinery/Godeps/Godeps.json +++ b/staging/src/k8s.io/apimachinery/Godeps/Godeps.json @@ -136,71 +136,75 @@ }, { "ImportPath": "golang.org/x/net/html", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/html/atom", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2/hpack", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/idna", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/lex/httplex", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/websocket", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/text/cases", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "golang.org/x/text/internal", + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/internal/tag", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/language", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/runes", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/bidirule", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/precis", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/transform", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/bidi", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/norm", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/width", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "gopkg.in/inf.v0", diff --git a/staging/src/k8s.io/apiserver/Godeps/Godeps.json b/staging/src/k8s.io/apiserver/Godeps/Godeps.json index 123f5c9918e..deba2dd8b44 100644 --- a/staging/src/k8s.io/apiserver/Godeps/Godeps.json +++ b/staging/src/k8s.io/apiserver/Godeps/Godeps.json @@ -580,43 +580,43 @@ }, { "ImportPath": "golang.org/x/net/context", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/html", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/html/atom", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2/hpack", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/idna", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/internal/timeseries", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/lex/httplex", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/trace", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/websocket", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/sys/unix", @@ -624,83 +624,111 @@ }, { "ImportPath": "golang.org/x/text/cases", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "golang.org/x/text/internal", + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/internal/tag", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/language", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/runes", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/bidirule", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/precis", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/transform", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/bidi", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/norm", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/width", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/time/rate", "Rev": "f51c12702a4d776e4c1fa9b0fabab841babae631" }, + { + "ImportPath": "google.golang.org/genproto/googleapis/rpc/status", + "Rev": "09f6ed296fc66555a25fe4ce95173148778dfa85" + }, { "ImportPath": "google.golang.org/grpc", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/codes", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/credentials", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/grpclb/grpc_lb_v1", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/grpclog", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/internal", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/keepalive", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/metadata", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/naming", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/peer", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/stats", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/status", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/tap", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/transport", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "gopkg.in/inf.v0", diff --git a/staging/src/k8s.io/client-go/Godeps/Godeps.json b/staging/src/k8s.io/client-go/Godeps/Godeps.json index 5e68697cc6c..1eccbc05712 100644 --- a/staging/src/k8s.io/client-go/Godeps/Godeps.json +++ b/staging/src/k8s.io/client-go/Godeps/Godeps.json @@ -256,27 +256,27 @@ }, { "ImportPath": "golang.org/x/net/context", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/context/ctxhttp", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2/hpack", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/idna", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/lex/httplex", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/oauth2", @@ -304,43 +304,47 @@ }, { "ImportPath": "golang.org/x/text/cases", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "golang.org/x/text/internal", + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/internal/tag", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/language", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/runes", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/bidirule", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/precis", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/transform", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/bidi", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/norm", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/width", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "gopkg.in/inf.v0", diff --git a/staging/src/k8s.io/code-generator/Godeps/Godeps.json b/staging/src/k8s.io/code-generator/Godeps/Godeps.json index 27edd8a3bb4..18ce3e05c1e 100644 --- a/staging/src/k8s.io/code-generator/Godeps/Godeps.json +++ b/staging/src/k8s.io/code-generator/Godeps/Godeps.json @@ -224,59 +224,63 @@ }, { "ImportPath": "golang.org/x/net/http2", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2/hpack", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/idna", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/lex/httplex", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/text/cases", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "golang.org/x/text/internal", + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/internal/tag", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/language", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/runes", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/bidirule", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/precis", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/transform", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/bidi", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/norm", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/width", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "gopkg.in/inf.v0", diff --git a/staging/src/k8s.io/kube-aggregator/Godeps/Godeps.json b/staging/src/k8s.io/kube-aggregator/Godeps/Godeps.json index 46cff8e267b..40e604257a3 100644 --- a/staging/src/k8s.io/kube-aggregator/Godeps/Godeps.json +++ b/staging/src/k8s.io/kube-aggregator/Godeps/Godeps.json @@ -300,43 +300,43 @@ }, { "ImportPath": "golang.org/x/net/context", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/html", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/html/atom", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2/hpack", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/idna", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/internal/timeseries", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/lex/httplex", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/trace", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/websocket", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/sys/unix", @@ -344,79 +344,107 @@ }, { "ImportPath": "golang.org/x/text/cases", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "golang.org/x/text/internal", + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/internal/tag", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/language", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/runes", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/bidirule", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/precis", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/transform", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/bidi", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/norm", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/width", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "google.golang.org/genproto/googleapis/rpc/status", + "Rev": "09f6ed296fc66555a25fe4ce95173148778dfa85" }, { "ImportPath": "google.golang.org/grpc", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/codes", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/credentials", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/grpclb/grpc_lb_v1", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/grpclog", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/internal", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/keepalive", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/metadata", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/naming", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/peer", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/stats", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/status", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/tap", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/transport", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "gopkg.in/inf.v0", diff --git a/staging/src/k8s.io/metrics/Godeps/Godeps.json b/staging/src/k8s.io/metrics/Godeps/Godeps.json index 84161570f62..f3b84309abc 100644 --- a/staging/src/k8s.io/metrics/Godeps/Godeps.json +++ b/staging/src/k8s.io/metrics/Godeps/Godeps.json @@ -124,59 +124,63 @@ }, { "ImportPath": "golang.org/x/net/http2", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2/hpack", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/idna", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/lex/httplex", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/text/cases", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "golang.org/x/text/internal", + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/internal/tag", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/language", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/runes", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/bidirule", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/precis", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/transform", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/bidi", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/norm", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/width", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "gopkg.in/inf.v0", diff --git a/staging/src/k8s.io/sample-apiserver/Godeps/Godeps.json b/staging/src/k8s.io/sample-apiserver/Godeps/Godeps.json index 85d28883145..b258a2ee061 100644 --- a/staging/src/k8s.io/sample-apiserver/Godeps/Godeps.json +++ b/staging/src/k8s.io/sample-apiserver/Godeps/Godeps.json @@ -292,43 +292,43 @@ }, { "ImportPath": "golang.org/x/net/context", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/html", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/html/atom", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/http2/hpack", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/idna", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/internal/timeseries", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/lex/httplex", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/trace", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/net/websocket", - "Rev": "f2499483f923065a842d38eb4c7f1927e6fc6e6d" + "Rev": "1c05540f6879653db88113bc4a2b70aec4bd491f" }, { "ImportPath": "golang.org/x/sys/unix", @@ -336,79 +336,107 @@ }, { "ImportPath": "golang.org/x/text/cases", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "golang.org/x/text/internal", + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/internal/tag", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/language", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/runes", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/bidirule", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/secure/precis", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/transform", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/bidi", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/unicode/norm", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, { "ImportPath": "golang.org/x/text/width", - "Rev": "2910a502d2bf9e43193af9d68ca516529614eed3" + "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" + }, + { + "ImportPath": "google.golang.org/genproto/googleapis/rpc/status", + "Rev": "09f6ed296fc66555a25fe4ce95173148778dfa85" }, { "ImportPath": "google.golang.org/grpc", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/codes", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/credentials", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/grpclb/grpc_lb_v1", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/grpclog", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/internal", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/keepalive", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/metadata", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/naming", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/peer", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/stats", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/status", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" + }, + { + "ImportPath": "google.golang.org/grpc/tap", + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "google.golang.org/grpc/transport", - "Rev": "777daa17ff9b5daef1cfdf915088a2ada3332bf0" + "Rev": "d2e1b51f33ff8c5e4a15560ff049d200e83726c5" }, { "ImportPath": "gopkg.in/inf.v0", diff --git a/vendor/BUILD b/vendor/BUILD deleted file mode 100644 index 340d437d823..00000000000 --- a/vendor/BUILD +++ /dev/null @@ -1,393 +0,0 @@ -filegroup( - name = "package-srcs", - srcs = glob(["**"]), - tags = ["automanaged"], - visibility = ["//visibility:private"], -) - -filegroup( - name = "all-srcs", - srcs = [ - ":package-srcs", - "//vendor/bitbucket.org/bertimus9/systemstat:all-srcs", - "//vendor/bitbucket.org/ww/goautoneg:all-srcs", - "//vendor/cloud.google.com/go/compute/metadata:all-srcs", - "//vendor/cloud.google.com/go/internal:all-srcs", - "//vendor/github.com/Azure/azure-sdk-for-go/arm/compute:all-srcs", - "//vendor/github.com/Azure/azure-sdk-for-go/arm/containerregistry:all-srcs", - "//vendor/github.com/Azure/azure-sdk-for-go/arm/disk:all-srcs", - "//vendor/github.com/Azure/azure-sdk-for-go/arm/network:all-srcs", - "//vendor/github.com/Azure/azure-sdk-for-go/arm/storage:all-srcs", - "//vendor/github.com/Azure/azure-sdk-for-go/storage:all-srcs", - "//vendor/github.com/Azure/go-ansiterm:all-srcs", - "//vendor/github.com/Azure/go-autorest/autorest:all-srcs", - "//vendor/github.com/MakeNowJust/heredoc:all-srcs", - "//vendor/github.com/Microsoft/go-winio:all-srcs", - "//vendor/github.com/NYTimes/gziphandler:all-srcs", - "//vendor/github.com/PuerkitoBio/purell:all-srcs", - "//vendor/github.com/PuerkitoBio/urlesc:all-srcs", - "//vendor/github.com/Sirupsen/logrus:all-srcs", - "//vendor/github.com/abbot/go-http-auth:all-srcs", - "//vendor/github.com/appc/spec/schema:all-srcs", - "//vendor/github.com/armon/circbuf:all-srcs", - "//vendor/github.com/asaskevich/govalidator:all-srcs", - "//vendor/github.com/aws/aws-sdk-go/aws:all-srcs", - "//vendor/github.com/aws/aws-sdk-go/private/protocol:all-srcs", - "//vendor/github.com/aws/aws-sdk-go/private/waiter:all-srcs", - "//vendor/github.com/aws/aws-sdk-go/service/autoscaling:all-srcs", - "//vendor/github.com/aws/aws-sdk-go/service/ec2:all-srcs", - "//vendor/github.com/aws/aws-sdk-go/service/ecr:all-srcs", - "//vendor/github.com/aws/aws-sdk-go/service/elb:all-srcs", - "//vendor/github.com/aws/aws-sdk-go/service/route53:all-srcs", - "//vendor/github.com/aws/aws-sdk-go/service/sts:all-srcs", - "//vendor/github.com/beorn7/perks/quantile:all-srcs", - "//vendor/github.com/blang/semver:all-srcs", - "//vendor/github.com/boltdb/bolt:all-srcs", - "//vendor/github.com/chai2010/gettext-go/gettext:all-srcs", - "//vendor/github.com/cloudflare/cfssl/auth:all-srcs", - "//vendor/github.com/cloudflare/cfssl/certdb:all-srcs", - "//vendor/github.com/cloudflare/cfssl/config:all-srcs", - "//vendor/github.com/cloudflare/cfssl/crypto/pkcs7:all-srcs", - "//vendor/github.com/cloudflare/cfssl/csr:all-srcs", - "//vendor/github.com/cloudflare/cfssl/errors:all-srcs", - "//vendor/github.com/cloudflare/cfssl/helpers:all-srcs", - "//vendor/github.com/cloudflare/cfssl/info:all-srcs", - "//vendor/github.com/cloudflare/cfssl/log:all-srcs", - "//vendor/github.com/cloudflare/cfssl/ocsp/config:all-srcs", - "//vendor/github.com/cloudflare/cfssl/signer:all-srcs", - "//vendor/github.com/clusterhq/flocker-go:all-srcs", - "//vendor/github.com/codedellemc/goscaleio:all-srcs", - "//vendor/github.com/codegangsta/negroni:all-srcs", - "//vendor/github.com/containernetworking/cni/libcni:all-srcs", - "//vendor/github.com/containernetworking/cni/pkg/invoke:all-srcs", - "//vendor/github.com/containernetworking/cni/pkg/types:all-srcs", - "//vendor/github.com/containernetworking/cni/pkg/version:all-srcs", - "//vendor/github.com/coreos/etcd/alarm:all-srcs", - "//vendor/github.com/coreos/etcd/auth:all-srcs", - "//vendor/github.com/coreos/etcd/client:all-srcs", - "//vendor/github.com/coreos/etcd/clientv3:all-srcs", - "//vendor/github.com/coreos/etcd/compactor:all-srcs", - "//vendor/github.com/coreos/etcd/discovery:all-srcs", - "//vendor/github.com/coreos/etcd/error:all-srcs", - "//vendor/github.com/coreos/etcd/etcdserver:all-srcs", - "//vendor/github.com/coreos/etcd/integration:all-srcs", - "//vendor/github.com/coreos/etcd/lease:all-srcs", - "//vendor/github.com/coreos/etcd/mvcc:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/adt:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/contention:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/cpuutil:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/crc:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/fileutil:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/httputil:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/idutil:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/ioutil:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/logutil:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/monotime:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/netutil:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/pathutil:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/pbutil:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/runtime:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/schedule:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/testutil:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/tlsutil:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/transport:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/types:all-srcs", - "//vendor/github.com/coreos/etcd/pkg/wait:all-srcs", - "//vendor/github.com/coreos/etcd/proxy/grpcproxy:all-srcs", - "//vendor/github.com/coreos/etcd/raft:all-srcs", - "//vendor/github.com/coreos/etcd/rafthttp:all-srcs", - "//vendor/github.com/coreos/etcd/snap:all-srcs", - "//vendor/github.com/coreos/etcd/store:all-srcs", - "//vendor/github.com/coreos/etcd/version:all-srcs", - "//vendor/github.com/coreos/etcd/wal:all-srcs", - "//vendor/github.com/coreos/go-oidc/http:all-srcs", - "//vendor/github.com/coreos/go-oidc/jose:all-srcs", - "//vendor/github.com/coreos/go-oidc/key:all-srcs", - "//vendor/github.com/coreos/go-oidc/oauth2:all-srcs", - "//vendor/github.com/coreos/go-oidc/oidc:all-srcs", - "//vendor/github.com/coreos/go-semver/semver:all-srcs", - "//vendor/github.com/coreos/go-systemd/daemon:all-srcs", - "//vendor/github.com/coreos/go-systemd/dbus:all-srcs", - "//vendor/github.com/coreos/go-systemd/journal:all-srcs", - "//vendor/github.com/coreos/go-systemd/unit:all-srcs", - "//vendor/github.com/coreos/go-systemd/util:all-srcs", - "//vendor/github.com/coreos/pkg/capnslog:all-srcs", - "//vendor/github.com/coreos/pkg/dlopen:all-srcs", - "//vendor/github.com/coreos/pkg/health:all-srcs", - "//vendor/github.com/coreos/pkg/httputil:all-srcs", - "//vendor/github.com/coreos/pkg/timeutil:all-srcs", - "//vendor/github.com/coreos/rkt/api/v1alpha:all-srcs", - "//vendor/github.com/cpuguy83/go-md2man/md2man:all-srcs", - "//vendor/github.com/davecgh/go-spew/spew:all-srcs", - "//vendor/github.com/daviddengcn/go-colortext:all-srcs", - "//vendor/github.com/dgrijalva/jwt-go:all-srcs", - "//vendor/github.com/docker/distribution/digest:all-srcs", - "//vendor/github.com/docker/distribution/reference:all-srcs", - "//vendor/github.com/docker/docker/api/types:all-srcs", - "//vendor/github.com/docker/docker/client:all-srcs", - "//vendor/github.com/docker/docker/pkg/jsonlog:all-srcs", - "//vendor/github.com/docker/docker/pkg/jsonmessage:all-srcs", - "//vendor/github.com/docker/docker/pkg/longpath:all-srcs", - "//vendor/github.com/docker/docker/pkg/mount:all-srcs", - "//vendor/github.com/docker/docker/pkg/stdcopy:all-srcs", - "//vendor/github.com/docker/docker/pkg/symlink:all-srcs", - "//vendor/github.com/docker/docker/pkg/system:all-srcs", - "//vendor/github.com/docker/docker/pkg/term:all-srcs", - "//vendor/github.com/docker/docker/pkg/tlsconfig:all-srcs", - "//vendor/github.com/docker/engine-api/client:all-srcs", - "//vendor/github.com/docker/engine-api/types:all-srcs", - "//vendor/github.com/docker/go-connections/nat:all-srcs", - "//vendor/github.com/docker/go-connections/sockets:all-srcs", - "//vendor/github.com/docker/go-connections/tlsconfig:all-srcs", - "//vendor/github.com/docker/go-units:all-srcs", - "//vendor/github.com/docker/spdystream:all-srcs", - "//vendor/github.com/elazarl/go-bindata-assetfs:all-srcs", - "//vendor/github.com/elazarl/goproxy:all-srcs", - "//vendor/github.com/emicklei/go-restful:all-srcs", - "//vendor/github.com/emicklei/go-restful-swagger12:all-srcs", - "//vendor/github.com/evanphx/json-patch:all-srcs", - "//vendor/github.com/exponent-io/jsonpath:all-srcs", - "//vendor/github.com/fatih/camelcase:all-srcs", - "//vendor/github.com/fsnotify/fsnotify:all-srcs", - "//vendor/github.com/garyburd/redigo/internal:all-srcs", - "//vendor/github.com/garyburd/redigo/redis:all-srcs", - "//vendor/github.com/ghodss/yaml:all-srcs", - "//vendor/github.com/go-ini/ini:all-srcs", - "//vendor/github.com/go-openapi/analysis:all-srcs", - "//vendor/github.com/go-openapi/errors:all-srcs", - "//vendor/github.com/go-openapi/jsonpointer:all-srcs", - "//vendor/github.com/go-openapi/jsonreference:all-srcs", - "//vendor/github.com/go-openapi/loads:all-srcs", - "//vendor/github.com/go-openapi/runtime:all-srcs", - "//vendor/github.com/go-openapi/spec:all-srcs", - "//vendor/github.com/go-openapi/strfmt:all-srcs", - "//vendor/github.com/go-openapi/swag:all-srcs", - "//vendor/github.com/go-openapi/validate:all-srcs", - "//vendor/github.com/godbus/dbus:all-srcs", - "//vendor/github.com/gogo/protobuf/gogoproto:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/compare:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/defaultcheck:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/description:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/embedcheck:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/enumstringer:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/equal:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/face:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/gostring:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/marshalto:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/oneofcheck:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/populate:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/size:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/stringer:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/testgen:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/union:all-srcs", - "//vendor/github.com/gogo/protobuf/plugin/unmarshal:all-srcs", - "//vendor/github.com/gogo/protobuf/proto:all-srcs", - "//vendor/github.com/gogo/protobuf/protoc-gen-gogo/descriptor:all-srcs", - "//vendor/github.com/gogo/protobuf/protoc-gen-gogo/generator:all-srcs", - "//vendor/github.com/gogo/protobuf/protoc-gen-gogo/grpc:all-srcs", - "//vendor/github.com/gogo/protobuf/protoc-gen-gogo/plugin:all-srcs", - "//vendor/github.com/gogo/protobuf/sortkeys:all-srcs", - "//vendor/github.com/gogo/protobuf/vanity:all-srcs", - "//vendor/github.com/golang/glog:all-srcs", - "//vendor/github.com/golang/groupcache/lru:all-srcs", - "//vendor/github.com/golang/mock/gomock:all-srcs", - "//vendor/github.com/golang/protobuf/jsonpb:all-srcs", - "//vendor/github.com/golang/protobuf/proto:all-srcs", - "//vendor/github.com/golang/protobuf/ptypes:all-srcs", - "//vendor/github.com/google/btree:all-srcs", - "//vendor/github.com/google/cadvisor/api:all-srcs", - "//vendor/github.com/google/cadvisor/cache/memory:all-srcs", - "//vendor/github.com/google/cadvisor/client/v2:all-srcs", - "//vendor/github.com/google/cadvisor/collector:all-srcs", - "//vendor/github.com/google/cadvisor/container:all-srcs", - "//vendor/github.com/google/cadvisor/devicemapper:all-srcs", - "//vendor/github.com/google/cadvisor/events:all-srcs", - "//vendor/github.com/google/cadvisor/fs:all-srcs", - "//vendor/github.com/google/cadvisor/healthz:all-srcs", - "//vendor/github.com/google/cadvisor/http:all-srcs", - "//vendor/github.com/google/cadvisor/info/v1:all-srcs", - "//vendor/github.com/google/cadvisor/info/v2:all-srcs", - "//vendor/github.com/google/cadvisor/machine:all-srcs", - "//vendor/github.com/google/cadvisor/manager:all-srcs", - "//vendor/github.com/google/cadvisor/metrics:all-srcs", - "//vendor/github.com/google/cadvisor/pages:all-srcs", - "//vendor/github.com/google/cadvisor/storage:all-srcs", - "//vendor/github.com/google/cadvisor/summary:all-srcs", - "//vendor/github.com/google/cadvisor/utils:all-srcs", - "//vendor/github.com/google/cadvisor/validate:all-srcs", - "//vendor/github.com/google/cadvisor/version:all-srcs", - "//vendor/github.com/google/cadvisor/zfs:all-srcs", - "//vendor/github.com/google/certificate-transparency/go:all-srcs", - "//vendor/github.com/google/gofuzz:all-srcs", - "//vendor/github.com/googleapis/gnostic/OpenAPIv2:all-srcs", - "//vendor/github.com/googleapis/gnostic/compiler:all-srcs", - "//vendor/github.com/googleapis/gnostic/extensions:all-srcs", - "//vendor/github.com/gophercloud/gophercloud:all-srcs", - "//vendor/github.com/gorilla/context:all-srcs", - "//vendor/github.com/gorilla/mux:all-srcs", - "//vendor/github.com/gorilla/websocket:all-srcs", - "//vendor/github.com/grpc-ecosystem/go-grpc-prometheus:all-srcs", - "//vendor/github.com/grpc-ecosystem/grpc-gateway/runtime:all-srcs", - "//vendor/github.com/grpc-ecosystem/grpc-gateway/utilities:all-srcs", - "//vendor/github.com/hashicorp/golang-lru:all-srcs", - "//vendor/github.com/hashicorp/hcl:all-srcs", - "//vendor/github.com/hawkular/hawkular-client-go/metrics:all-srcs", - "//vendor/github.com/heketi/heketi/client/api/go-client:all-srcs", - "//vendor/github.com/heketi/heketi/pkg/glusterfs/api:all-srcs", - "//vendor/github.com/heketi/heketi/pkg/utils:all-srcs", - "//vendor/github.com/howeyc/gopass:all-srcs", - "//vendor/github.com/imdario/mergo:all-srcs", - "//vendor/github.com/inconshreveable/mousetrap:all-srcs", - "//vendor/github.com/influxdata/influxdb/client:all-srcs", - "//vendor/github.com/influxdata/influxdb/models:all-srcs", - "//vendor/github.com/influxdata/influxdb/pkg/escape:all-srcs", - "//vendor/github.com/jmespath/go-jmespath:all-srcs", - "//vendor/github.com/jonboulle/clockwork:all-srcs", - "//vendor/github.com/jteeuwen/go-bindata:all-srcs", - "//vendor/github.com/juju/ratelimit:all-srcs", - "//vendor/github.com/kardianos/osext:all-srcs", - "//vendor/github.com/karlseguin/ccache:all-srcs", - "//vendor/github.com/kr/fs:all-srcs", - "//vendor/github.com/kr/pty:all-srcs", - "//vendor/github.com/libopenstorage/openstorage/api:all-srcs", - "//vendor/github.com/libopenstorage/openstorage/pkg/units:all-srcs", - "//vendor/github.com/libopenstorage/openstorage/volume:all-srcs", - "//vendor/github.com/lpabon/godbc:all-srcs", - "//vendor/github.com/magiconair/properties:all-srcs", - "//vendor/github.com/mailru/easyjson/buffer:all-srcs", - "//vendor/github.com/mailru/easyjson/jlexer:all-srcs", - "//vendor/github.com/mailru/easyjson/jwriter:all-srcs", - "//vendor/github.com/matttproud/golang_protobuf_extensions/pbutil:all-srcs", - "//vendor/github.com/miekg/coredns/middleware/etcd/msg:all-srcs", - "//vendor/github.com/miekg/dns:all-srcs", - "//vendor/github.com/mistifyio/go-zfs:all-srcs", - "//vendor/github.com/mitchellh/go-wordwrap:all-srcs", - "//vendor/github.com/mitchellh/mapstructure:all-srcs", - "//vendor/github.com/mreiferson/go-httpclient:all-srcs", - "//vendor/github.com/mvdan/xurls:all-srcs", - "//vendor/github.com/mxk/go-flowrate/flowrate:all-srcs", - "//vendor/github.com/onsi/ginkgo:all-srcs", - "//vendor/github.com/onsi/gomega:all-srcs", - "//vendor/github.com/opencontainers/runc/libcontainer:all-srcs", - "//vendor/github.com/pborman/uuid:all-srcs", - "//vendor/github.com/pelletier/go-buffruneio:all-srcs", - "//vendor/github.com/pelletier/go-toml:all-srcs", - "//vendor/github.com/pkg/errors:all-srcs", - "//vendor/github.com/pkg/sftp:all-srcs", - "//vendor/github.com/pmezard/go-difflib/difflib:all-srcs", - "//vendor/github.com/prometheus/client_golang/prometheus:all-srcs", - "//vendor/github.com/prometheus/client_model/go:all-srcs", - "//vendor/github.com/prometheus/common/expfmt:all-srcs", - "//vendor/github.com/prometheus/common/internal/bitbucket.org/ww/goautoneg:all-srcs", - "//vendor/github.com/prometheus/common/model:all-srcs", - "//vendor/github.com/prometheus/procfs:all-srcs", - "//vendor/github.com/quobyte/api:all-srcs", - "//vendor/github.com/rackspace/gophercloud:all-srcs", - "//vendor/github.com/rancher/go-rancher/client:all-srcs", - "//vendor/github.com/renstrom/dedent:all-srcs", - "//vendor/github.com/robfig/cron:all-srcs", - "//vendor/github.com/rubiojr/go-vhd/vhd:all-srcs", - "//vendor/github.com/russross/blackfriday:all-srcs", - "//vendor/github.com/satori/uuid:all-srcs", - "//vendor/github.com/seccomp/libseccomp-golang:all-srcs", - "//vendor/github.com/shurcooL/sanitized_anchor_name:all-srcs", - "//vendor/github.com/spf13/afero:all-srcs", - "//vendor/github.com/spf13/cast:all-srcs", - "//vendor/github.com/spf13/cobra:all-srcs", - "//vendor/github.com/spf13/jwalterweatherman:all-srcs", - "//vendor/github.com/spf13/pflag:all-srcs", - "//vendor/github.com/spf13/viper:all-srcs", - "//vendor/github.com/square/go-jose:all-srcs", - "//vendor/github.com/storageos/go-api:all-srcs", - "//vendor/github.com/stretchr/objx:all-srcs", - "//vendor/github.com/stretchr/testify/assert:all-srcs", - "//vendor/github.com/stretchr/testify/mock:all-srcs", - "//vendor/github.com/stretchr/testify/require:all-srcs", - "//vendor/github.com/syndtr/gocapability/capability:all-srcs", - "//vendor/github.com/ugorji/go/codec:all-srcs", - "//vendor/github.com/vishvananda/netlink:all-srcs", - "//vendor/github.com/vmware/govmomi:all-srcs", - "//vendor/github.com/vmware/photon-controller-go-sdk/SSPI:all-srcs", - "//vendor/github.com/vmware/photon-controller-go-sdk/photon:all-srcs", - "//vendor/github.com/xanzy/go-cloudstack/cloudstack:all-srcs", - "//vendor/github.com/xiang90/probing:all-srcs", - "//vendor/github.com/xyproto/simpleredis:all-srcs", - "//vendor/go.pedge.io/pb/go/google/protobuf:all-srcs", - "//vendor/go4.org/errorutil:all-srcs", - "//vendor/golang.org/x/crypto/bcrypt:all-srcs", - "//vendor/golang.org/x/crypto/blowfish:all-srcs", - "//vendor/golang.org/x/crypto/curve25519:all-srcs", - "//vendor/golang.org/x/crypto/ed25519:all-srcs", - "//vendor/golang.org/x/crypto/nacl/secretbox:all-srcs", - "//vendor/golang.org/x/crypto/pkcs12:all-srcs", - "//vendor/golang.org/x/crypto/poly1305:all-srcs", - "//vendor/golang.org/x/crypto/salsa20/salsa:all-srcs", - "//vendor/golang.org/x/crypto/ssh:all-srcs", - "//vendor/golang.org/x/exp/inotify:all-srcs", - "//vendor/golang.org/x/net/context:all-srcs", - "//vendor/golang.org/x/net/html:all-srcs", - "//vendor/golang.org/x/net/http2:all-srcs", - "//vendor/golang.org/x/net/idna:all-srcs", - "//vendor/golang.org/x/net/internal/timeseries:all-srcs", - "//vendor/golang.org/x/net/lex/httplex:all-srcs", - "//vendor/golang.org/x/net/proxy:all-srcs", - "//vendor/golang.org/x/net/trace:all-srcs", - "//vendor/golang.org/x/net/websocket:all-srcs", - "//vendor/golang.org/x/oauth2:all-srcs", - "//vendor/golang.org/x/sys/unix:all-srcs", - "//vendor/golang.org/x/sys/windows:all-srcs", - "//vendor/golang.org/x/text/cases:all-srcs", - "//vendor/golang.org/x/text/encoding:all-srcs", - "//vendor/golang.org/x/text/internal/tag:all-srcs", - "//vendor/golang.org/x/text/internal/utf8internal:all-srcs", - "//vendor/golang.org/x/text/language:all-srcs", - "//vendor/golang.org/x/text/runes:all-srcs", - "//vendor/golang.org/x/text/secure/bidirule:all-srcs", - "//vendor/golang.org/x/text/secure/precis:all-srcs", - "//vendor/golang.org/x/text/transform:all-srcs", - "//vendor/golang.org/x/text/unicode/bidi:all-srcs", - "//vendor/golang.org/x/text/unicode/norm:all-srcs", - "//vendor/golang.org/x/text/width:all-srcs", - "//vendor/golang.org/x/time/rate:all-srcs", - "//vendor/golang.org/x/tools/container/intsets:all-srcs", - "//vendor/google.golang.org/api/cloudkms/v1:all-srcs", - "//vendor/google.golang.org/api/cloudmonitoring/v2beta2:all-srcs", - "//vendor/google.golang.org/api/compute/v0.alpha:all-srcs", - "//vendor/google.golang.org/api/compute/v0.beta:all-srcs", - "//vendor/google.golang.org/api/compute/v1:all-srcs", - "//vendor/google.golang.org/api/container/v1:all-srcs", - "//vendor/google.golang.org/api/dns/v1:all-srcs", - "//vendor/google.golang.org/api/gensupport:all-srcs", - "//vendor/google.golang.org/api/googleapi:all-srcs", - "//vendor/google.golang.org/api/logging/v2beta1:all-srcs", - "//vendor/google.golang.org/api/monitoring/v3:all-srcs", - "//vendor/google.golang.org/api/pubsub/v1:all-srcs", - "//vendor/google.golang.org/grpc:all-srcs", - "//vendor/gopkg.in/gcfg.v1:all-srcs", - "//vendor/gopkg.in/inf.v0:all-srcs", - "//vendor/gopkg.in/natefinch/lumberjack.v2:all-srcs", - "//vendor/gopkg.in/warnings.v0:all-srcs", - "//vendor/gopkg.in/yaml.v2:all-srcs", - "//vendor/k8s.io/gengo/args:all-srcs", - "//vendor/k8s.io/gengo/examples/deepcopy-gen/generators:all-srcs", - "//vendor/k8s.io/gengo/examples/defaulter-gen/generators:all-srcs", - "//vendor/k8s.io/gengo/examples/import-boss/generators:all-srcs", - "//vendor/k8s.io/gengo/examples/set-gen/generators:all-srcs", - "//vendor/k8s.io/gengo/examples/set-gen/sets:all-srcs", - "//vendor/k8s.io/gengo/generator:all-srcs", - "//vendor/k8s.io/gengo/namer:all-srcs", - "//vendor/k8s.io/gengo/parser:all-srcs", - "//vendor/k8s.io/gengo/types:all-srcs", - "//vendor/k8s.io/heapster/metrics/api/v1/types:all-srcs", - "//vendor/k8s.io/kube-openapi/pkg/aggregator:all-srcs", - "//vendor/k8s.io/kube-openapi/pkg/builder:all-srcs", - "//vendor/k8s.io/kube-openapi/pkg/common:all-srcs", - "//vendor/k8s.io/kube-openapi/pkg/generators:all-srcs", - "//vendor/k8s.io/kube-openapi/pkg/handler:all-srcs", - "//vendor/k8s.io/kube-openapi/pkg/util:all-srcs", - "//vendor/k8s.io/utils/exec:all-srcs", - "//vendor/vbom.ml/util/sortorder:all-srcs", - ], - tags = ["automanaged"], - visibility = ["//visibility:public"], -) diff --git a/vendor/golang.org/x/net/context/BUILD b/vendor/golang.org/x/net/context/BUILD index 60960035161..09b1fb3fa79 100644 --- a/vendor/golang.org/x/net/context/BUILD +++ b/vendor/golang.org/x/net/context/BUILD @@ -5,7 +5,9 @@ go_library( srcs = [ "context.go", "go17.go", + "go19.go", "pre_go17.go", + "pre_go19.go", ], visibility = ["//visibility:public"], ) diff --git a/vendor/golang.org/x/net/context/context.go b/vendor/golang.org/x/net/context/context.go index ea1a7cd53a1..a25301a76fa 100644 --- a/vendor/golang.org/x/net/context/context.go +++ b/vendor/golang.org/x/net/context/context.go @@ -7,7 +7,7 @@ // and between processes. // // Incoming requests to a server should create a Context, and outgoing calls to -// servers should accept a Context. The chain of function calls between must +// servers should accept a Context. The chain of function calls between must // propagate the Context, optionally replacing it with a modified copy created // using WithDeadline, WithTimeout, WithCancel, or WithValue. // @@ -16,14 +16,14 @@ // propagation: // // Do not store Contexts inside a struct type; instead, pass a Context -// explicitly to each function that needs it. The Context should be the first +// explicitly to each function that needs it. The Context should be the first // parameter, typically named ctx: // // func DoSomething(ctx context.Context, arg Arg) error { // // ... use ctx ... // } // -// Do not pass a nil Context, even if a function permits it. Pass context.TODO +// Do not pass a nil Context, even if a function permits it. Pass context.TODO // if you are unsure about which Context to use. // // Use context Values only for request-scoped data that transits processes and @@ -36,112 +36,15 @@ // Contexts. package context -import "time" - -// A Context carries a deadline, a cancelation signal, and other values across -// API boundaries. -// -// Context's methods may be called by multiple goroutines simultaneously. -type Context interface { - // Deadline returns the time when work done on behalf of this context - // should be canceled. Deadline returns ok==false when no deadline is - // set. Successive calls to Deadline return the same results. - Deadline() (deadline time.Time, ok bool) - - // Done returns a channel that's closed when work done on behalf of this - // context should be canceled. Done may return nil if this context can - // never be canceled. Successive calls to Done return the same value. - // - // WithCancel arranges for Done to be closed when cancel is called; - // WithDeadline arranges for Done to be closed when the deadline - // expires; WithTimeout arranges for Done to be closed when the timeout - // elapses. - // - // Done is provided for use in select statements: - // - // // Stream generates values with DoSomething and sends them to out - // // until DoSomething returns an error or ctx.Done is closed. - // func Stream(ctx context.Context, out chan<- Value) error { - // for { - // v, err := DoSomething(ctx) - // if err != nil { - // return err - // } - // select { - // case <-ctx.Done(): - // return ctx.Err() - // case out <- v: - // } - // } - // } - // - // See http://blog.golang.org/pipelines for more examples of how to use - // a Done channel for cancelation. - Done() <-chan struct{} - - // Err returns a non-nil error value after Done is closed. Err returns - // Canceled if the context was canceled or DeadlineExceeded if the - // context's deadline passed. No other values for Err are defined. - // After Done is closed, successive calls to Err return the same value. - Err() error - - // Value returns the value associated with this context for key, or nil - // if no value is associated with key. Successive calls to Value with - // the same key returns the same result. - // - // Use context values only for request-scoped data that transits - // processes and API boundaries, not for passing optional parameters to - // functions. - // - // A key identifies a specific value in a Context. Functions that wish - // to store values in Context typically allocate a key in a global - // variable then use that key as the argument to context.WithValue and - // Context.Value. A key can be any type that supports equality; - // packages should define keys as an unexported type to avoid - // collisions. - // - // Packages that define a Context key should provide type-safe accessors - // for the values stores using that key: - // - // // Package user defines a User type that's stored in Contexts. - // package user - // - // import "golang.org/x/net/context" - // - // // User is the type of value stored in the Contexts. - // type User struct {...} - // - // // key is an unexported type for keys defined in this package. - // // This prevents collisions with keys defined in other packages. - // type key int - // - // // userKey is the key for user.User values in Contexts. It is - // // unexported; clients use user.NewContext and user.FromContext - // // instead of using this key directly. - // var userKey key = 0 - // - // // NewContext returns a new Context that carries value u. - // func NewContext(ctx context.Context, u *User) context.Context { - // return context.WithValue(ctx, userKey, u) - // } - // - // // FromContext returns the User value stored in ctx, if any. - // func FromContext(ctx context.Context) (*User, bool) { - // u, ok := ctx.Value(userKey).(*User) - // return u, ok - // } - Value(key interface{}) interface{} -} - // Background returns a non-nil, empty Context. It is never canceled, has no -// values, and has no deadline. It is typically used by the main function, +// values, and has no deadline. It is typically used by the main function, // initialization, and tests, and as the top-level Context for incoming // requests. func Background() Context { return background } -// TODO returns a non-nil, empty Context. Code should use context.TODO when +// TODO returns a non-nil, empty Context. Code should use context.TODO when // it's unclear which Context to use or it is not yet available (because the // surrounding function has not yet been extended to accept a Context // parameter). TODO is recognized by static analysis tools that determine @@ -149,8 +52,3 @@ func Background() Context { func TODO() Context { return todo } - -// A CancelFunc tells an operation to abandon its work. -// A CancelFunc does not wait for the work to stop. -// After the first call, subsequent calls to a CancelFunc do nothing. -type CancelFunc func() diff --git a/vendor/golang.org/x/net/context/go17.go b/vendor/golang.org/x/net/context/go17.go index f8cda19adae..d20f52b7de9 100644 --- a/vendor/golang.org/x/net/context/go17.go +++ b/vendor/golang.org/x/net/context/go17.go @@ -35,8 +35,8 @@ func WithCancel(parent Context) (ctx Context, cancel CancelFunc) { } // WithDeadline returns a copy of the parent context with the deadline adjusted -// to be no later than d. If the parent's deadline is already earlier than d, -// WithDeadline(parent, d) is semantically equivalent to parent. The returned +// to be no later than d. If the parent's deadline is already earlier than d, +// WithDeadline(parent, d) is semantically equivalent to parent. The returned // context's Done channel is closed when the deadline expires, when the returned // cancel function is called, or when the parent context's Done channel is // closed, whichever happens first. diff --git a/vendor/golang.org/x/net/context/go19.go b/vendor/golang.org/x/net/context/go19.go new file mode 100644 index 00000000000..d88bd1db127 --- /dev/null +++ b/vendor/golang.org/x/net/context/go19.go @@ -0,0 +1,20 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build go1.9 + +package context + +import "context" // standard library's context, as of Go 1.7 + +// A Context carries a deadline, a cancelation signal, and other values across +// API boundaries. +// +// Context's methods may be called by multiple goroutines simultaneously. +type Context = context.Context + +// A CancelFunc tells an operation to abandon its work. +// A CancelFunc does not wait for the work to stop. +// After the first call, subsequent calls to a CancelFunc do nothing. +type CancelFunc = context.CancelFunc diff --git a/vendor/golang.org/x/net/context/pre_go17.go b/vendor/golang.org/x/net/context/pre_go17.go index 5a30acabd03..0f35592df51 100644 --- a/vendor/golang.org/x/net/context/pre_go17.go +++ b/vendor/golang.org/x/net/context/pre_go17.go @@ -13,7 +13,7 @@ import ( "time" ) -// An emptyCtx is never canceled, has no values, and has no deadline. It is not +// An emptyCtx is never canceled, has no values, and has no deadline. It is not // struct{}, since vars of this type must have distinct addresses. type emptyCtx int @@ -104,7 +104,7 @@ func propagateCancel(parent Context, child canceler) { } // parentCancelCtx follows a chain of parent references until it finds a -// *cancelCtx. This function understands how each of the concrete types in this +// *cancelCtx. This function understands how each of the concrete types in this // package represents its parent. func parentCancelCtx(parent Context) (*cancelCtx, bool) { for { @@ -134,14 +134,14 @@ func removeChild(parent Context, child canceler) { p.mu.Unlock() } -// A canceler is a context type that can be canceled directly. The +// A canceler is a context type that can be canceled directly. The // implementations are *cancelCtx and *timerCtx. type canceler interface { cancel(removeFromParent bool, err error) Done() <-chan struct{} } -// A cancelCtx can be canceled. When canceled, it also cancels any children +// A cancelCtx can be canceled. When canceled, it also cancels any children // that implement canceler. type cancelCtx struct { Context @@ -193,8 +193,8 @@ func (c *cancelCtx) cancel(removeFromParent bool, err error) { } // WithDeadline returns a copy of the parent context with the deadline adjusted -// to be no later than d. If the parent's deadline is already earlier than d, -// WithDeadline(parent, d) is semantically equivalent to parent. The returned +// to be no later than d. If the parent's deadline is already earlier than d, +// WithDeadline(parent, d) is semantically equivalent to parent. The returned // context's Done channel is closed when the deadline expires, when the returned // cancel function is called, or when the parent context's Done channel is // closed, whichever happens first. @@ -226,8 +226,8 @@ func WithDeadline(parent Context, deadline time.Time) (Context, CancelFunc) { return c, func() { c.cancel(true, Canceled) } } -// A timerCtx carries a timer and a deadline. It embeds a cancelCtx to -// implement Done and Err. It implements cancel by stopping its timer then +// A timerCtx carries a timer and a deadline. It embeds a cancelCtx to +// implement Done and Err. It implements cancel by stopping its timer then // delegating to cancelCtx.cancel. type timerCtx struct { *cancelCtx @@ -281,7 +281,7 @@ func WithValue(parent Context, key interface{}, val interface{}) Context { return &valueCtx{parent, key, val} } -// A valueCtx carries a key-value pair. It implements Value for that key and +// A valueCtx carries a key-value pair. It implements Value for that key and // delegates all other calls to the embedded Context. type valueCtx struct { Context diff --git a/vendor/golang.org/x/net/context/pre_go19.go b/vendor/golang.org/x/net/context/pre_go19.go new file mode 100644 index 00000000000..b105f80be4f --- /dev/null +++ b/vendor/golang.org/x/net/context/pre_go19.go @@ -0,0 +1,109 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !go1.9 + +package context + +import "time" + +// A Context carries a deadline, a cancelation signal, and other values across +// API boundaries. +// +// Context's methods may be called by multiple goroutines simultaneously. +type Context interface { + // Deadline returns the time when work done on behalf of this context + // should be canceled. Deadline returns ok==false when no deadline is + // set. Successive calls to Deadline return the same results. + Deadline() (deadline time.Time, ok bool) + + // Done returns a channel that's closed when work done on behalf of this + // context should be canceled. Done may return nil if this context can + // never be canceled. Successive calls to Done return the same value. + // + // WithCancel arranges for Done to be closed when cancel is called; + // WithDeadline arranges for Done to be closed when the deadline + // expires; WithTimeout arranges for Done to be closed when the timeout + // elapses. + // + // Done is provided for use in select statements: + // + // // Stream generates values with DoSomething and sends them to out + // // until DoSomething returns an error or ctx.Done is closed. + // func Stream(ctx context.Context, out chan<- Value) error { + // for { + // v, err := DoSomething(ctx) + // if err != nil { + // return err + // } + // select { + // case <-ctx.Done(): + // return ctx.Err() + // case out <- v: + // } + // } + // } + // + // See http://blog.golang.org/pipelines for more examples of how to use + // a Done channel for cancelation. + Done() <-chan struct{} + + // Err returns a non-nil error value after Done is closed. Err returns + // Canceled if the context was canceled or DeadlineExceeded if the + // context's deadline passed. No other values for Err are defined. + // After Done is closed, successive calls to Err return the same value. + Err() error + + // Value returns the value associated with this context for key, or nil + // if no value is associated with key. Successive calls to Value with + // the same key returns the same result. + // + // Use context values only for request-scoped data that transits + // processes and API boundaries, not for passing optional parameters to + // functions. + // + // A key identifies a specific value in a Context. Functions that wish + // to store values in Context typically allocate a key in a global + // variable then use that key as the argument to context.WithValue and + // Context.Value. A key can be any type that supports equality; + // packages should define keys as an unexported type to avoid + // collisions. + // + // Packages that define a Context key should provide type-safe accessors + // for the values stores using that key: + // + // // Package user defines a User type that's stored in Contexts. + // package user + // + // import "golang.org/x/net/context" + // + // // User is the type of value stored in the Contexts. + // type User struct {...} + // + // // key is an unexported type for keys defined in this package. + // // This prevents collisions with keys defined in other packages. + // type key int + // + // // userKey is the key for user.User values in Contexts. It is + // // unexported; clients use user.NewContext and user.FromContext + // // instead of using this key directly. + // var userKey key = 0 + // + // // NewContext returns a new Context that carries value u. + // func NewContext(ctx context.Context, u *User) context.Context { + // return context.WithValue(ctx, userKey, u) + // } + // + // // FromContext returns the User value stored in ctx, if any. + // func FromContext(ctx context.Context) (*User, bool) { + // u, ok := ctx.Value(userKey).(*User) + // return u, ok + // } + Value(key interface{}) interface{} +} + +// A CancelFunc tells an operation to abandon its work. +// A CancelFunc does not wait for the work to stop. +// After the first call, subsequent calls to a CancelFunc do nothing. +type CancelFunc func() diff --git a/vendor/golang.org/x/net/http2/BUILD b/vendor/golang.org/x/net/http2/BUILD index 0a361dc209b..0fedd97ebeb 100644 --- a/vendor/golang.org/x/net/http2/BUILD +++ b/vendor/golang.org/x/net/http2/BUILD @@ -3,22 +3,25 @@ load("@io_bazel_rules_go//go:def.bzl", "go_library") go_library( name = "go_default_library", srcs = [ + "ciphers.go", "client_conn_pool.go", "configure_transport.go", + "databuffer.go", "errors.go", - "fixed_buffer.go", "flow.go", "frame.go", "go16.go", "go17.go", "go17_not18.go", "go18.go", + "go19.go", "gotrack.go", "headermap.go", "http2.go", "not_go16.go", "not_go17.go", "not_go18.go", + "not_go19.go", "pipe.go", "server.go", "transport.go", diff --git a/vendor/golang.org/x/net/http2/ciphers.go b/vendor/golang.org/x/net/http2/ciphers.go new file mode 100644 index 00000000000..698860b7775 --- /dev/null +++ b/vendor/golang.org/x/net/http2/ciphers.go @@ -0,0 +1,641 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package http2 + +// A list of the possible cipher suite ids. Taken from +// http://www.iana.org/assignments/tls-parameters/tls-parameters.txt + +const ( + cipher_TLS_NULL_WITH_NULL_NULL uint16 = 0x0000 + cipher_TLS_RSA_WITH_NULL_MD5 uint16 = 0x0001 + cipher_TLS_RSA_WITH_NULL_SHA uint16 = 0x0002 + cipher_TLS_RSA_EXPORT_WITH_RC4_40_MD5 uint16 = 0x0003 + cipher_TLS_RSA_WITH_RC4_128_MD5 uint16 = 0x0004 + cipher_TLS_RSA_WITH_RC4_128_SHA uint16 = 0x0005 + cipher_TLS_RSA_EXPORT_WITH_RC2_CBC_40_MD5 uint16 = 0x0006 + cipher_TLS_RSA_WITH_IDEA_CBC_SHA uint16 = 0x0007 + cipher_TLS_RSA_EXPORT_WITH_DES40_CBC_SHA uint16 = 0x0008 + cipher_TLS_RSA_WITH_DES_CBC_SHA uint16 = 0x0009 + cipher_TLS_RSA_WITH_3DES_EDE_CBC_SHA uint16 = 0x000A + cipher_TLS_DH_DSS_EXPORT_WITH_DES40_CBC_SHA uint16 = 0x000B + cipher_TLS_DH_DSS_WITH_DES_CBC_SHA uint16 = 0x000C + cipher_TLS_DH_DSS_WITH_3DES_EDE_CBC_SHA uint16 = 0x000D + cipher_TLS_DH_RSA_EXPORT_WITH_DES40_CBC_SHA uint16 = 0x000E + cipher_TLS_DH_RSA_WITH_DES_CBC_SHA uint16 = 0x000F + cipher_TLS_DH_RSA_WITH_3DES_EDE_CBC_SHA uint16 = 0x0010 + cipher_TLS_DHE_DSS_EXPORT_WITH_DES40_CBC_SHA uint16 = 0x0011 + cipher_TLS_DHE_DSS_WITH_DES_CBC_SHA uint16 = 0x0012 + cipher_TLS_DHE_DSS_WITH_3DES_EDE_CBC_SHA uint16 = 0x0013 + cipher_TLS_DHE_RSA_EXPORT_WITH_DES40_CBC_SHA uint16 = 0x0014 + cipher_TLS_DHE_RSA_WITH_DES_CBC_SHA uint16 = 0x0015 + cipher_TLS_DHE_RSA_WITH_3DES_EDE_CBC_SHA uint16 = 0x0016 + cipher_TLS_DH_anon_EXPORT_WITH_RC4_40_MD5 uint16 = 0x0017 + cipher_TLS_DH_anon_WITH_RC4_128_MD5 uint16 = 0x0018 + cipher_TLS_DH_anon_EXPORT_WITH_DES40_CBC_SHA uint16 = 0x0019 + cipher_TLS_DH_anon_WITH_DES_CBC_SHA uint16 = 0x001A + cipher_TLS_DH_anon_WITH_3DES_EDE_CBC_SHA uint16 = 0x001B + // Reserved uint16 = 0x001C-1D + cipher_TLS_KRB5_WITH_DES_CBC_SHA uint16 = 0x001E + cipher_TLS_KRB5_WITH_3DES_EDE_CBC_SHA uint16 = 0x001F + cipher_TLS_KRB5_WITH_RC4_128_SHA uint16 = 0x0020 + cipher_TLS_KRB5_WITH_IDEA_CBC_SHA uint16 = 0x0021 + cipher_TLS_KRB5_WITH_DES_CBC_MD5 uint16 = 0x0022 + cipher_TLS_KRB5_WITH_3DES_EDE_CBC_MD5 uint16 = 0x0023 + cipher_TLS_KRB5_WITH_RC4_128_MD5 uint16 = 0x0024 + cipher_TLS_KRB5_WITH_IDEA_CBC_MD5 uint16 = 0x0025 + cipher_TLS_KRB5_EXPORT_WITH_DES_CBC_40_SHA uint16 = 0x0026 + cipher_TLS_KRB5_EXPORT_WITH_RC2_CBC_40_SHA uint16 = 0x0027 + cipher_TLS_KRB5_EXPORT_WITH_RC4_40_SHA uint16 = 0x0028 + cipher_TLS_KRB5_EXPORT_WITH_DES_CBC_40_MD5 uint16 = 0x0029 + cipher_TLS_KRB5_EXPORT_WITH_RC2_CBC_40_MD5 uint16 = 0x002A + cipher_TLS_KRB5_EXPORT_WITH_RC4_40_MD5 uint16 = 0x002B + cipher_TLS_PSK_WITH_NULL_SHA uint16 = 0x002C + cipher_TLS_DHE_PSK_WITH_NULL_SHA uint16 = 0x002D + cipher_TLS_RSA_PSK_WITH_NULL_SHA uint16 = 0x002E + cipher_TLS_RSA_WITH_AES_128_CBC_SHA uint16 = 0x002F + cipher_TLS_DH_DSS_WITH_AES_128_CBC_SHA uint16 = 0x0030 + cipher_TLS_DH_RSA_WITH_AES_128_CBC_SHA uint16 = 0x0031 + cipher_TLS_DHE_DSS_WITH_AES_128_CBC_SHA uint16 = 0x0032 + cipher_TLS_DHE_RSA_WITH_AES_128_CBC_SHA uint16 = 0x0033 + cipher_TLS_DH_anon_WITH_AES_128_CBC_SHA uint16 = 0x0034 + cipher_TLS_RSA_WITH_AES_256_CBC_SHA uint16 = 0x0035 + cipher_TLS_DH_DSS_WITH_AES_256_CBC_SHA uint16 = 0x0036 + cipher_TLS_DH_RSA_WITH_AES_256_CBC_SHA uint16 = 0x0037 + cipher_TLS_DHE_DSS_WITH_AES_256_CBC_SHA uint16 = 0x0038 + cipher_TLS_DHE_RSA_WITH_AES_256_CBC_SHA uint16 = 0x0039 + cipher_TLS_DH_anon_WITH_AES_256_CBC_SHA uint16 = 0x003A + cipher_TLS_RSA_WITH_NULL_SHA256 uint16 = 0x003B + cipher_TLS_RSA_WITH_AES_128_CBC_SHA256 uint16 = 0x003C + cipher_TLS_RSA_WITH_AES_256_CBC_SHA256 uint16 = 0x003D + cipher_TLS_DH_DSS_WITH_AES_128_CBC_SHA256 uint16 = 0x003E + cipher_TLS_DH_RSA_WITH_AES_128_CBC_SHA256 uint16 = 0x003F + cipher_TLS_DHE_DSS_WITH_AES_128_CBC_SHA256 uint16 = 0x0040 + cipher_TLS_RSA_WITH_CAMELLIA_128_CBC_SHA uint16 = 0x0041 + cipher_TLS_DH_DSS_WITH_CAMELLIA_128_CBC_SHA uint16 = 0x0042 + cipher_TLS_DH_RSA_WITH_CAMELLIA_128_CBC_SHA uint16 = 0x0043 + cipher_TLS_DHE_DSS_WITH_CAMELLIA_128_CBC_SHA uint16 = 0x0044 + cipher_TLS_DHE_RSA_WITH_CAMELLIA_128_CBC_SHA uint16 = 0x0045 + cipher_TLS_DH_anon_WITH_CAMELLIA_128_CBC_SHA uint16 = 0x0046 + // Reserved uint16 = 0x0047-4F + // Reserved uint16 = 0x0050-58 + // Reserved uint16 = 0x0059-5C + // Unassigned uint16 = 0x005D-5F + // Reserved uint16 = 0x0060-66 + cipher_TLS_DHE_RSA_WITH_AES_128_CBC_SHA256 uint16 = 0x0067 + cipher_TLS_DH_DSS_WITH_AES_256_CBC_SHA256 uint16 = 0x0068 + cipher_TLS_DH_RSA_WITH_AES_256_CBC_SHA256 uint16 = 0x0069 + cipher_TLS_DHE_DSS_WITH_AES_256_CBC_SHA256 uint16 = 0x006A + cipher_TLS_DHE_RSA_WITH_AES_256_CBC_SHA256 uint16 = 0x006B + cipher_TLS_DH_anon_WITH_AES_128_CBC_SHA256 uint16 = 0x006C + cipher_TLS_DH_anon_WITH_AES_256_CBC_SHA256 uint16 = 0x006D + // Unassigned uint16 = 0x006E-83 + cipher_TLS_RSA_WITH_CAMELLIA_256_CBC_SHA uint16 = 0x0084 + cipher_TLS_DH_DSS_WITH_CAMELLIA_256_CBC_SHA uint16 = 0x0085 + cipher_TLS_DH_RSA_WITH_CAMELLIA_256_CBC_SHA uint16 = 0x0086 + cipher_TLS_DHE_DSS_WITH_CAMELLIA_256_CBC_SHA uint16 = 0x0087 + cipher_TLS_DHE_RSA_WITH_CAMELLIA_256_CBC_SHA uint16 = 0x0088 + cipher_TLS_DH_anon_WITH_CAMELLIA_256_CBC_SHA uint16 = 0x0089 + cipher_TLS_PSK_WITH_RC4_128_SHA uint16 = 0x008A + cipher_TLS_PSK_WITH_3DES_EDE_CBC_SHA uint16 = 0x008B + cipher_TLS_PSK_WITH_AES_128_CBC_SHA uint16 = 0x008C + cipher_TLS_PSK_WITH_AES_256_CBC_SHA uint16 = 0x008D + cipher_TLS_DHE_PSK_WITH_RC4_128_SHA uint16 = 0x008E + cipher_TLS_DHE_PSK_WITH_3DES_EDE_CBC_SHA uint16 = 0x008F + cipher_TLS_DHE_PSK_WITH_AES_128_CBC_SHA uint16 = 0x0090 + cipher_TLS_DHE_PSK_WITH_AES_256_CBC_SHA uint16 = 0x0091 + cipher_TLS_RSA_PSK_WITH_RC4_128_SHA uint16 = 0x0092 + cipher_TLS_RSA_PSK_WITH_3DES_EDE_CBC_SHA uint16 = 0x0093 + cipher_TLS_RSA_PSK_WITH_AES_128_CBC_SHA uint16 = 0x0094 + cipher_TLS_RSA_PSK_WITH_AES_256_CBC_SHA uint16 = 0x0095 + cipher_TLS_RSA_WITH_SEED_CBC_SHA uint16 = 0x0096 + cipher_TLS_DH_DSS_WITH_SEED_CBC_SHA uint16 = 0x0097 + cipher_TLS_DH_RSA_WITH_SEED_CBC_SHA uint16 = 0x0098 + cipher_TLS_DHE_DSS_WITH_SEED_CBC_SHA uint16 = 0x0099 + cipher_TLS_DHE_RSA_WITH_SEED_CBC_SHA uint16 = 0x009A + cipher_TLS_DH_anon_WITH_SEED_CBC_SHA uint16 = 0x009B + cipher_TLS_RSA_WITH_AES_128_GCM_SHA256 uint16 = 0x009C + cipher_TLS_RSA_WITH_AES_256_GCM_SHA384 uint16 = 0x009D + cipher_TLS_DHE_RSA_WITH_AES_128_GCM_SHA256 uint16 = 0x009E + cipher_TLS_DHE_RSA_WITH_AES_256_GCM_SHA384 uint16 = 0x009F + cipher_TLS_DH_RSA_WITH_AES_128_GCM_SHA256 uint16 = 0x00A0 + cipher_TLS_DH_RSA_WITH_AES_256_GCM_SHA384 uint16 = 0x00A1 + cipher_TLS_DHE_DSS_WITH_AES_128_GCM_SHA256 uint16 = 0x00A2 + cipher_TLS_DHE_DSS_WITH_AES_256_GCM_SHA384 uint16 = 0x00A3 + cipher_TLS_DH_DSS_WITH_AES_128_GCM_SHA256 uint16 = 0x00A4 + cipher_TLS_DH_DSS_WITH_AES_256_GCM_SHA384 uint16 = 0x00A5 + cipher_TLS_DH_anon_WITH_AES_128_GCM_SHA256 uint16 = 0x00A6 + cipher_TLS_DH_anon_WITH_AES_256_GCM_SHA384 uint16 = 0x00A7 + cipher_TLS_PSK_WITH_AES_128_GCM_SHA256 uint16 = 0x00A8 + cipher_TLS_PSK_WITH_AES_256_GCM_SHA384 uint16 = 0x00A9 + cipher_TLS_DHE_PSK_WITH_AES_128_GCM_SHA256 uint16 = 0x00AA + cipher_TLS_DHE_PSK_WITH_AES_256_GCM_SHA384 uint16 = 0x00AB + cipher_TLS_RSA_PSK_WITH_AES_128_GCM_SHA256 uint16 = 0x00AC + cipher_TLS_RSA_PSK_WITH_AES_256_GCM_SHA384 uint16 = 0x00AD + cipher_TLS_PSK_WITH_AES_128_CBC_SHA256 uint16 = 0x00AE + cipher_TLS_PSK_WITH_AES_256_CBC_SHA384 uint16 = 0x00AF + cipher_TLS_PSK_WITH_NULL_SHA256 uint16 = 0x00B0 + cipher_TLS_PSK_WITH_NULL_SHA384 uint16 = 0x00B1 + cipher_TLS_DHE_PSK_WITH_AES_128_CBC_SHA256 uint16 = 0x00B2 + cipher_TLS_DHE_PSK_WITH_AES_256_CBC_SHA384 uint16 = 0x00B3 + cipher_TLS_DHE_PSK_WITH_NULL_SHA256 uint16 = 0x00B4 + cipher_TLS_DHE_PSK_WITH_NULL_SHA384 uint16 = 0x00B5 + cipher_TLS_RSA_PSK_WITH_AES_128_CBC_SHA256 uint16 = 0x00B6 + cipher_TLS_RSA_PSK_WITH_AES_256_CBC_SHA384 uint16 = 0x00B7 + cipher_TLS_RSA_PSK_WITH_NULL_SHA256 uint16 = 0x00B8 + cipher_TLS_RSA_PSK_WITH_NULL_SHA384 uint16 = 0x00B9 + cipher_TLS_RSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0x00BA + cipher_TLS_DH_DSS_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0x00BB + cipher_TLS_DH_RSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0x00BC + cipher_TLS_DHE_DSS_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0x00BD + cipher_TLS_DHE_RSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0x00BE + cipher_TLS_DH_anon_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0x00BF + cipher_TLS_RSA_WITH_CAMELLIA_256_CBC_SHA256 uint16 = 0x00C0 + cipher_TLS_DH_DSS_WITH_CAMELLIA_256_CBC_SHA256 uint16 = 0x00C1 + cipher_TLS_DH_RSA_WITH_CAMELLIA_256_CBC_SHA256 uint16 = 0x00C2 + cipher_TLS_DHE_DSS_WITH_CAMELLIA_256_CBC_SHA256 uint16 = 0x00C3 + cipher_TLS_DHE_RSA_WITH_CAMELLIA_256_CBC_SHA256 uint16 = 0x00C4 + cipher_TLS_DH_anon_WITH_CAMELLIA_256_CBC_SHA256 uint16 = 0x00C5 + // Unassigned uint16 = 0x00C6-FE + cipher_TLS_EMPTY_RENEGOTIATION_INFO_SCSV uint16 = 0x00FF + // Unassigned uint16 = 0x01-55,* + cipher_TLS_FALLBACK_SCSV uint16 = 0x5600 + // Unassigned uint16 = 0x5601 - 0xC000 + cipher_TLS_ECDH_ECDSA_WITH_NULL_SHA uint16 = 0xC001 + cipher_TLS_ECDH_ECDSA_WITH_RC4_128_SHA uint16 = 0xC002 + cipher_TLS_ECDH_ECDSA_WITH_3DES_EDE_CBC_SHA uint16 = 0xC003 + cipher_TLS_ECDH_ECDSA_WITH_AES_128_CBC_SHA uint16 = 0xC004 + cipher_TLS_ECDH_ECDSA_WITH_AES_256_CBC_SHA uint16 = 0xC005 + cipher_TLS_ECDHE_ECDSA_WITH_NULL_SHA uint16 = 0xC006 + cipher_TLS_ECDHE_ECDSA_WITH_RC4_128_SHA uint16 = 0xC007 + cipher_TLS_ECDHE_ECDSA_WITH_3DES_EDE_CBC_SHA uint16 = 0xC008 + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA uint16 = 0xC009 + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA uint16 = 0xC00A + cipher_TLS_ECDH_RSA_WITH_NULL_SHA uint16 = 0xC00B + cipher_TLS_ECDH_RSA_WITH_RC4_128_SHA uint16 = 0xC00C + cipher_TLS_ECDH_RSA_WITH_3DES_EDE_CBC_SHA uint16 = 0xC00D + cipher_TLS_ECDH_RSA_WITH_AES_128_CBC_SHA uint16 = 0xC00E + cipher_TLS_ECDH_RSA_WITH_AES_256_CBC_SHA uint16 = 0xC00F + cipher_TLS_ECDHE_RSA_WITH_NULL_SHA uint16 = 0xC010 + cipher_TLS_ECDHE_RSA_WITH_RC4_128_SHA uint16 = 0xC011 + cipher_TLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHA uint16 = 0xC012 + cipher_TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA uint16 = 0xC013 + cipher_TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA uint16 = 0xC014 + cipher_TLS_ECDH_anon_WITH_NULL_SHA uint16 = 0xC015 + cipher_TLS_ECDH_anon_WITH_RC4_128_SHA uint16 = 0xC016 + cipher_TLS_ECDH_anon_WITH_3DES_EDE_CBC_SHA uint16 = 0xC017 + cipher_TLS_ECDH_anon_WITH_AES_128_CBC_SHA uint16 = 0xC018 + cipher_TLS_ECDH_anon_WITH_AES_256_CBC_SHA uint16 = 0xC019 + cipher_TLS_SRP_SHA_WITH_3DES_EDE_CBC_SHA uint16 = 0xC01A + cipher_TLS_SRP_SHA_RSA_WITH_3DES_EDE_CBC_SHA uint16 = 0xC01B + cipher_TLS_SRP_SHA_DSS_WITH_3DES_EDE_CBC_SHA uint16 = 0xC01C + cipher_TLS_SRP_SHA_WITH_AES_128_CBC_SHA uint16 = 0xC01D + cipher_TLS_SRP_SHA_RSA_WITH_AES_128_CBC_SHA uint16 = 0xC01E + cipher_TLS_SRP_SHA_DSS_WITH_AES_128_CBC_SHA uint16 = 0xC01F + cipher_TLS_SRP_SHA_WITH_AES_256_CBC_SHA uint16 = 0xC020 + cipher_TLS_SRP_SHA_RSA_WITH_AES_256_CBC_SHA uint16 = 0xC021 + cipher_TLS_SRP_SHA_DSS_WITH_AES_256_CBC_SHA uint16 = 0xC022 + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256 uint16 = 0xC023 + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA384 uint16 = 0xC024 + cipher_TLS_ECDH_ECDSA_WITH_AES_128_CBC_SHA256 uint16 = 0xC025 + cipher_TLS_ECDH_ECDSA_WITH_AES_256_CBC_SHA384 uint16 = 0xC026 + cipher_TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256 uint16 = 0xC027 + cipher_TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384 uint16 = 0xC028 + cipher_TLS_ECDH_RSA_WITH_AES_128_CBC_SHA256 uint16 = 0xC029 + cipher_TLS_ECDH_RSA_WITH_AES_256_CBC_SHA384 uint16 = 0xC02A + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256 uint16 = 0xC02B + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384 uint16 = 0xC02C + cipher_TLS_ECDH_ECDSA_WITH_AES_128_GCM_SHA256 uint16 = 0xC02D + cipher_TLS_ECDH_ECDSA_WITH_AES_256_GCM_SHA384 uint16 = 0xC02E + cipher_TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256 uint16 = 0xC02F + cipher_TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 uint16 = 0xC030 + cipher_TLS_ECDH_RSA_WITH_AES_128_GCM_SHA256 uint16 = 0xC031 + cipher_TLS_ECDH_RSA_WITH_AES_256_GCM_SHA384 uint16 = 0xC032 + cipher_TLS_ECDHE_PSK_WITH_RC4_128_SHA uint16 = 0xC033 + cipher_TLS_ECDHE_PSK_WITH_3DES_EDE_CBC_SHA uint16 = 0xC034 + cipher_TLS_ECDHE_PSK_WITH_AES_128_CBC_SHA uint16 = 0xC035 + cipher_TLS_ECDHE_PSK_WITH_AES_256_CBC_SHA uint16 = 0xC036 + cipher_TLS_ECDHE_PSK_WITH_AES_128_CBC_SHA256 uint16 = 0xC037 + cipher_TLS_ECDHE_PSK_WITH_AES_256_CBC_SHA384 uint16 = 0xC038 + cipher_TLS_ECDHE_PSK_WITH_NULL_SHA uint16 = 0xC039 + cipher_TLS_ECDHE_PSK_WITH_NULL_SHA256 uint16 = 0xC03A + cipher_TLS_ECDHE_PSK_WITH_NULL_SHA384 uint16 = 0xC03B + cipher_TLS_RSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC03C + cipher_TLS_RSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC03D + cipher_TLS_DH_DSS_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC03E + cipher_TLS_DH_DSS_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC03F + cipher_TLS_DH_RSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC040 + cipher_TLS_DH_RSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC041 + cipher_TLS_DHE_DSS_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC042 + cipher_TLS_DHE_DSS_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC043 + cipher_TLS_DHE_RSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC044 + cipher_TLS_DHE_RSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC045 + cipher_TLS_DH_anon_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC046 + cipher_TLS_DH_anon_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC047 + cipher_TLS_ECDHE_ECDSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC048 + cipher_TLS_ECDHE_ECDSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC049 + cipher_TLS_ECDH_ECDSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC04A + cipher_TLS_ECDH_ECDSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC04B + cipher_TLS_ECDHE_RSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC04C + cipher_TLS_ECDHE_RSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC04D + cipher_TLS_ECDH_RSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC04E + cipher_TLS_ECDH_RSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC04F + cipher_TLS_RSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC050 + cipher_TLS_RSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC051 + cipher_TLS_DHE_RSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC052 + cipher_TLS_DHE_RSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC053 + cipher_TLS_DH_RSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC054 + cipher_TLS_DH_RSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC055 + cipher_TLS_DHE_DSS_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC056 + cipher_TLS_DHE_DSS_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC057 + cipher_TLS_DH_DSS_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC058 + cipher_TLS_DH_DSS_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC059 + cipher_TLS_DH_anon_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC05A + cipher_TLS_DH_anon_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC05B + cipher_TLS_ECDHE_ECDSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC05C + cipher_TLS_ECDHE_ECDSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC05D + cipher_TLS_ECDH_ECDSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC05E + cipher_TLS_ECDH_ECDSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC05F + cipher_TLS_ECDHE_RSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC060 + cipher_TLS_ECDHE_RSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC061 + cipher_TLS_ECDH_RSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC062 + cipher_TLS_ECDH_RSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC063 + cipher_TLS_PSK_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC064 + cipher_TLS_PSK_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC065 + cipher_TLS_DHE_PSK_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC066 + cipher_TLS_DHE_PSK_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC067 + cipher_TLS_RSA_PSK_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC068 + cipher_TLS_RSA_PSK_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC069 + cipher_TLS_PSK_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC06A + cipher_TLS_PSK_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC06B + cipher_TLS_DHE_PSK_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC06C + cipher_TLS_DHE_PSK_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC06D + cipher_TLS_RSA_PSK_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC06E + cipher_TLS_RSA_PSK_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC06F + cipher_TLS_ECDHE_PSK_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC070 + cipher_TLS_ECDHE_PSK_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC071 + cipher_TLS_ECDHE_ECDSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC072 + cipher_TLS_ECDHE_ECDSA_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC073 + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC074 + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC075 + cipher_TLS_ECDHE_RSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC076 + cipher_TLS_ECDHE_RSA_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC077 + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC078 + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC079 + cipher_TLS_RSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC07A + cipher_TLS_RSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC07B + cipher_TLS_DHE_RSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC07C + cipher_TLS_DHE_RSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC07D + cipher_TLS_DH_RSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC07E + cipher_TLS_DH_RSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC07F + cipher_TLS_DHE_DSS_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC080 + cipher_TLS_DHE_DSS_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC081 + cipher_TLS_DH_DSS_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC082 + cipher_TLS_DH_DSS_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC083 + cipher_TLS_DH_anon_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC084 + cipher_TLS_DH_anon_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC085 + cipher_TLS_ECDHE_ECDSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC086 + cipher_TLS_ECDHE_ECDSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC087 + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC088 + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC089 + cipher_TLS_ECDHE_RSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC08A + cipher_TLS_ECDHE_RSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC08B + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC08C + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC08D + cipher_TLS_PSK_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC08E + cipher_TLS_PSK_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC08F + cipher_TLS_DHE_PSK_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC090 + cipher_TLS_DHE_PSK_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC091 + cipher_TLS_RSA_PSK_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC092 + cipher_TLS_RSA_PSK_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC093 + cipher_TLS_PSK_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC094 + cipher_TLS_PSK_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC095 + cipher_TLS_DHE_PSK_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC096 + cipher_TLS_DHE_PSK_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC097 + cipher_TLS_RSA_PSK_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC098 + cipher_TLS_RSA_PSK_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC099 + cipher_TLS_ECDHE_PSK_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC09A + cipher_TLS_ECDHE_PSK_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC09B + cipher_TLS_RSA_WITH_AES_128_CCM uint16 = 0xC09C + cipher_TLS_RSA_WITH_AES_256_CCM uint16 = 0xC09D + cipher_TLS_DHE_RSA_WITH_AES_128_CCM uint16 = 0xC09E + cipher_TLS_DHE_RSA_WITH_AES_256_CCM uint16 = 0xC09F + cipher_TLS_RSA_WITH_AES_128_CCM_8 uint16 = 0xC0A0 + cipher_TLS_RSA_WITH_AES_256_CCM_8 uint16 = 0xC0A1 + cipher_TLS_DHE_RSA_WITH_AES_128_CCM_8 uint16 = 0xC0A2 + cipher_TLS_DHE_RSA_WITH_AES_256_CCM_8 uint16 = 0xC0A3 + cipher_TLS_PSK_WITH_AES_128_CCM uint16 = 0xC0A4 + cipher_TLS_PSK_WITH_AES_256_CCM uint16 = 0xC0A5 + cipher_TLS_DHE_PSK_WITH_AES_128_CCM uint16 = 0xC0A6 + cipher_TLS_DHE_PSK_WITH_AES_256_CCM uint16 = 0xC0A7 + cipher_TLS_PSK_WITH_AES_128_CCM_8 uint16 = 0xC0A8 + cipher_TLS_PSK_WITH_AES_256_CCM_8 uint16 = 0xC0A9 + cipher_TLS_PSK_DHE_WITH_AES_128_CCM_8 uint16 = 0xC0AA + cipher_TLS_PSK_DHE_WITH_AES_256_CCM_8 uint16 = 0xC0AB + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_CCM uint16 = 0xC0AC + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_CCM uint16 = 0xC0AD + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_CCM_8 uint16 = 0xC0AE + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_CCM_8 uint16 = 0xC0AF + // Unassigned uint16 = 0xC0B0-FF + // Unassigned uint16 = 0xC1-CB,* + // Unassigned uint16 = 0xCC00-A7 + cipher_TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCA8 + cipher_TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCA9 + cipher_TLS_DHE_RSA_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCAA + cipher_TLS_PSK_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCAB + cipher_TLS_ECDHE_PSK_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCAC + cipher_TLS_DHE_PSK_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCAD + cipher_TLS_RSA_PSK_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCAE +) + +// isBadCipher reports whether the cipher is blacklisted by the HTTP/2 spec. +// References: +// https://tools.ietf.org/html/rfc7540#appendix-A +// Reject cipher suites from Appendix A. +// "This list includes those cipher suites that do not +// offer an ephemeral key exchange and those that are +// based on the TLS null, stream or block cipher type" +func isBadCipher(cipher uint16) bool { + switch cipher { + case cipher_TLS_NULL_WITH_NULL_NULL, + cipher_TLS_RSA_WITH_NULL_MD5, + cipher_TLS_RSA_WITH_NULL_SHA, + cipher_TLS_RSA_EXPORT_WITH_RC4_40_MD5, + cipher_TLS_RSA_WITH_RC4_128_MD5, + cipher_TLS_RSA_WITH_RC4_128_SHA, + cipher_TLS_RSA_EXPORT_WITH_RC2_CBC_40_MD5, + cipher_TLS_RSA_WITH_IDEA_CBC_SHA, + cipher_TLS_RSA_EXPORT_WITH_DES40_CBC_SHA, + cipher_TLS_RSA_WITH_DES_CBC_SHA, + cipher_TLS_RSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_DH_DSS_EXPORT_WITH_DES40_CBC_SHA, + cipher_TLS_DH_DSS_WITH_DES_CBC_SHA, + cipher_TLS_DH_DSS_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_DH_RSA_EXPORT_WITH_DES40_CBC_SHA, + cipher_TLS_DH_RSA_WITH_DES_CBC_SHA, + cipher_TLS_DH_RSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_DHE_DSS_EXPORT_WITH_DES40_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_DES_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_DHE_RSA_EXPORT_WITH_DES40_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_DES_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_DH_anon_EXPORT_WITH_RC4_40_MD5, + cipher_TLS_DH_anon_WITH_RC4_128_MD5, + cipher_TLS_DH_anon_EXPORT_WITH_DES40_CBC_SHA, + cipher_TLS_DH_anon_WITH_DES_CBC_SHA, + cipher_TLS_DH_anon_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_KRB5_WITH_DES_CBC_SHA, + cipher_TLS_KRB5_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_KRB5_WITH_RC4_128_SHA, + cipher_TLS_KRB5_WITH_IDEA_CBC_SHA, + cipher_TLS_KRB5_WITH_DES_CBC_MD5, + cipher_TLS_KRB5_WITH_3DES_EDE_CBC_MD5, + cipher_TLS_KRB5_WITH_RC4_128_MD5, + cipher_TLS_KRB5_WITH_IDEA_CBC_MD5, + cipher_TLS_KRB5_EXPORT_WITH_DES_CBC_40_SHA, + cipher_TLS_KRB5_EXPORT_WITH_RC2_CBC_40_SHA, + cipher_TLS_KRB5_EXPORT_WITH_RC4_40_SHA, + cipher_TLS_KRB5_EXPORT_WITH_DES_CBC_40_MD5, + cipher_TLS_KRB5_EXPORT_WITH_RC2_CBC_40_MD5, + cipher_TLS_KRB5_EXPORT_WITH_RC4_40_MD5, + cipher_TLS_PSK_WITH_NULL_SHA, + cipher_TLS_DHE_PSK_WITH_NULL_SHA, + cipher_TLS_RSA_PSK_WITH_NULL_SHA, + cipher_TLS_RSA_WITH_AES_128_CBC_SHA, + cipher_TLS_DH_DSS_WITH_AES_128_CBC_SHA, + cipher_TLS_DH_RSA_WITH_AES_128_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_AES_128_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_AES_128_CBC_SHA, + cipher_TLS_DH_anon_WITH_AES_128_CBC_SHA, + cipher_TLS_RSA_WITH_AES_256_CBC_SHA, + cipher_TLS_DH_DSS_WITH_AES_256_CBC_SHA, + cipher_TLS_DH_RSA_WITH_AES_256_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_AES_256_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_AES_256_CBC_SHA, + cipher_TLS_DH_anon_WITH_AES_256_CBC_SHA, + cipher_TLS_RSA_WITH_NULL_SHA256, + cipher_TLS_RSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_RSA_WITH_AES_256_CBC_SHA256, + cipher_TLS_DH_DSS_WITH_AES_128_CBC_SHA256, + cipher_TLS_DH_RSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_DHE_DSS_WITH_AES_128_CBC_SHA256, + cipher_TLS_RSA_WITH_CAMELLIA_128_CBC_SHA, + cipher_TLS_DH_DSS_WITH_CAMELLIA_128_CBC_SHA, + cipher_TLS_DH_RSA_WITH_CAMELLIA_128_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_CAMELLIA_128_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_CAMELLIA_128_CBC_SHA, + cipher_TLS_DH_anon_WITH_CAMELLIA_128_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_DH_DSS_WITH_AES_256_CBC_SHA256, + cipher_TLS_DH_RSA_WITH_AES_256_CBC_SHA256, + cipher_TLS_DHE_DSS_WITH_AES_256_CBC_SHA256, + cipher_TLS_DHE_RSA_WITH_AES_256_CBC_SHA256, + cipher_TLS_DH_anon_WITH_AES_128_CBC_SHA256, + cipher_TLS_DH_anon_WITH_AES_256_CBC_SHA256, + cipher_TLS_RSA_WITH_CAMELLIA_256_CBC_SHA, + cipher_TLS_DH_DSS_WITH_CAMELLIA_256_CBC_SHA, + cipher_TLS_DH_RSA_WITH_CAMELLIA_256_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_CAMELLIA_256_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_CAMELLIA_256_CBC_SHA, + cipher_TLS_DH_anon_WITH_CAMELLIA_256_CBC_SHA, + cipher_TLS_PSK_WITH_RC4_128_SHA, + cipher_TLS_PSK_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_PSK_WITH_AES_128_CBC_SHA, + cipher_TLS_PSK_WITH_AES_256_CBC_SHA, + cipher_TLS_DHE_PSK_WITH_RC4_128_SHA, + cipher_TLS_DHE_PSK_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_DHE_PSK_WITH_AES_128_CBC_SHA, + cipher_TLS_DHE_PSK_WITH_AES_256_CBC_SHA, + cipher_TLS_RSA_PSK_WITH_RC4_128_SHA, + cipher_TLS_RSA_PSK_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_RSA_PSK_WITH_AES_128_CBC_SHA, + cipher_TLS_RSA_PSK_WITH_AES_256_CBC_SHA, + cipher_TLS_RSA_WITH_SEED_CBC_SHA, + cipher_TLS_DH_DSS_WITH_SEED_CBC_SHA, + cipher_TLS_DH_RSA_WITH_SEED_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_SEED_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_SEED_CBC_SHA, + cipher_TLS_DH_anon_WITH_SEED_CBC_SHA, + cipher_TLS_RSA_WITH_AES_128_GCM_SHA256, + cipher_TLS_RSA_WITH_AES_256_GCM_SHA384, + cipher_TLS_DH_RSA_WITH_AES_128_GCM_SHA256, + cipher_TLS_DH_RSA_WITH_AES_256_GCM_SHA384, + cipher_TLS_DH_DSS_WITH_AES_128_GCM_SHA256, + cipher_TLS_DH_DSS_WITH_AES_256_GCM_SHA384, + cipher_TLS_DH_anon_WITH_AES_128_GCM_SHA256, + cipher_TLS_DH_anon_WITH_AES_256_GCM_SHA384, + cipher_TLS_PSK_WITH_AES_128_GCM_SHA256, + cipher_TLS_PSK_WITH_AES_256_GCM_SHA384, + cipher_TLS_RSA_PSK_WITH_AES_128_GCM_SHA256, + cipher_TLS_RSA_PSK_WITH_AES_256_GCM_SHA384, + cipher_TLS_PSK_WITH_AES_128_CBC_SHA256, + cipher_TLS_PSK_WITH_AES_256_CBC_SHA384, + cipher_TLS_PSK_WITH_NULL_SHA256, + cipher_TLS_PSK_WITH_NULL_SHA384, + cipher_TLS_DHE_PSK_WITH_AES_128_CBC_SHA256, + cipher_TLS_DHE_PSK_WITH_AES_256_CBC_SHA384, + cipher_TLS_DHE_PSK_WITH_NULL_SHA256, + cipher_TLS_DHE_PSK_WITH_NULL_SHA384, + cipher_TLS_RSA_PSK_WITH_AES_128_CBC_SHA256, + cipher_TLS_RSA_PSK_WITH_AES_256_CBC_SHA384, + cipher_TLS_RSA_PSK_WITH_NULL_SHA256, + cipher_TLS_RSA_PSK_WITH_NULL_SHA384, + cipher_TLS_RSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_DH_DSS_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_DH_RSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_DHE_DSS_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_DHE_RSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_DH_anon_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_RSA_WITH_CAMELLIA_256_CBC_SHA256, + cipher_TLS_DH_DSS_WITH_CAMELLIA_256_CBC_SHA256, + cipher_TLS_DH_RSA_WITH_CAMELLIA_256_CBC_SHA256, + cipher_TLS_DHE_DSS_WITH_CAMELLIA_256_CBC_SHA256, + cipher_TLS_DHE_RSA_WITH_CAMELLIA_256_CBC_SHA256, + cipher_TLS_DH_anon_WITH_CAMELLIA_256_CBC_SHA256, + cipher_TLS_EMPTY_RENEGOTIATION_INFO_SCSV, + cipher_TLS_ECDH_ECDSA_WITH_NULL_SHA, + cipher_TLS_ECDH_ECDSA_WITH_RC4_128_SHA, + cipher_TLS_ECDH_ECDSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_ECDH_ECDSA_WITH_AES_128_CBC_SHA, + cipher_TLS_ECDH_ECDSA_WITH_AES_256_CBC_SHA, + cipher_TLS_ECDHE_ECDSA_WITH_NULL_SHA, + cipher_TLS_ECDHE_ECDSA_WITH_RC4_128_SHA, + cipher_TLS_ECDHE_ECDSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA, + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA, + cipher_TLS_ECDH_RSA_WITH_NULL_SHA, + cipher_TLS_ECDH_RSA_WITH_RC4_128_SHA, + cipher_TLS_ECDH_RSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_ECDH_RSA_WITH_AES_128_CBC_SHA, + cipher_TLS_ECDH_RSA_WITH_AES_256_CBC_SHA, + cipher_TLS_ECDHE_RSA_WITH_NULL_SHA, + cipher_TLS_ECDHE_RSA_WITH_RC4_128_SHA, + cipher_TLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA, + cipher_TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA, + cipher_TLS_ECDH_anon_WITH_NULL_SHA, + cipher_TLS_ECDH_anon_WITH_RC4_128_SHA, + cipher_TLS_ECDH_anon_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_ECDH_anon_WITH_AES_128_CBC_SHA, + cipher_TLS_ECDH_anon_WITH_AES_256_CBC_SHA, + cipher_TLS_SRP_SHA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_SRP_SHA_RSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_SRP_SHA_DSS_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_SRP_SHA_WITH_AES_128_CBC_SHA, + cipher_TLS_SRP_SHA_RSA_WITH_AES_128_CBC_SHA, + cipher_TLS_SRP_SHA_DSS_WITH_AES_128_CBC_SHA, + cipher_TLS_SRP_SHA_WITH_AES_256_CBC_SHA, + cipher_TLS_SRP_SHA_RSA_WITH_AES_256_CBC_SHA, + cipher_TLS_SRP_SHA_DSS_WITH_AES_256_CBC_SHA, + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA384, + cipher_TLS_ECDH_ECDSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_ECDH_ECDSA_WITH_AES_256_CBC_SHA384, + cipher_TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384, + cipher_TLS_ECDH_RSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_ECDH_RSA_WITH_AES_256_CBC_SHA384, + cipher_TLS_ECDH_ECDSA_WITH_AES_128_GCM_SHA256, + cipher_TLS_ECDH_ECDSA_WITH_AES_256_GCM_SHA384, + cipher_TLS_ECDH_RSA_WITH_AES_128_GCM_SHA256, + cipher_TLS_ECDH_RSA_WITH_AES_256_GCM_SHA384, + cipher_TLS_ECDHE_PSK_WITH_RC4_128_SHA, + cipher_TLS_ECDHE_PSK_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_ECDHE_PSK_WITH_AES_128_CBC_SHA, + cipher_TLS_ECDHE_PSK_WITH_AES_256_CBC_SHA, + cipher_TLS_ECDHE_PSK_WITH_AES_128_CBC_SHA256, + cipher_TLS_ECDHE_PSK_WITH_AES_256_CBC_SHA384, + cipher_TLS_ECDHE_PSK_WITH_NULL_SHA, + cipher_TLS_ECDHE_PSK_WITH_NULL_SHA256, + cipher_TLS_ECDHE_PSK_WITH_NULL_SHA384, + cipher_TLS_RSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_RSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_DH_DSS_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_DH_DSS_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_DH_RSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_DH_RSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_DHE_DSS_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_DHE_DSS_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_DHE_RSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_DHE_RSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_DH_anon_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_DH_anon_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_ECDHE_ECDSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_ECDHE_ECDSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_ECDH_ECDSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_ECDH_ECDSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_ECDHE_RSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_ECDHE_RSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_ECDH_RSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_ECDH_RSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_RSA_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_RSA_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_DH_RSA_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_DH_RSA_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_DH_DSS_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_DH_DSS_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_DH_anon_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_DH_anon_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_ECDH_ECDSA_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_ECDH_ECDSA_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_ECDH_RSA_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_ECDH_RSA_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_PSK_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_PSK_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_DHE_PSK_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_DHE_PSK_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_RSA_PSK_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_RSA_PSK_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_PSK_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_PSK_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_RSA_PSK_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_RSA_PSK_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_ECDHE_PSK_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_ECDHE_PSK_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_ECDHE_ECDSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_ECDHE_ECDSA_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_ECDHE_RSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_ECDHE_RSA_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_RSA_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_RSA_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_DH_RSA_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_DH_RSA_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_DH_DSS_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_DH_DSS_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_DH_anon_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_DH_anon_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_PSK_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_PSK_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_RSA_PSK_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_RSA_PSK_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_PSK_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_PSK_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_DHE_PSK_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_DHE_PSK_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_RSA_PSK_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_RSA_PSK_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_ECDHE_PSK_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_ECDHE_PSK_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_RSA_WITH_AES_128_CCM, + cipher_TLS_RSA_WITH_AES_256_CCM, + cipher_TLS_RSA_WITH_AES_128_CCM_8, + cipher_TLS_RSA_WITH_AES_256_CCM_8, + cipher_TLS_PSK_WITH_AES_128_CCM, + cipher_TLS_PSK_WITH_AES_256_CCM, + cipher_TLS_PSK_WITH_AES_128_CCM_8, + cipher_TLS_PSK_WITH_AES_256_CCM_8: + return true + default: + return false + } +} diff --git a/vendor/golang.org/x/net/http2/client_conn_pool.go b/vendor/golang.org/x/net/http2/client_conn_pool.go index b13941258a3..bdf5652b01c 100644 --- a/vendor/golang.org/x/net/http2/client_conn_pool.go +++ b/vendor/golang.org/x/net/http2/client_conn_pool.go @@ -247,7 +247,7 @@ func filterOutClientConn(in []*ClientConn, exclude *ClientConn) []*ClientConn { } // noDialClientConnPool is an implementation of http2.ClientConnPool -// which never dials. We let the HTTP/1.1 client dial and use its TLS +// which never dials. We let the HTTP/1.1 client dial and use its TLS // connection instead. type noDialClientConnPool struct{ *clientConnPool } diff --git a/vendor/golang.org/x/net/http2/configure_transport.go b/vendor/golang.org/x/net/http2/configure_transport.go index 4f720f530b0..b65fc6d423d 100644 --- a/vendor/golang.org/x/net/http2/configure_transport.go +++ b/vendor/golang.org/x/net/http2/configure_transport.go @@ -56,7 +56,7 @@ func configureTransport(t1 *http.Transport) (*Transport, error) { } // registerHTTPSProtocol calls Transport.RegisterProtocol but -// convering panics into errors. +// converting panics into errors. func registerHTTPSProtocol(t *http.Transport, rt http.RoundTripper) (err error) { defer func() { if e := recover(); e != nil { diff --git a/vendor/golang.org/x/net/http2/databuffer.go b/vendor/golang.org/x/net/http2/databuffer.go new file mode 100644 index 00000000000..a3067f8de74 --- /dev/null +++ b/vendor/golang.org/x/net/http2/databuffer.go @@ -0,0 +1,146 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package http2 + +import ( + "errors" + "fmt" + "sync" +) + +// Buffer chunks are allocated from a pool to reduce pressure on GC. +// The maximum wasted space per dataBuffer is 2x the largest size class, +// which happens when the dataBuffer has multiple chunks and there is +// one unread byte in both the first and last chunks. We use a few size +// classes to minimize overheads for servers that typically receive very +// small request bodies. +// +// TODO: Benchmark to determine if the pools are necessary. The GC may have +// improved enough that we can instead allocate chunks like this: +// make([]byte, max(16<<10, expectedBytesRemaining)) +var ( + dataChunkSizeClasses = []int{ + 1 << 10, + 2 << 10, + 4 << 10, + 8 << 10, + 16 << 10, + } + dataChunkPools = [...]sync.Pool{ + {New: func() interface{} { return make([]byte, 1<<10) }}, + {New: func() interface{} { return make([]byte, 2<<10) }}, + {New: func() interface{} { return make([]byte, 4<<10) }}, + {New: func() interface{} { return make([]byte, 8<<10) }}, + {New: func() interface{} { return make([]byte, 16<<10) }}, + } +) + +func getDataBufferChunk(size int64) []byte { + i := 0 + for ; i < len(dataChunkSizeClasses)-1; i++ { + if size <= int64(dataChunkSizeClasses[i]) { + break + } + } + return dataChunkPools[i].Get().([]byte) +} + +func putDataBufferChunk(p []byte) { + for i, n := range dataChunkSizeClasses { + if len(p) == n { + dataChunkPools[i].Put(p) + return + } + } + panic(fmt.Sprintf("unexpected buffer len=%v", len(p))) +} + +// dataBuffer is an io.ReadWriter backed by a list of data chunks. +// Each dataBuffer is used to read DATA frames on a single stream. +// The buffer is divided into chunks so the server can limit the +// total memory used by a single connection without limiting the +// request body size on any single stream. +type dataBuffer struct { + chunks [][]byte + r int // next byte to read is chunks[0][r] + w int // next byte to write is chunks[len(chunks)-1][w] + size int // total buffered bytes + expected int64 // we expect at least this many bytes in future Write calls (ignored if <= 0) +} + +var errReadEmpty = errors.New("read from empty dataBuffer") + +// Read copies bytes from the buffer into p. +// It is an error to read when no data is available. +func (b *dataBuffer) Read(p []byte) (int, error) { + if b.size == 0 { + return 0, errReadEmpty + } + var ntotal int + for len(p) > 0 && b.size > 0 { + readFrom := b.bytesFromFirstChunk() + n := copy(p, readFrom) + p = p[n:] + ntotal += n + b.r += n + b.size -= n + // If the first chunk has been consumed, advance to the next chunk. + if b.r == len(b.chunks[0]) { + putDataBufferChunk(b.chunks[0]) + end := len(b.chunks) - 1 + copy(b.chunks[:end], b.chunks[1:]) + b.chunks[end] = nil + b.chunks = b.chunks[:end] + b.r = 0 + } + } + return ntotal, nil +} + +func (b *dataBuffer) bytesFromFirstChunk() []byte { + if len(b.chunks) == 1 { + return b.chunks[0][b.r:b.w] + } + return b.chunks[0][b.r:] +} + +// Len returns the number of bytes of the unread portion of the buffer. +func (b *dataBuffer) Len() int { + return b.size +} + +// Write appends p to the buffer. +func (b *dataBuffer) Write(p []byte) (int, error) { + ntotal := len(p) + for len(p) > 0 { + // If the last chunk is empty, allocate a new chunk. Try to allocate + // enough to fully copy p plus any additional bytes we expect to + // receive. However, this may allocate less than len(p). + want := int64(len(p)) + if b.expected > want { + want = b.expected + } + chunk := b.lastChunkOrAlloc(want) + n := copy(chunk[b.w:], p) + p = p[n:] + b.w += n + b.size += n + b.expected -= int64(n) + } + return ntotal, nil +} + +func (b *dataBuffer) lastChunkOrAlloc(want int64) []byte { + if len(b.chunks) != 0 { + last := b.chunks[len(b.chunks)-1] + if b.w < len(last) { + return last + } + } + chunk := getDataBufferChunk(want) + b.chunks = append(b.chunks, chunk) + b.w = 0 + return chunk +} diff --git a/vendor/golang.org/x/net/http2/errors.go b/vendor/golang.org/x/net/http2/errors.go index 20fd7626a56..71f2c463178 100644 --- a/vendor/golang.org/x/net/http2/errors.go +++ b/vendor/golang.org/x/net/http2/errors.go @@ -87,13 +87,16 @@ type goAwayFlowError struct{} func (goAwayFlowError) Error() string { return "connection exceeded flow control window size" } -// connErrorReason wraps a ConnectionError with an informative error about why it occurs. - +// connError represents an HTTP/2 ConnectionError error code, along +// with a string (for debugging) explaining why. +// // Errors of this type are only returned by the frame parser functions -// and converted into ConnectionError(ErrCodeProtocol). +// and converted into ConnectionError(Code), after stashing away +// the Reason into the Framer's errDetail field, accessible via +// the (*Framer).ErrorDetail method. type connError struct { - Code ErrCode - Reason string + Code ErrCode // the ConnectionError error code + Reason string // additional reason } func (e connError) Error() string { diff --git a/vendor/golang.org/x/net/http2/fixed_buffer.go b/vendor/golang.org/x/net/http2/fixed_buffer.go deleted file mode 100644 index 47da0f0bf71..00000000000 --- a/vendor/golang.org/x/net/http2/fixed_buffer.go +++ /dev/null @@ -1,60 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package http2 - -import ( - "errors" -) - -// fixedBuffer is an io.ReadWriter backed by a fixed size buffer. -// It never allocates, but moves old data as new data is written. -type fixedBuffer struct { - buf []byte - r, w int -} - -var ( - errReadEmpty = errors.New("read from empty fixedBuffer") - errWriteFull = errors.New("write on full fixedBuffer") -) - -// Read copies bytes from the buffer into p. -// It is an error to read when no data is available. -func (b *fixedBuffer) Read(p []byte) (n int, err error) { - if b.r == b.w { - return 0, errReadEmpty - } - n = copy(p, b.buf[b.r:b.w]) - b.r += n - if b.r == b.w { - b.r = 0 - b.w = 0 - } - return n, nil -} - -// Len returns the number of bytes of the unread portion of the buffer. -func (b *fixedBuffer) Len() int { - return b.w - b.r -} - -// Write copies bytes from p into the buffer. -// It is an error to write more data than the buffer can hold. -func (b *fixedBuffer) Write(p []byte) (n int, err error) { - // Slide existing data to beginning. - if b.r > 0 && len(p) > len(b.buf)-b.w { - copy(b.buf, b.buf[b.r:b.w]) - b.w -= b.r - b.r = 0 - } - - // Write new data. - n = copy(b.buf[b.w:], p) - b.w += n - if n < len(p) { - err = errWriteFull - } - return n, err -} diff --git a/vendor/golang.org/x/net/http2/frame.go b/vendor/golang.org/x/net/http2/frame.go index 358833fedfe..3b14890728f 100644 --- a/vendor/golang.org/x/net/http2/frame.go +++ b/vendor/golang.org/x/net/http2/frame.go @@ -122,7 +122,7 @@ var flagName = map[FrameType]map[Flags]string{ // a frameParser parses a frame given its FrameHeader and payload // bytes. The length of payload will always equal fh.Length (which // might be 0). -type frameParser func(fh FrameHeader, payload []byte) (Frame, error) +type frameParser func(fc *frameCache, fh FrameHeader, payload []byte) (Frame, error) var frameParsers = map[FrameType]frameParser{ FrameData: parseDataFrame, @@ -312,7 +312,7 @@ type Framer struct { MaxHeaderListSize uint32 // TODO: track which type of frame & with which flags was sent - // last. Then return an error (unless AllowIllegalWrites) if + // last. Then return an error (unless AllowIllegalWrites) if // we're in the middle of a header block and a // non-Continuation or Continuation on a different stream is // attempted to be written. @@ -323,6 +323,8 @@ type Framer struct { debugFramerBuf *bytes.Buffer debugReadLoggerf func(string, ...interface{}) debugWriteLoggerf func(string, ...interface{}) + + frameCache *frameCache // nil if frames aren't reused (default) } func (fr *Framer) maxHeaderListSize() uint32 { @@ -398,6 +400,27 @@ const ( maxFrameSize = 1<<24 - 1 ) +// SetReuseFrames allows the Framer to reuse Frames. +// If called on a Framer, Frames returned by calls to ReadFrame are only +// valid until the next call to ReadFrame. +func (fr *Framer) SetReuseFrames() { + if fr.frameCache != nil { + return + } + fr.frameCache = &frameCache{} +} + +type frameCache struct { + dataFrame DataFrame +} + +func (fc *frameCache) getDataFrame() *DataFrame { + if fc == nil { + return &DataFrame{} + } + return &fc.dataFrame +} + // NewFramer returns a Framer that writes frames to w and reads them from r. func NewFramer(w io.Writer, r io.Reader) *Framer { fr := &Framer{ @@ -477,7 +500,7 @@ func (fr *Framer) ReadFrame() (Frame, error) { if _, err := io.ReadFull(fr.r, payload); err != nil { return nil, err } - f, err := typeFrameParser(fh.Type)(fh, payload) + f, err := typeFrameParser(fh.Type)(fr.frameCache, fh, payload) if err != nil { if ce, ok := err.(connError); ok { return nil, fr.connError(ce.Code, ce.Reason) @@ -565,7 +588,7 @@ func (f *DataFrame) Data() []byte { return f.data } -func parseDataFrame(fh FrameHeader, payload []byte) (Frame, error) { +func parseDataFrame(fc *frameCache, fh FrameHeader, payload []byte) (Frame, error) { if fh.StreamID == 0 { // DATA frames MUST be associated with a stream. If a // DATA frame is received whose stream identifier @@ -574,9 +597,9 @@ func parseDataFrame(fh FrameHeader, payload []byte) (Frame, error) { // PROTOCOL_ERROR. return nil, connError{ErrCodeProtocol, "DATA frame with stream ID 0"} } - f := &DataFrame{ - FrameHeader: fh, - } + f := fc.getDataFrame() + f.FrameHeader = fh + var padSize byte if fh.Flags.Has(FlagDataPadded) { var err error @@ -600,6 +623,7 @@ var ( errStreamID = errors.New("invalid stream ID") errDepStreamID = errors.New("invalid dependent stream ID") errPadLength = errors.New("pad length too large") + errPadBytes = errors.New("padding bytes must all be zeros unless AllowIllegalWrites is enabled") ) func validStreamIDOrZero(streamID uint32) bool { @@ -623,6 +647,7 @@ func (f *Framer) WriteData(streamID uint32, endStream bool, data []byte) error { // // If pad is nil, the padding bit is not sent. // The length of pad must not exceed 255 bytes. +// The bytes of pad must all be zero, unless f.AllowIllegalWrites is set. // // It will perform exactly one Write to the underlying Writer. // It is the caller's responsibility not to violate the maximum frame size @@ -631,8 +656,18 @@ func (f *Framer) WriteDataPadded(streamID uint32, endStream bool, data, pad []by if !validStreamID(streamID) && !f.AllowIllegalWrites { return errStreamID } - if len(pad) > 255 { - return errPadLength + if len(pad) > 0 { + if len(pad) > 255 { + return errPadLength + } + if !f.AllowIllegalWrites { + for _, b := range pad { + if b != 0 { + // "Padding octets MUST be set to zero when sending." + return errPadBytes + } + } + } } var flags Flags if endStream { @@ -660,10 +695,10 @@ type SettingsFrame struct { p []byte } -func parseSettingsFrame(fh FrameHeader, p []byte) (Frame, error) { +func parseSettingsFrame(_ *frameCache, fh FrameHeader, p []byte) (Frame, error) { if fh.Flags.Has(FlagSettingsAck) && fh.Length > 0 { // When this (ACK 0x1) bit is set, the payload of the - // SETTINGS frame MUST be empty. Receipt of a + // SETTINGS frame MUST be empty. Receipt of a // SETTINGS frame with the ACK flag set and a length // field value other than 0 MUST be treated as a // connection error (Section 5.4.1) of type @@ -672,7 +707,7 @@ func parseSettingsFrame(fh FrameHeader, p []byte) (Frame, error) { } if fh.StreamID != 0 { // SETTINGS frames always apply to a connection, - // never a single stream. The stream identifier for a + // never a single stream. The stream identifier for a // SETTINGS frame MUST be zero (0x0). If an endpoint // receives a SETTINGS frame whose stream identifier // field is anything other than 0x0, the endpoint MUST @@ -762,7 +797,7 @@ type PingFrame struct { func (f *PingFrame) IsAck() bool { return f.Flags.Has(FlagPingAck) } -func parsePingFrame(fh FrameHeader, payload []byte) (Frame, error) { +func parsePingFrame(_ *frameCache, fh FrameHeader, payload []byte) (Frame, error) { if len(payload) != 8 { return nil, ConnectionError(ErrCodeFrameSize) } @@ -802,7 +837,7 @@ func (f *GoAwayFrame) DebugData() []byte { return f.debugData } -func parseGoAwayFrame(fh FrameHeader, p []byte) (Frame, error) { +func parseGoAwayFrame(_ *frameCache, fh FrameHeader, p []byte) (Frame, error) { if fh.StreamID != 0 { return nil, ConnectionError(ErrCodeProtocol) } @@ -842,7 +877,7 @@ func (f *UnknownFrame) Payload() []byte { return f.p } -func parseUnknownFrame(fh FrameHeader, p []byte) (Frame, error) { +func parseUnknownFrame(_ *frameCache, fh FrameHeader, p []byte) (Frame, error) { return &UnknownFrame{fh, p}, nil } @@ -853,7 +888,7 @@ type WindowUpdateFrame struct { Increment uint32 // never read with high bit set } -func parseWindowUpdateFrame(fh FrameHeader, p []byte) (Frame, error) { +func parseWindowUpdateFrame(_ *frameCache, fh FrameHeader, p []byte) (Frame, error) { if len(p) != 4 { return nil, ConnectionError(ErrCodeFrameSize) } @@ -918,12 +953,12 @@ func (f *HeadersFrame) HasPriority() bool { return f.FrameHeader.Flags.Has(FlagHeadersPriority) } -func parseHeadersFrame(fh FrameHeader, p []byte) (_ Frame, err error) { +func parseHeadersFrame(_ *frameCache, fh FrameHeader, p []byte) (_ Frame, err error) { hf := &HeadersFrame{ FrameHeader: fh, } if fh.StreamID == 0 { - // HEADERS frames MUST be associated with a stream. If a HEADERS frame + // HEADERS frames MUST be associated with a stream. If a HEADERS frame // is received whose stream identifier field is 0x0, the recipient MUST // respond with a connection error (Section 5.4.1) of type // PROTOCOL_ERROR. @@ -1045,7 +1080,7 @@ type PriorityParam struct { Exclusive bool // Weight is the stream's zero-indexed weight. It should be - // set together with StreamDep, or neither should be set. Per + // set together with StreamDep, or neither should be set. Per // the spec, "Add one to the value to obtain a weight between // 1 and 256." Weight uint8 @@ -1055,7 +1090,7 @@ func (p PriorityParam) IsZero() bool { return p == PriorityParam{} } -func parsePriorityFrame(fh FrameHeader, payload []byte) (Frame, error) { +func parsePriorityFrame(_ *frameCache, fh FrameHeader, payload []byte) (Frame, error) { if fh.StreamID == 0 { return nil, connError{ErrCodeProtocol, "PRIORITY frame with stream ID 0"} } @@ -1102,7 +1137,7 @@ type RSTStreamFrame struct { ErrCode ErrCode } -func parseRSTStreamFrame(fh FrameHeader, p []byte) (Frame, error) { +func parseRSTStreamFrame(_ *frameCache, fh FrameHeader, p []byte) (Frame, error) { if len(p) != 4 { return nil, ConnectionError(ErrCodeFrameSize) } @@ -1132,7 +1167,7 @@ type ContinuationFrame struct { headerFragBuf []byte } -func parseContinuationFrame(fh FrameHeader, p []byte) (Frame, error) { +func parseContinuationFrame(_ *frameCache, fh FrameHeader, p []byte) (Frame, error) { if fh.StreamID == 0 { return nil, connError{ErrCodeProtocol, "CONTINUATION frame with stream ID 0"} } @@ -1182,7 +1217,7 @@ func (f *PushPromiseFrame) HeadersEnded() bool { return f.FrameHeader.Flags.Has(FlagPushPromiseEndHeaders) } -func parsePushPromise(fh FrameHeader, p []byte) (_ Frame, err error) { +func parsePushPromise(_ *frameCache, fh FrameHeader, p []byte) (_ Frame, err error) { pp := &PushPromiseFrame{ FrameHeader: fh, } diff --git a/vendor/golang.org/x/net/http2/go16.go b/vendor/golang.org/x/net/http2/go16.go index 2b72855f552..00b2e9e3cf3 100644 --- a/vendor/golang.org/x/net/http2/go16.go +++ b/vendor/golang.org/x/net/http2/go16.go @@ -7,7 +7,6 @@ package http2 import ( - "crypto/tls" "net/http" "time" ) @@ -15,29 +14,3 @@ import ( func transportExpectContinueTimeout(t1 *http.Transport) time.Duration { return t1.ExpectContinueTimeout } - -// isBadCipher reports whether the cipher is blacklisted by the HTTP/2 spec. -func isBadCipher(cipher uint16) bool { - switch cipher { - case tls.TLS_RSA_WITH_RC4_128_SHA, - tls.TLS_RSA_WITH_3DES_EDE_CBC_SHA, - tls.TLS_RSA_WITH_AES_128_CBC_SHA, - tls.TLS_RSA_WITH_AES_256_CBC_SHA, - tls.TLS_RSA_WITH_AES_128_GCM_SHA256, - tls.TLS_RSA_WITH_AES_256_GCM_SHA384, - tls.TLS_ECDHE_ECDSA_WITH_RC4_128_SHA, - tls.TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA, - tls.TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA, - tls.TLS_ECDHE_RSA_WITH_RC4_128_SHA, - tls.TLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHA, - tls.TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA, - tls.TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA: - // Reject cipher suites from Appendix A. - // "This list includes those cipher suites that do not - // offer an ephemeral key exchange and those that are - // based on the TLS null, stream or block cipher type" - return true - default: - return false - } -} diff --git a/vendor/golang.org/x/net/http2/go18.go b/vendor/golang.org/x/net/http2/go18.go index 633202c39fd..4f30d228a88 100644 --- a/vendor/golang.org/x/net/http2/go18.go +++ b/vendor/golang.org/x/net/http2/go18.go @@ -12,7 +12,11 @@ import ( "net/http" ) -func cloneTLSConfig(c *tls.Config) *tls.Config { return c.Clone() } +func cloneTLSConfig(c *tls.Config) *tls.Config { + c2 := c.Clone() + c2.GetClientCertificate = c.GetClientCertificate // golang.org/issue/19264 + return c2 +} var _ http.Pusher = (*responseWriter)(nil) @@ -48,3 +52,5 @@ func reqGetBody(req *http.Request) func() (io.ReadCloser, error) { func reqBodyIsNoBody(body io.ReadCloser) bool { return body == http.NoBody } + +func go18httpNoBody() io.ReadCloser { return http.NoBody } // for tests only diff --git a/vendor/golang.org/x/net/http2/go19.go b/vendor/golang.org/x/net/http2/go19.go new file mode 100644 index 00000000000..38124ba56e2 --- /dev/null +++ b/vendor/golang.org/x/net/http2/go19.go @@ -0,0 +1,16 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build go1.9 + +package http2 + +import ( + "net/http" +) + +func configureServer19(s *http.Server, conf *Server) error { + s.RegisterOnShutdown(conf.state.startGracefulShutdown) + return nil +} diff --git a/vendor/golang.org/x/net/http2/hpack/encode.go b/vendor/golang.org/x/net/http2/hpack/encode.go index f9bb0339848..54726c2a3c5 100644 --- a/vendor/golang.org/x/net/http2/hpack/encode.go +++ b/vendor/golang.org/x/net/http2/hpack/encode.go @@ -39,13 +39,14 @@ func NewEncoder(w io.Writer) *Encoder { tableSizeUpdate: false, w: w, } + e.dynTab.table.init() e.dynTab.setMaxSize(initialHeaderTableSize) return e } // WriteField encodes f into a single Write to e's underlying Writer. // This function may also produce bytes for "Header Table Size Update" -// if necessary. If produced, it is done before encoding f. +// if necessary. If produced, it is done before encoding f. func (e *Encoder) WriteField(f HeaderField) error { e.buf = e.buf[:0] @@ -88,29 +89,17 @@ func (e *Encoder) WriteField(f HeaderField) error { // only name matches, i points to that index and nameValueMatch // becomes false. func (e *Encoder) searchTable(f HeaderField) (i uint64, nameValueMatch bool) { - for idx, hf := range staticTable { - if !constantTimeStringCompare(hf.Name, f.Name) { - continue - } - if i == 0 { - i = uint64(idx + 1) - } - if f.Sensitive { - continue - } - if !constantTimeStringCompare(hf.Value, f.Value) { - continue - } - i = uint64(idx + 1) - nameValueMatch = true - return + i, nameValueMatch = staticTable.search(f) + if nameValueMatch { + return i, true } - j, nameValueMatch := e.dynTab.search(f) + j, nameValueMatch := e.dynTab.table.search(f) if nameValueMatch || (i == 0 && j != 0) { - i = j + uint64(len(staticTable)) + return j + uint64(staticTable.len()), nameValueMatch } - return + + return i, false } // SetMaxDynamicTableSize changes the dynamic header table size to v. diff --git a/vendor/golang.org/x/net/http2/hpack/hpack.go b/vendor/golang.org/x/net/http2/hpack/hpack.go index 135b9f62cd6..176644acdac 100644 --- a/vendor/golang.org/x/net/http2/hpack/hpack.go +++ b/vendor/golang.org/x/net/http2/hpack/hpack.go @@ -61,7 +61,7 @@ func (hf HeaderField) String() string { func (hf HeaderField) Size() uint32 { // http://http2.github.io/http2-spec/compression.html#rfc.section.4.1 // "The size of the dynamic table is the sum of the size of - // its entries. The size of an entry is the sum of its name's + // its entries. The size of an entry is the sum of its name's // length in octets (as defined in Section 5.2), its value's // length in octets (see Section 5.2), plus 32. The size of // an entry is calculated using the length of the name and @@ -102,6 +102,7 @@ func NewDecoder(maxDynamicTableSize uint32, emitFunc func(f HeaderField)) *Decod emit: emitFunc, emitEnabled: true, } + d.dynTab.table.init() d.dynTab.allowedMaxSize = maxDynamicTableSize d.dynTab.setMaxSize(maxDynamicTableSize) return d @@ -154,12 +155,9 @@ func (d *Decoder) SetAllowedMaxDynamicTableSize(v uint32) { } type dynamicTable struct { - // ents is the FIFO described at // http://http2.github.io/http2-spec/compression.html#rfc.section.2.3.2 - // The newest (low index) is append at the end, and items are - // evicted from the front. - ents []HeaderField - size uint32 + table headerFieldTable + size uint32 // in bytes maxSize uint32 // current maxSize allowedMaxSize uint32 // maxSize may go up to this, inclusive } @@ -169,95 +167,45 @@ func (dt *dynamicTable) setMaxSize(v uint32) { dt.evict() } -// TODO: change dynamicTable to be a struct with a slice and a size int field, -// per http://http2.github.io/http2-spec/compression.html#rfc.section.4.1: -// -// -// Then make add increment the size. maybe the max size should move from Decoder to -// dynamicTable and add should return an ok bool if there was enough space. -// -// Later we'll need a remove operation on dynamicTable. - func (dt *dynamicTable) add(f HeaderField) { - dt.ents = append(dt.ents, f) + dt.table.addEntry(f) dt.size += f.Size() dt.evict() } -// If we're too big, evict old stuff (front of the slice) +// If we're too big, evict old stuff. func (dt *dynamicTable) evict() { - base := dt.ents // keep base pointer of slice - for dt.size > dt.maxSize { - dt.size -= dt.ents[0].Size() - dt.ents = dt.ents[1:] + var n int + for dt.size > dt.maxSize && n < dt.table.len() { + dt.size -= dt.table.ents[n].Size() + n++ } - - // Shift slice contents down if we evicted things. - if len(dt.ents) != len(base) { - copy(base, dt.ents) - dt.ents = base[:len(dt.ents)] - } -} - -// constantTimeStringCompare compares string a and b in a constant -// time manner. -func constantTimeStringCompare(a, b string) bool { - if len(a) != len(b) { - return false - } - - c := byte(0) - - for i := 0; i < len(a); i++ { - c |= a[i] ^ b[i] - } - - return c == 0 -} - -// Search searches f in the table. The return value i is 0 if there is -// no name match. If there is name match or name/value match, i is the -// index of that entry (1-based). If both name and value match, -// nameValueMatch becomes true. -func (dt *dynamicTable) search(f HeaderField) (i uint64, nameValueMatch bool) { - l := len(dt.ents) - for j := l - 1; j >= 0; j-- { - ent := dt.ents[j] - if !constantTimeStringCompare(ent.Name, f.Name) { - continue - } - if i == 0 { - i = uint64(l - j) - } - if f.Sensitive { - continue - } - if !constantTimeStringCompare(ent.Value, f.Value) { - continue - } - i = uint64(l - j) - nameValueMatch = true - return - } - return + dt.table.evictOldest(n) } func (d *Decoder) maxTableIndex() int { - return len(d.dynTab.ents) + len(staticTable) + // This should never overflow. RFC 7540 Section 6.5.2 limits the size of + // the dynamic table to 2^32 bytes, where each entry will occupy more than + // one byte. Further, the staticTable has a fixed, small length. + return d.dynTab.table.len() + staticTable.len() } func (d *Decoder) at(i uint64) (hf HeaderField, ok bool) { - if i < 1 { + // See Section 2.3.3. + if i == 0 { return } + if i <= uint64(staticTable.len()) { + return staticTable.ents[i-1], true + } if i > uint64(d.maxTableIndex()) { return } - if i <= uint64(len(staticTable)) { - return staticTable[i-1], true - } - dents := d.dynTab.ents - return dents[len(dents)-(int(i)-len(staticTable))], true + // In the dynamic table, newer entries have lower indices. + // However, dt.ents[0] is the oldest entry. Hence, dt.ents is + // the reversed dynamic table. + dt := d.dynTab.table + return dt.ents[dt.len()-(int(i)-staticTable.len())], true } // Decode decodes an entire block. @@ -307,7 +255,7 @@ func (d *Decoder) Write(p []byte) (n int, err error) { err = d.parseHeaderFieldRepr() if err == errNeedMore { // Extra paranoia, making sure saveBuf won't - // get too large. All the varint and string + // get too large. All the varint and string // reading code earlier should already catch // overlong things and return ErrStringLength, // but keep this as a last resort. diff --git a/vendor/golang.org/x/net/http2/hpack/tables.go b/vendor/golang.org/x/net/http2/hpack/tables.go index b9283a02330..a66cfbea69d 100644 --- a/vendor/golang.org/x/net/http2/hpack/tables.go +++ b/vendor/golang.org/x/net/http2/hpack/tables.go @@ -4,73 +4,200 @@ package hpack -func pair(name, value string) HeaderField { - return HeaderField{Name: name, Value: value} +import ( + "fmt" +) + +// headerFieldTable implements a list of HeaderFields. +// This is used to implement the static and dynamic tables. +type headerFieldTable struct { + // For static tables, entries are never evicted. + // + // For dynamic tables, entries are evicted from ents[0] and added to the end. + // Each entry has a unique id that starts at one and increments for each + // entry that is added. This unique id is stable across evictions, meaning + // it can be used as a pointer to a specific entry. As in hpack, unique ids + // are 1-based. The unique id for ents[k] is k + evictCount + 1. + // + // Zero is not a valid unique id. + // + // evictCount should not overflow in any remotely practical situation. In + // practice, we will have one dynamic table per HTTP/2 connection. If we + // assume a very powerful server that handles 1M QPS per connection and each + // request adds (then evicts) 100 entries from the table, it would still take + // 2M years for evictCount to overflow. + ents []HeaderField + evictCount uint64 + + // byName maps a HeaderField name to the unique id of the newest entry with + // the same name. See above for a definition of "unique id". + byName map[string]uint64 + + // byNameValue maps a HeaderField name/value pair to the unique id of the newest + // entry with the same name and value. See above for a definition of "unique id". + byNameValue map[pairNameValue]uint64 +} + +type pairNameValue struct { + name, value string +} + +func (t *headerFieldTable) init() { + t.byName = make(map[string]uint64) + t.byNameValue = make(map[pairNameValue]uint64) +} + +// len reports the number of entries in the table. +func (t *headerFieldTable) len() int { + return len(t.ents) +} + +// addEntry adds a new entry. +func (t *headerFieldTable) addEntry(f HeaderField) { + id := uint64(t.len()) + t.evictCount + 1 + t.byName[f.Name] = id + t.byNameValue[pairNameValue{f.Name, f.Value}] = id + t.ents = append(t.ents, f) +} + +// evictOldest evicts the n oldest entries in the table. +func (t *headerFieldTable) evictOldest(n int) { + if n > t.len() { + panic(fmt.Sprintf("evictOldest(%v) on table with %v entries", n, t.len())) + } + for k := 0; k < n; k++ { + f := t.ents[k] + id := t.evictCount + uint64(k) + 1 + if t.byName[f.Name] == id { + delete(t.byName, f.Name) + } + if p := (pairNameValue{f.Name, f.Value}); t.byNameValue[p] == id { + delete(t.byNameValue, p) + } + } + copy(t.ents, t.ents[n:]) + for k := t.len() - n; k < t.len(); k++ { + t.ents[k] = HeaderField{} // so strings can be garbage collected + } + t.ents = t.ents[:t.len()-n] + if t.evictCount+uint64(n) < t.evictCount { + panic("evictCount overflow") + } + t.evictCount += uint64(n) +} + +// search finds f in the table. If there is no match, i is 0. +// If both name and value match, i is the matched index and nameValueMatch +// becomes true. If only name matches, i points to that index and +// nameValueMatch becomes false. +// +// The returned index is a 1-based HPACK index. For dynamic tables, HPACK says +// that index 1 should be the newest entry, but t.ents[0] is the oldest entry, +// meaning t.ents is reversed for dynamic tables. Hence, when t is a dynamic +// table, the return value i actually refers to the entry t.ents[t.len()-i]. +// +// All tables are assumed to be a dynamic tables except for the global +// staticTable pointer. +// +// See Section 2.3.3. +func (t *headerFieldTable) search(f HeaderField) (i uint64, nameValueMatch bool) { + if !f.Sensitive { + if id := t.byNameValue[pairNameValue{f.Name, f.Value}]; id != 0 { + return t.idToIndex(id), true + } + } + if id := t.byName[f.Name]; id != 0 { + return t.idToIndex(id), false + } + return 0, false +} + +// idToIndex converts a unique id to an HPACK index. +// See Section 2.3.3. +func (t *headerFieldTable) idToIndex(id uint64) uint64 { + if id <= t.evictCount { + panic(fmt.Sprintf("id (%v) <= evictCount (%v)", id, t.evictCount)) + } + k := id - t.evictCount - 1 // convert id to an index t.ents[k] + if t != staticTable { + return uint64(t.len()) - k // dynamic table + } + return k + 1 } // http://tools.ietf.org/html/draft-ietf-httpbis-header-compression-07#appendix-B -var staticTable = [...]HeaderField{ - pair(":authority", ""), // index 1 (1-based) - pair(":method", "GET"), - pair(":method", "POST"), - pair(":path", "/"), - pair(":path", "/index.html"), - pair(":scheme", "http"), - pair(":scheme", "https"), - pair(":status", "200"), - pair(":status", "204"), - pair(":status", "206"), - pair(":status", "304"), - pair(":status", "400"), - pair(":status", "404"), - pair(":status", "500"), - pair("accept-charset", ""), - pair("accept-encoding", "gzip, deflate"), - pair("accept-language", ""), - pair("accept-ranges", ""), - pair("accept", ""), - pair("access-control-allow-origin", ""), - pair("age", ""), - pair("allow", ""), - pair("authorization", ""), - pair("cache-control", ""), - pair("content-disposition", ""), - pair("content-encoding", ""), - pair("content-language", ""), - pair("content-length", ""), - pair("content-location", ""), - pair("content-range", ""), - pair("content-type", ""), - pair("cookie", ""), - pair("date", ""), - pair("etag", ""), - pair("expect", ""), - pair("expires", ""), - pair("from", ""), - pair("host", ""), - pair("if-match", ""), - pair("if-modified-since", ""), - pair("if-none-match", ""), - pair("if-range", ""), - pair("if-unmodified-since", ""), - pair("last-modified", ""), - pair("link", ""), - pair("location", ""), - pair("max-forwards", ""), - pair("proxy-authenticate", ""), - pair("proxy-authorization", ""), - pair("range", ""), - pair("referer", ""), - pair("refresh", ""), - pair("retry-after", ""), - pair("server", ""), - pair("set-cookie", ""), - pair("strict-transport-security", ""), - pair("transfer-encoding", ""), - pair("user-agent", ""), - pair("vary", ""), - pair("via", ""), - pair("www-authenticate", ""), +var staticTable = newStaticTable() +var staticTableEntries = [...]HeaderField{ + {Name: ":authority"}, + {Name: ":method", Value: "GET"}, + {Name: ":method", Value: "POST"}, + {Name: ":path", Value: "/"}, + {Name: ":path", Value: "/index.html"}, + {Name: ":scheme", Value: "http"}, + {Name: ":scheme", Value: "https"}, + {Name: ":status", Value: "200"}, + {Name: ":status", Value: "204"}, + {Name: ":status", Value: "206"}, + {Name: ":status", Value: "304"}, + {Name: ":status", Value: "400"}, + {Name: ":status", Value: "404"}, + {Name: ":status", Value: "500"}, + {Name: "accept-charset"}, + {Name: "accept-encoding", Value: "gzip, deflate"}, + {Name: "accept-language"}, + {Name: "accept-ranges"}, + {Name: "accept"}, + {Name: "access-control-allow-origin"}, + {Name: "age"}, + {Name: "allow"}, + {Name: "authorization"}, + {Name: "cache-control"}, + {Name: "content-disposition"}, + {Name: "content-encoding"}, + {Name: "content-language"}, + {Name: "content-length"}, + {Name: "content-location"}, + {Name: "content-range"}, + {Name: "content-type"}, + {Name: "cookie"}, + {Name: "date"}, + {Name: "etag"}, + {Name: "expect"}, + {Name: "expires"}, + {Name: "from"}, + {Name: "host"}, + {Name: "if-match"}, + {Name: "if-modified-since"}, + {Name: "if-none-match"}, + {Name: "if-range"}, + {Name: "if-unmodified-since"}, + {Name: "last-modified"}, + {Name: "link"}, + {Name: "location"}, + {Name: "max-forwards"}, + {Name: "proxy-authenticate"}, + {Name: "proxy-authorization"}, + {Name: "range"}, + {Name: "referer"}, + {Name: "refresh"}, + {Name: "retry-after"}, + {Name: "server"}, + {Name: "set-cookie"}, + {Name: "strict-transport-security"}, + {Name: "transfer-encoding"}, + {Name: "user-agent"}, + {Name: "vary"}, + {Name: "via"}, + {Name: "www-authenticate"}, +} + +func newStaticTable() *headerFieldTable { + t := &headerFieldTable{} + t.init() + for _, e := range staticTableEntries[:] { + t.addEntry(e) + } + return t } var huffmanCodes = [256]uint32{ diff --git a/vendor/golang.org/x/net/http2/http2.go b/vendor/golang.org/x/net/http2/http2.go index a91fed57069..15d7aff3829 100644 --- a/vendor/golang.org/x/net/http2/http2.go +++ b/vendor/golang.org/x/net/http2/http2.go @@ -376,12 +376,16 @@ func (s *sorter) SortStrings(ss []string) { // validPseudoPath reports whether v is a valid :path pseudo-header // value. It must be either: // -// *) a non-empty string starting with '/', but not with with "//", +// *) a non-empty string starting with '/' // *) the string '*', for OPTIONS requests. // // For now this is only used a quick check for deciding when to clean // up Opaque URLs before sending requests from the Transport. // See golang.org/issue/16847 +// +// We used to enforce that the path also didn't start with "//", but +// Google's GFE accepts such paths and Chrome sends them, so ignore +// that part of the spec. See golang.org/issue/19103. func validPseudoPath(v string) bool { - return (len(v) > 0 && v[0] == '/' && (len(v) == 1 || v[1] != '/')) || v == "*" + return (len(v) > 0 && v[0] == '/') || v == "*" } diff --git a/vendor/golang.org/x/net/http2/not_go16.go b/vendor/golang.org/x/net/http2/not_go16.go index efd2e1282cf..508cebcc4db 100644 --- a/vendor/golang.org/x/net/http2/not_go16.go +++ b/vendor/golang.org/x/net/http2/not_go16.go @@ -7,7 +7,6 @@ package http2 import ( - "crypto/tls" "net/http" "time" ) @@ -20,27 +19,3 @@ func transportExpectContinueTimeout(t1 *http.Transport) time.Duration { return 0 } - -// isBadCipher reports whether the cipher is blacklisted by the HTTP/2 spec. -func isBadCipher(cipher uint16) bool { - switch cipher { - case tls.TLS_RSA_WITH_RC4_128_SHA, - tls.TLS_RSA_WITH_3DES_EDE_CBC_SHA, - tls.TLS_RSA_WITH_AES_128_CBC_SHA, - tls.TLS_RSA_WITH_AES_256_CBC_SHA, - tls.TLS_ECDHE_ECDSA_WITH_RC4_128_SHA, - tls.TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA, - tls.TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA, - tls.TLS_ECDHE_RSA_WITH_RC4_128_SHA, - tls.TLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHA, - tls.TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA, - tls.TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA: - // Reject cipher suites from Appendix A. - // "This list includes those cipher suites that do not - // offer an ephemeral key exchange and those that are - // based on the TLS null, stream or block cipher type" - return true - default: - return false - } -} diff --git a/vendor/golang.org/x/net/http2/not_go18.go b/vendor/golang.org/x/net/http2/not_go18.go index efbf83c32c4..6f8d3f86fa8 100644 --- a/vendor/golang.org/x/net/http2/not_go18.go +++ b/vendor/golang.org/x/net/http2/not_go18.go @@ -25,3 +25,5 @@ func reqGetBody(req *http.Request) func() (io.ReadCloser, error) { } func reqBodyIsNoBody(io.ReadCloser) bool { return false } + +func go18httpNoBody() io.ReadCloser { return nil } // for tests only diff --git a/vendor/golang.org/x/net/http2/not_go19.go b/vendor/golang.org/x/net/http2/not_go19.go new file mode 100644 index 00000000000..5ae07726b74 --- /dev/null +++ b/vendor/golang.org/x/net/http2/not_go19.go @@ -0,0 +1,16 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !go1.9 + +package http2 + +import ( + "net/http" +) + +func configureServer19(s *http.Server, conf *Server) error { + // not supported prior to go1.9 + return nil +} diff --git a/vendor/golang.org/x/net/http2/pipe.go b/vendor/golang.org/x/net/http2/pipe.go index 53b7a1daf63..a6140099cb3 100644 --- a/vendor/golang.org/x/net/http2/pipe.go +++ b/vendor/golang.org/x/net/http2/pipe.go @@ -10,13 +10,13 @@ import ( "sync" ) -// pipe is a goroutine-safe io.Reader/io.Writer pair. It's like +// pipe is a goroutine-safe io.Reader/io.Writer pair. It's like // io.Pipe except there are no PipeReader/PipeWriter halves, and the // underlying buffer is an interface. (io.Pipe is always unbuffered) type pipe struct { mu sync.Mutex - c sync.Cond // c.L lazily initialized to &p.mu - b pipeBuffer + c sync.Cond // c.L lazily initialized to &p.mu + b pipeBuffer // nil when done reading err error // read error once empty. non-nil means closed. breakErr error // immediate read error (caller doesn't see rest of b) donec chan struct{} // closed on error @@ -32,6 +32,9 @@ type pipeBuffer interface { func (p *pipe) Len() int { p.mu.Lock() defer p.mu.Unlock() + if p.b == nil { + return 0 + } return p.b.Len() } @@ -47,7 +50,7 @@ func (p *pipe) Read(d []byte) (n int, err error) { if p.breakErr != nil { return 0, p.breakErr } - if p.b.Len() > 0 { + if p.b != nil && p.b.Len() > 0 { return p.b.Read(d) } if p.err != nil { @@ -55,6 +58,7 @@ func (p *pipe) Read(d []byte) (n int, err error) { p.readFn() // e.g. copy trailers p.readFn = nil // not sticky like p.err } + p.b = nil return 0, p.err } p.c.Wait() @@ -75,6 +79,9 @@ func (p *pipe) Write(d []byte) (n int, err error) { if p.err != nil { return 0, errClosedPipeWrite } + if p.breakErr != nil { + return len(d), nil // discard when there is no reader + } return p.b.Write(d) } @@ -109,6 +116,9 @@ func (p *pipe) closeWithError(dst *error, err error, fn func()) { return } p.readFn = fn + if dst == &p.breakErr { + p.b = nil + } *dst = err p.closeDoneLocked() } diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go index 3c6b90ccd55..eae143ddff1 100644 --- a/vendor/golang.org/x/net/http2/server.go +++ b/vendor/golang.org/x/net/http2/server.go @@ -110,9 +110,41 @@ type Server struct { // activity for the purposes of IdleTimeout. IdleTimeout time.Duration + // MaxUploadBufferPerConnection is the size of the initial flow + // control window for each connections. The HTTP/2 spec does not + // allow this to be smaller than 65535 or larger than 2^32-1. + // If the value is outside this range, a default value will be + // used instead. + MaxUploadBufferPerConnection int32 + + // MaxUploadBufferPerStream is the size of the initial flow control + // window for each stream. The HTTP/2 spec does not allow this to + // be larger than 2^32-1. If the value is zero or larger than the + // maximum, a default value will be used instead. + MaxUploadBufferPerStream int32 + // NewWriteScheduler constructs a write scheduler for a connection. // If nil, a default scheduler is chosen. NewWriteScheduler func() WriteScheduler + + // Internal state. This is a pointer (rather than embedded directly) + // so that we don't embed a Mutex in this struct, which will make the + // struct non-copyable, which might break some callers. + state *serverInternalState +} + +func (s *Server) initialConnRecvWindowSize() int32 { + if s.MaxUploadBufferPerConnection > initialWindowSize { + return s.MaxUploadBufferPerConnection + } + return 1 << 20 +} + +func (s *Server) initialStreamRecvWindowSize() int32 { + if s.MaxUploadBufferPerStream > 0 { + return s.MaxUploadBufferPerStream + } + return 1 << 20 } func (s *Server) maxReadFrameSize() uint32 { @@ -129,6 +161,40 @@ func (s *Server) maxConcurrentStreams() uint32 { return defaultMaxStreams } +type serverInternalState struct { + mu sync.Mutex + activeConns map[*serverConn]struct{} +} + +func (s *serverInternalState) registerConn(sc *serverConn) { + if s == nil { + return // if the Server was used without calling ConfigureServer + } + s.mu.Lock() + s.activeConns[sc] = struct{}{} + s.mu.Unlock() +} + +func (s *serverInternalState) unregisterConn(sc *serverConn) { + if s == nil { + return // if the Server was used without calling ConfigureServer + } + s.mu.Lock() + delete(s.activeConns, sc) + s.mu.Unlock() +} + +func (s *serverInternalState) startGracefulShutdown() { + if s == nil { + return // if the Server was used without calling ConfigureServer + } + s.mu.Lock() + for sc := range s.activeConns { + sc.startGracefulShutdown() + } + s.mu.Unlock() +} + // ConfigureServer adds HTTP/2 support to a net/http Server. // // The configuration conf may be nil. @@ -141,9 +207,13 @@ func ConfigureServer(s *http.Server, conf *Server) error { if conf == nil { conf = new(Server) } + conf.state = &serverInternalState{activeConns: make(map[*serverConn]struct{})} if err := configureServer18(s, conf); err != nil { return err } + if err := configureServer19(s, conf); err != nil { + return err + } if s.TLSConfig == nil { s.TLSConfig = new(tls.Config) @@ -255,35 +325,37 @@ func (s *Server) ServeConn(c net.Conn, opts *ServeConnOpts) { defer cancel() sc := &serverConn{ - srv: s, - hs: opts.baseConfig(), - conn: c, - baseCtx: baseCtx, - remoteAddrStr: c.RemoteAddr().String(), - bw: newBufferedWriter(c), - handler: opts.handler(), - streams: make(map[uint32]*stream), - readFrameCh: make(chan readFrameResult), - wantWriteFrameCh: make(chan FrameWriteRequest, 8), - wantStartPushCh: make(chan startPushRequest, 8), - wroteFrameCh: make(chan frameWriteResult, 1), // buffered; one send in writeFrameAsync - bodyReadCh: make(chan bodyReadMsg), // buffering doesn't matter either way - doneServing: make(chan struct{}), - clientMaxStreams: math.MaxUint32, // Section 6.5.2: "Initially, there is no limit to this value" - advMaxStreams: s.maxConcurrentStreams(), - initialWindowSize: initialWindowSize, - maxFrameSize: initialMaxFrameSize, - headerTableSize: initialHeaderTableSize, - serveG: newGoroutineLock(), - pushEnabled: true, + srv: s, + hs: opts.baseConfig(), + conn: c, + baseCtx: baseCtx, + remoteAddrStr: c.RemoteAddr().String(), + bw: newBufferedWriter(c), + handler: opts.handler(), + streams: make(map[uint32]*stream), + readFrameCh: make(chan readFrameResult), + wantWriteFrameCh: make(chan FrameWriteRequest, 8), + serveMsgCh: make(chan interface{}, 8), + wroteFrameCh: make(chan frameWriteResult, 1), // buffered; one send in writeFrameAsync + bodyReadCh: make(chan bodyReadMsg), // buffering doesn't matter either way + doneServing: make(chan struct{}), + clientMaxStreams: math.MaxUint32, // Section 6.5.2: "Initially, there is no limit to this value" + advMaxStreams: s.maxConcurrentStreams(), + initialStreamSendWindowSize: initialWindowSize, + maxFrameSize: initialMaxFrameSize, + headerTableSize: initialHeaderTableSize, + serveG: newGoroutineLock(), + pushEnabled: true, } + s.state.registerConn(sc) + defer s.state.unregisterConn(sc) + // The net/http package sets the write deadline from the // http.Server.WriteTimeout during the TLS handshake, but then - // passes the connection off to us with the deadline already - // set. Disarm it here so that it is not applied to additional - // streams opened on this connection. - // TODO: implement WriteTimeout fully. See Issue 18437. + // passes the connection off to us with the deadline already set. + // Write deadlines are set per stream in serverConn.newStream. + // Disarm the net.Conn write deadline here. if sc.hs.WriteTimeout != 0 { sc.conn.SetWriteDeadline(time.Time{}) } @@ -294,6 +366,9 @@ func (s *Server) ServeConn(c net.Conn, opts *ServeConnOpts) { sc.writeSched = NewRandomWriteScheduler() } + // These start at the RFC-specified defaults. If there is a higher + // configured value for inflow, that will be updated when we send a + // WINDOW_UPDATE shortly after sending SETTINGS. sc.flow.add(initialWindowSize) sc.inflow.add(initialWindowSize) sc.hpackEncoder = hpack.NewEncoder(&sc.headerWriteBuf) @@ -376,10 +451,9 @@ type serverConn struct { doneServing chan struct{} // closed when serverConn.serve ends readFrameCh chan readFrameResult // written by serverConn.readFrames wantWriteFrameCh chan FrameWriteRequest // from handlers -> serve - wantStartPushCh chan startPushRequest // from handlers -> serve wroteFrameCh chan frameWriteResult // from writeFrameAsync -> serve, tickles more frame writes bodyReadCh chan bodyReadMsg // from handlers -> serve - testHookCh chan func(int) // code to run on the serve loop + serveMsgCh chan interface{} // misc messages & code to send to / run on the serve loop flow flow // conn-wide (not stream-specific) outbound flow control inflow flow // conn-wide inbound flow control tlsState *tls.ConnectionState // shared by all handlers, like net/http @@ -387,38 +461,39 @@ type serverConn struct { writeSched WriteScheduler // Everything following is owned by the serve loop; use serveG.check(): - serveG goroutineLock // used to verify funcs are on serve() - pushEnabled bool - sawFirstSettings bool // got the initial SETTINGS frame after the preface - needToSendSettingsAck bool - unackedSettings int // how many SETTINGS have we sent without ACKs? - clientMaxStreams uint32 // SETTINGS_MAX_CONCURRENT_STREAMS from client (our PUSH_PROMISE limit) - advMaxStreams uint32 // our SETTINGS_MAX_CONCURRENT_STREAMS advertised the client - curClientStreams uint32 // number of open streams initiated by the client - curPushedStreams uint32 // number of open streams initiated by server push - maxClientStreamID uint32 // max ever seen from client (odd), or 0 if there have been no client requests - maxPushPromiseID uint32 // ID of the last push promise (even), or 0 if there have been no pushes - streams map[uint32]*stream - initialWindowSize int32 - maxFrameSize int32 - headerTableSize uint32 - peerMaxHeaderListSize uint32 // zero means unknown (default) - canonHeader map[string]string // http2-lower-case -> Go-Canonical-Case - writingFrame bool // started writing a frame (on serve goroutine or separate) - writingFrameAsync bool // started a frame on its own goroutine but haven't heard back on wroteFrameCh - needsFrameFlush bool // last frame write wasn't a flush - inGoAway bool // we've started to or sent GOAWAY - inFrameScheduleLoop bool // whether we're in the scheduleFrameWrite loop - needToSendGoAway bool // we need to schedule a GOAWAY frame write - goAwayCode ErrCode - shutdownTimerCh <-chan time.Time // nil until used - shutdownTimer *time.Timer // nil until used - idleTimer *time.Timer // nil if unused - idleTimerCh <-chan time.Time // nil if unused + serveG goroutineLock // used to verify funcs are on serve() + pushEnabled bool + sawFirstSettings bool // got the initial SETTINGS frame after the preface + needToSendSettingsAck bool + unackedSettings int // how many SETTINGS have we sent without ACKs? + clientMaxStreams uint32 // SETTINGS_MAX_CONCURRENT_STREAMS from client (our PUSH_PROMISE limit) + advMaxStreams uint32 // our SETTINGS_MAX_CONCURRENT_STREAMS advertised the client + curClientStreams uint32 // number of open streams initiated by the client + curPushedStreams uint32 // number of open streams initiated by server push + maxClientStreamID uint32 // max ever seen from client (odd), or 0 if there have been no client requests + maxPushPromiseID uint32 // ID of the last push promise (even), or 0 if there have been no pushes + streams map[uint32]*stream + initialStreamSendWindowSize int32 + maxFrameSize int32 + headerTableSize uint32 + peerMaxHeaderListSize uint32 // zero means unknown (default) + canonHeader map[string]string // http2-lower-case -> Go-Canonical-Case + writingFrame bool // started writing a frame (on serve goroutine or separate) + writingFrameAsync bool // started a frame on its own goroutine but haven't heard back on wroteFrameCh + needsFrameFlush bool // last frame write wasn't a flush + inGoAway bool // we've started to or sent GOAWAY + inFrameScheduleLoop bool // whether we're in the scheduleFrameWrite loop + needToSendGoAway bool // we need to schedule a GOAWAY frame write + goAwayCode ErrCode + shutdownTimer *time.Timer // nil until used + idleTimer *time.Timer // nil if unused // Owned by the writeFrameAsync goroutine: headerWriteBuf bytes.Buffer hpackEncoder *hpack.Encoder + + // Used by startGracefulShutdown. + shutdownOnce sync.Once } func (sc *serverConn) maxHeaderListSize() uint32 { @@ -463,10 +538,10 @@ type stream struct { numTrailerValues int64 weight uint8 state streamState - resetQueued bool // RST_STREAM queued for write; set by sc.resetStream - gotTrailerHeader bool // HEADER frame for trailers was seen - wroteHeaders bool // whether we wrote headers (not status 100) - reqBuf []byte // if non-nil, body pipe buffer to return later at EOF + resetQueued bool // RST_STREAM queued for write; set by sc.resetStream + gotTrailerHeader bool // HEADER frame for trailers was seen + wroteHeaders bool // whether we wrote headers (not status 100) + writeDeadline *time.Timer // nil if unused trailer http.Header // accumulated trailers reqTrailer http.Header // handler's Request.Trailer @@ -696,48 +771,48 @@ func (sc *serverConn) serve() { {SettingMaxFrameSize, sc.srv.maxReadFrameSize()}, {SettingMaxConcurrentStreams, sc.advMaxStreams}, {SettingMaxHeaderListSize, sc.maxHeaderListSize()}, - - // TODO: more actual settings, notably - // SettingInitialWindowSize, but then we also - // want to bump up the conn window size the - // same amount here right after the settings + {SettingInitialWindowSize, uint32(sc.srv.initialStreamRecvWindowSize())}, }, }) sc.unackedSettings++ + // Each connection starts with intialWindowSize inflow tokens. + // If a higher value is configured, we add more tokens. + if diff := sc.srv.initialConnRecvWindowSize() - initialWindowSize; diff > 0 { + sc.sendWindowUpdate(nil, int(diff)) + } + if err := sc.readPreface(); err != nil { sc.condlogf(err, "http2: server: error reading preface from client %v: %v", sc.conn.RemoteAddr(), err) return } // Now that we've got the preface, get us out of the - // "StateNew" state. We can't go directly to idle, though. + // "StateNew" state. We can't go directly to idle, though. // Active means we read some data and anticipate a request. We'll // do another Active when we get a HEADERS frame. sc.setConnState(http.StateActive) sc.setConnState(http.StateIdle) if sc.srv.IdleTimeout != 0 { - sc.idleTimer = time.NewTimer(sc.srv.IdleTimeout) + sc.idleTimer = time.AfterFunc(sc.srv.IdleTimeout, sc.onIdleTimer) defer sc.idleTimer.Stop() - sc.idleTimerCh = sc.idleTimer.C - } - - var gracefulShutdownCh <-chan struct{} - if sc.hs != nil { - gracefulShutdownCh = h1ServerShutdownChan(sc.hs) } go sc.readFrames() // closed by defer sc.conn.Close above - settingsTimer := time.NewTimer(firstSettingsTimeout) + settingsTimer := time.AfterFunc(firstSettingsTimeout, sc.onSettingsTimer) + defer settingsTimer.Stop() + loopNum := 0 for { loopNum++ select { case wr := <-sc.wantWriteFrameCh: + if se, ok := wr.write.(StreamError); ok { + sc.resetStream(se) + break + } sc.writeFrame(wr) - case spr := <-sc.wantStartPushCh: - sc.startPush(spr) case res := <-sc.wroteFrameCh: sc.wroteFrame(res) case res := <-sc.readFrameCh: @@ -745,26 +820,37 @@ func (sc *serverConn) serve() { return } res.readMore() - if settingsTimer.C != nil { + if settingsTimer != nil { settingsTimer.Stop() - settingsTimer.C = nil + settingsTimer = nil } case m := <-sc.bodyReadCh: sc.noteBodyRead(m.st, m.n) - case <-settingsTimer.C: - sc.logf("timeout waiting for SETTINGS frames from %v", sc.conn.RemoteAddr()) - return - case <-gracefulShutdownCh: - gracefulShutdownCh = nil - sc.startGracefulShutdown() - case <-sc.shutdownTimerCh: - sc.vlogf("GOAWAY close timer fired; closing conn from %v", sc.conn.RemoteAddr()) - return - case <-sc.idleTimerCh: - sc.vlogf("connection is idle") - sc.goAway(ErrCodeNo) - case fn := <-sc.testHookCh: - fn(loopNum) + case msg := <-sc.serveMsgCh: + switch v := msg.(type) { + case func(int): + v(loopNum) // for testing + case *serverMessage: + switch v { + case settingsTimerMsg: + sc.logf("timeout waiting for SETTINGS frames from %v", sc.conn.RemoteAddr()) + return + case idleTimerMsg: + sc.vlogf("connection is idle") + sc.goAway(ErrCodeNo) + case shutdownTimerMsg: + sc.vlogf("GOAWAY close timer fired; closing conn from %v", sc.conn.RemoteAddr()) + return + case gracefulShutdownMsg: + sc.startGracefulShutdownInternal() + default: + panic("unknown timer") + } + case *startPushRequest: + sc.startPush(v) + default: + panic(fmt.Sprintf("unexpected type %T", v)) + } } if sc.inGoAway && sc.curOpenStreams() == 0 && !sc.needToSendGoAway && !sc.writingFrame { @@ -773,6 +859,36 @@ func (sc *serverConn) serve() { } } +func (sc *serverConn) awaitGracefulShutdown(sharedCh <-chan struct{}, privateCh chan struct{}) { + select { + case <-sc.doneServing: + case <-sharedCh: + close(privateCh) + } +} + +type serverMessage int + +// Message values sent to serveMsgCh. +var ( + settingsTimerMsg = new(serverMessage) + idleTimerMsg = new(serverMessage) + shutdownTimerMsg = new(serverMessage) + gracefulShutdownMsg = new(serverMessage) +) + +func (sc *serverConn) onSettingsTimer() { sc.sendServeMsg(settingsTimerMsg) } +func (sc *serverConn) onIdleTimer() { sc.sendServeMsg(idleTimerMsg) } +func (sc *serverConn) onShutdownTimer() { sc.sendServeMsg(shutdownTimerMsg) } + +func (sc *serverConn) sendServeMsg(msg interface{}) { + sc.serveG.checkNotOn() // NOT + select { + case sc.serveMsgCh <- msg: + case <-sc.doneServing: + } +} + // readPreface reads the ClientPreface greeting from the peer // or returns an error on timeout or an invalid greeting. func (sc *serverConn) readPreface() error { @@ -1014,7 +1130,11 @@ func (sc *serverConn) wroteFrame(res frameWriteResult) { // stateClosed after the RST_STREAM frame is // written. st.state = stateHalfClosedLocal - sc.resetStream(streamError(st.id, ErrCodeCancel)) + // Section 8.1: a server MAY request that the client abort + // transmission of a request without error by sending a + // RST_STREAM with an error code of NO_ERROR after sending + // a complete response. + sc.resetStream(streamError(st.id, ErrCodeNo)) case stateHalfClosedRemote: sc.closeStream(st, errHandlerComplete) } @@ -1086,10 +1206,19 @@ func (sc *serverConn) scheduleFrameWrite() { sc.inFrameScheduleLoop = false } -// startGracefulShutdown sends a GOAWAY with ErrCodeNo to tell the -// client we're gracefully shutting down. The connection isn't closed -// until all current streams are done. +// startGracefulShutdown gracefully shuts down a connection. This +// sends GOAWAY with ErrCodeNo to tell the client we're gracefully +// shutting down. The connection isn't closed until all current +// streams are done. +// +// startGracefulShutdown returns immediately; it does not wait until +// the connection has shut down. func (sc *serverConn) startGracefulShutdown() { + sc.serveG.checkNotOn() // NOT + sc.shutdownOnce.Do(func() { sc.sendServeMsg(gracefulShutdownMsg) }) +} + +func (sc *serverConn) startGracefulShutdownInternal() { sc.goAwayIn(ErrCodeNo, 0) } @@ -1121,8 +1250,7 @@ func (sc *serverConn) goAwayIn(code ErrCode, forceCloseIn time.Duration) { func (sc *serverConn) shutDownIn(d time.Duration) { sc.serveG.check() - sc.shutdownTimer = time.NewTimer(d) - sc.shutdownTimerCh = sc.shutdownTimer.C + sc.shutdownTimer = time.AfterFunc(d, sc.onShutdownTimer) } func (sc *serverConn) resetStream(se StreamError) { @@ -1305,6 +1433,9 @@ func (sc *serverConn) closeStream(st *stream, err error) { panic(fmt.Sprintf("invariant; can't close stream in state %v", st.state)) } st.state = stateClosed + if st.writeDeadline != nil { + st.writeDeadline.Stop() + } if st.isPushed() { sc.curPushedStreams-- } else { @@ -1317,7 +1448,7 @@ func (sc *serverConn) closeStream(st *stream, err error) { sc.idleTimer.Reset(sc.srv.IdleTimeout) } if h1ServerKeepAlivesDisabled(sc.hs) { - sc.startGracefulShutdown() + sc.startGracefulShutdownInternal() } } if p := st.body; p != nil { @@ -1395,9 +1526,9 @@ func (sc *serverConn) processSettingInitialWindowSize(val uint32) error { // adjust the size of all stream flow control windows that it // maintains by the difference between the new value and the // old value." - old := sc.initialWindowSize - sc.initialWindowSize = int32(val) - growth := sc.initialWindowSize - old // may be negative + old := sc.initialStreamSendWindowSize + sc.initialStreamSendWindowSize = int32(val) + growth := int32(val) - old // may be negative for _, st := range sc.streams { if !st.flow.add(growth) { // 6.9.2 Initial Flow Control Window Size @@ -1504,7 +1635,7 @@ func (sc *serverConn) processGoAway(f *GoAwayFrame) error { } else { sc.vlogf("http2: received GOAWAY %+v, starting graceful shutdown", f) } - sc.startGracefulShutdown() + sc.startGracefulShutdownInternal() // http://tools.ietf.org/html/rfc7540#section-6.8 // We should not create any new streams, which means we should disable push. sc.pushEnabled = false @@ -1543,6 +1674,12 @@ func (st *stream) copyTrailersToHandlerRequest() { } } +// onWriteTimeout is run on its own goroutine (from time.AfterFunc) +// when the stream's WriteTimeout has fired. +func (st *stream) onWriteTimeout() { + st.sc.writeFrameFromHandler(FrameWriteRequest{write: streamError(st.id, ErrCodeInternal)}) +} + func (sc *serverConn) processHeaders(f *MetaHeadersFrame) error { sc.serveG.check() id := f.StreamID @@ -1719,9 +1856,12 @@ func (sc *serverConn) newStream(id, pusherID uint32, state streamState) *stream } st.cw.Init() st.flow.conn = &sc.flow // link to conn-level counter - st.flow.add(sc.initialWindowSize) - st.inflow.conn = &sc.inflow // link to conn-level counter - st.inflow.add(initialWindowSize) // TODO: update this when we send a higher initial window size in the initial settings + st.flow.add(sc.initialStreamSendWindowSize) + st.inflow.conn = &sc.inflow // link to conn-level counter + st.inflow.add(sc.srv.initialStreamRecvWindowSize()) + if sc.hs.WriteTimeout != 0 { + st.writeDeadline = time.AfterFunc(sc.hs.WriteTimeout, st.onWriteTimeout) + } sc.streams[id] = st sc.writeSched.OpenStream(st.id, OpenStreamOptions{PusherID: pusherID}) @@ -1785,16 +1925,14 @@ func (sc *serverConn) newWriterAndRequest(st *stream, f *MetaHeadersFrame) (*res return nil, nil, err } if bodyOpen { - st.reqBuf = getRequestBodyBuf() - req.Body.(*requestBody).pipe = &pipe{ - b: &fixedBuffer{buf: st.reqBuf}, - } - if vv, ok := rp.header["Content-Length"]; ok { req.ContentLength, _ = strconv.ParseInt(vv[0], 10, 64) } else { req.ContentLength = -1 } + req.Body.(*requestBody).pipe = &pipe{ + b: &dataBuffer{expected: req.ContentLength}, + } } return rw, req, nil } @@ -1890,24 +2028,6 @@ func (sc *serverConn) newWriterAndRequestNoBody(st *stream, rp requestParam) (*r return rw, req, nil } -var reqBodyCache = make(chan []byte, 8) - -func getRequestBodyBuf() []byte { - select { - case b := <-reqBodyCache: - return b - default: - return make([]byte, initialWindowSize) - } -} - -func putRequestBodyBuf(b []byte) { - select { - case reqBodyCache <- b: - default: - } -} - // Run on its own goroutine. func (sc *serverConn) runHandler(rw *responseWriter, req *http.Request, handler func(http.ResponseWriter, *http.Request)) { didPanic := true @@ -2003,12 +2123,6 @@ func (sc *serverConn) noteBodyReadFromHandler(st *stream, n int, err error) { case <-sc.doneServing: } } - if err == io.EOF { - if buf := st.reqBuf; buf != nil { - st.reqBuf = nil // shouldn't matter; field unused by other - putRequestBodyBuf(buf) - } - } } func (sc *serverConn) noteBodyRead(st *stream, n int) { @@ -2103,8 +2217,8 @@ func (b *requestBody) Read(p []byte) (n int, err error) { return } -// responseWriter is the http.ResponseWriter implementation. It's -// intentionally small (1 pointer wide) to minimize garbage. The +// responseWriter is the http.ResponseWriter implementation. It's +// intentionally small (1 pointer wide) to minimize garbage. The // responseWriterState pointer inside is zeroed at the end of a // request (in handlerDone) and calls on the responseWriter thereafter // simply crash (caller's mistake), but the much larger responseWriterState @@ -2138,6 +2252,7 @@ type responseWriterState struct { wroteHeader bool // WriteHeader called (explicitly or implicitly). Not necessarily sent to user yet. sentHeader bool // have we sent the header frame? handlerDone bool // handler has finished + dirty bool // a Write failed; don't reuse this responseWriterState sentContentLen int64 // non-zero if handler set a Content-Length header wroteBytes int64 @@ -2219,6 +2334,7 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { date: date, }) if err != nil { + rws.dirty = true return 0, err } if endStream { @@ -2240,6 +2356,7 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { if len(p) > 0 || endStream { // only send a 0 byte DATA frame if we're ending the stream. if err := rws.conn.writeDataFromHandler(rws.stream, p, endStream); err != nil { + rws.dirty = true return 0, err } } @@ -2251,6 +2368,9 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { trailers: rws.trailers, endStream: true, }) + if err != nil { + rws.dirty = true + } return len(p), err } return len(p), nil @@ -2278,7 +2398,7 @@ const TrailerPrefix = "Trailer:" // says you SHOULD (but not must) predeclare any trailers in the // header, the official ResponseWriter rules said trailers in Go must // be predeclared, and then we reuse the same ResponseWriter.Header() -// map to mean both Headers and Trailers. When it's time to write the +// map to mean both Headers and Trailers. When it's time to write the // Trailers, we pick out the fields of Headers that were declared as // trailers. That worked for a while, until we found the first major // user of Trailers in the wild: gRPC (using them only over http2), @@ -2390,7 +2510,7 @@ func cloneHeader(h http.Header) http.Header { // // * Handler calls w.Write or w.WriteString -> // * -> rws.bw (*bufio.Writer) -> -// * (Handler migth call Flush) +// * (Handler might call Flush) // * -> chunkWriter{rws} // * -> responseWriterState.writeChunk(p []byte) // * -> responseWriterState.writeChunk (most of the magic; see comment there) @@ -2429,10 +2549,19 @@ func (w *responseWriter) write(lenData int, dataB []byte, dataS string) (n int, func (w *responseWriter) handlerDone() { rws := w.rws + dirty := rws.dirty rws.handlerDone = true w.Flush() w.rws = nil - responseWriterStatePool.Put(rws) + if !dirty { + // Only recycle the pool if all prior Write calls to + // the serverConn goroutine completed successfully. If + // they returned earlier due to resets from the peer + // there might still be write goroutines outstanding + // from the serverConn referencing the rws memory. See + // issue 20704. + responseWriterStatePool.Put(rws) + } } // Push errors. @@ -2514,7 +2643,7 @@ func (w *responseWriter) push(target string, opts pushOptions) error { return fmt.Errorf("method %q must be GET or HEAD", opts.Method) } - msg := startPushRequest{ + msg := &startPushRequest{ parent: st, method: opts.Method, url: u, @@ -2527,7 +2656,7 @@ func (w *responseWriter) push(target string, opts pushOptions) error { return errClientDisconnected case <-st.cw: return errStreamClosed - case sc.wantStartPushCh <- msg: + case sc.serveMsgCh <- msg: } select { @@ -2549,7 +2678,7 @@ type startPushRequest struct { done chan error } -func (sc *serverConn) startPush(msg startPushRequest) { +func (sc *serverConn) startPush(msg *startPushRequest) { sc.serveG.check() // http://tools.ietf.org/html/rfc7540#section-6.6. @@ -2588,7 +2717,7 @@ func (sc *serverConn) startPush(msg startPushRequest) { // A server that is unable to establish a new stream identifier can send a GOAWAY // frame so that the client is forced to open a new connection for new streams. if sc.maxPushPromiseID+2 >= 1<<31 { - sc.startGracefulShutdown() + sc.startGracefulShutdownInternal() return 0, ErrPushLimitReached } sc.maxPushPromiseID += 2 @@ -2713,31 +2842,6 @@ var badTrailer = map[string]bool{ "Www-Authenticate": true, } -// h1ServerShutdownChan returns a channel that will be closed when the -// provided *http.Server wants to shut down. -// -// This is a somewhat hacky way to get at http1 innards. It works -// when the http2 code is bundled into the net/http package in the -// standard library. The alternatives ended up making the cmd/go tool -// depend on http Servers. This is the lightest option for now. -// This is tested via the TestServeShutdown* tests in net/http. -func h1ServerShutdownChan(hs *http.Server) <-chan struct{} { - if fn := testh1ServerShutdownChan; fn != nil { - return fn(hs) - } - var x interface{} = hs - type I interface { - getDoneChan() <-chan struct{} - } - if hs, ok := x.(I); ok { - return hs.getDoneChan() - } - return nil -} - -// optional test hook for h1ServerShutdownChan. -var testh1ServerShutdownChan func(hs *http.Server) <-chan struct{} - // h1ServerKeepAlivesDisabled reports whether hs has its keep-alives // disabled. See comments on h1ServerShutdownChan above for why // the code is written this way. diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go index 0c7e859db1e..e0dfe9f6a69 100644 --- a/vendor/golang.org/x/net/http2/transport.go +++ b/vendor/golang.org/x/net/http2/transport.go @@ -18,6 +18,7 @@ import ( "io/ioutil" "log" "math" + mathrand "math/rand" "net" "net/http" "sort" @@ -164,6 +165,7 @@ type ClientConn struct { goAwayDebug string // goAway frame's debug data, retained as a string streams map[uint32]*clientStream // client-initiated nextStreamID uint32 + pendingRequests int // requests blocked and waiting to be sent because len(streams) == maxConcurrentStreams pings map[[8]byte]chan struct{} // in flight ping data to notification channel bw *bufio.Writer br *bufio.Reader @@ -216,35 +218,45 @@ type clientStream struct { resTrailer *http.Header // client's Response.Trailer } -// awaitRequestCancel runs in its own goroutine and waits for the user -// to cancel a RoundTrip request, its context to expire, or for the -// request to be done (any way it might be removed from the cc.streams -// map: peer reset, successful completion, TCP connection breakage, -// etc) -func (cs *clientStream) awaitRequestCancel(req *http.Request) { +// awaitRequestCancel waits for the user to cancel a request or for the done +// channel to be signaled. A non-nil error is returned only if the request was +// canceled. +func awaitRequestCancel(req *http.Request, done <-chan struct{}) error { ctx := reqContext(req) if req.Cancel == nil && ctx.Done() == nil { - return + return nil } select { case <-req.Cancel: - cs.cancelStream() - cs.bufPipe.CloseWithError(errRequestCanceled) + return errRequestCanceled case <-ctx.Done(): + return ctx.Err() + case <-done: + return nil + } +} + +// awaitRequestCancel waits for the user to cancel a request, its context to +// expire, or for the request to be done (any way it might be removed from the +// cc.streams map: peer reset, successful completion, TCP connection breakage, +// etc). If the request is canceled, then cs will be canceled and closed. +func (cs *clientStream) awaitRequestCancel(req *http.Request) { + if err := awaitRequestCancel(req, cs.done); err != nil { cs.cancelStream() - cs.bufPipe.CloseWithError(ctx.Err()) - case <-cs.done: + cs.bufPipe.CloseWithError(err) } } func (cs *clientStream) cancelStream() { - cs.cc.mu.Lock() + cc := cs.cc + cc.mu.Lock() didReset := cs.didReset cs.didReset = true - cs.cc.mu.Unlock() + cc.mu.Unlock() if !didReset { - cs.cc.writeStreamReset(cs.ID, ErrCodeCancel, nil) + cc.writeStreamReset(cs.ID, ErrCodeCancel, nil) + cc.forgetStreamID(cs.ID) } } @@ -329,7 +341,7 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res } addr := authorityAddr(req.URL.Scheme, req.URL.Host) - for { + for retry := 0; ; retry++ { cc, err := t.connPool().GetClientConn(req, addr) if err != nil { t.vlogf("http2: Transport failed to get client conn for %s: %v", addr, err) @@ -337,9 +349,25 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res } traceGotConn(req, cc) res, err := cc.RoundTrip(req) - if err != nil { - if req, err = shouldRetryRequest(req, err); err == nil { - continue + if err != nil && retry <= 6 { + afterBodyWrite := false + if e, ok := err.(afterReqBodyWriteError); ok { + err = e + afterBodyWrite = true + } + if req, err = shouldRetryRequest(req, err, afterBodyWrite); err == nil { + // After the first retry, do exponential backoff with 10% jitter. + if retry == 0 { + continue + } + backoff := float64(uint(1) << (uint(retry) - 1)) + backoff += backoff * (0.1 * mathrand.Float64()) + select { + case <-time.After(time.Second * time.Duration(backoff)): + continue + case <-reqContext(req).Done(): + return nil, reqContext(req).Err() + } } } if err != nil { @@ -360,43 +388,60 @@ func (t *Transport) CloseIdleConnections() { } var ( - errClientConnClosed = errors.New("http2: client conn is closed") - errClientConnUnusable = errors.New("http2: client conn not usable") - - errClientConnGotGoAway = errors.New("http2: Transport received Server's graceful shutdown GOAWAY") - errClientConnGotGoAwayAfterSomeReqBody = errors.New("http2: Transport received Server's graceful shutdown GOAWAY; some request body already written") + errClientConnClosed = errors.New("http2: client conn is closed") + errClientConnUnusable = errors.New("http2: client conn not usable") + errClientConnGotGoAway = errors.New("http2: Transport received Server's graceful shutdown GOAWAY") ) +// afterReqBodyWriteError is a wrapper around errors returned by ClientConn.RoundTrip. +// It is used to signal that err happened after part of Request.Body was sent to the server. +type afterReqBodyWriteError struct { + err error +} + +func (e afterReqBodyWriteError) Error() string { + return e.err.Error() + "; some request body already written" +} + // shouldRetryRequest is called by RoundTrip when a request fails to get // response headers. It is always called with a non-nil error. // It returns either a request to retry (either the same request, or a // modified clone), or an error if the request can't be replayed. -func shouldRetryRequest(req *http.Request, err error) (*http.Request, error) { - switch err { - default: +func shouldRetryRequest(req *http.Request, err error, afterBodyWrite bool) (*http.Request, error) { + if !canRetryError(err) { return nil, err - case errClientConnUnusable, errClientConnGotGoAway: - return req, nil - case errClientConnGotGoAwayAfterSomeReqBody: - // If the Body is nil (or http.NoBody), it's safe to reuse - // this request and its Body. - if req.Body == nil || reqBodyIsNoBody(req.Body) { - return req, nil - } - // Otherwise we depend on the Request having its GetBody - // func defined. - getBody := reqGetBody(req) // Go 1.8: getBody = req.GetBody - if getBody == nil { - return nil, errors.New("http2: Transport: peer server initiated graceful shutdown after some of Request.Body was written; define Request.GetBody to avoid this error") - } - body, err := getBody() - if err != nil { - return nil, err - } - newReq := *req - newReq.Body = body - return &newReq, nil } + if !afterBodyWrite { + return req, nil + } + // If the Body is nil (or http.NoBody), it's safe to reuse + // this request and its Body. + if req.Body == nil || reqBodyIsNoBody(req.Body) { + return req, nil + } + // Otherwise we depend on the Request having its GetBody + // func defined. + getBody := reqGetBody(req) // Go 1.8: getBody = req.GetBody + if getBody == nil { + return nil, fmt.Errorf("http2: Transport: cannot retry err [%v] after Request.Body was written; define Request.GetBody to avoid this error", err) + } + body, err := getBody() + if err != nil { + return nil, err + } + newReq := *req + newReq.Body = body + return &newReq, nil +} + +func canRetryError(err error) bool { + if err == errClientConnUnusable || err == errClientConnGotGoAway { + return true + } + if se, ok := err.(StreamError); ok { + return se.Code == ErrCodeRefusedStream + } + return false } func (t *Transport) dialClientConn(addr string, singleUse bool) (*ClientConn, error) { @@ -560,6 +605,8 @@ func (cc *ClientConn) setGoAway(f *GoAwayFrame) { } } +// CanTakeNewRequest reports whether the connection can take a new request, +// meaning it has not been closed or received or sent a GOAWAY. func (cc *ClientConn) CanTakeNewRequest() bool { cc.mu.Lock() defer cc.mu.Unlock() @@ -571,11 +618,10 @@ func (cc *ClientConn) canTakeNewRequestLocked() bool { return false } return cc.goAway == nil && !cc.closed && - int64(len(cc.streams)+1) < int64(cc.maxConcurrentStreams) && - cc.nextStreamID < math.MaxInt32 + int64(cc.nextStreamID)+int64(cc.pendingRequests) < math.MaxInt32 } -// onIdleTimeout is called from a time.AfterFunc goroutine. It will +// onIdleTimeout is called from a time.AfterFunc goroutine. It will // only be called when we're idle, but because we're coming from a new // goroutine, there could be a new request coming in at the same time, // so this simply calls the synchronized closeIfIdle to shut down this @@ -694,7 +740,7 @@ func checkConnHeaders(req *http.Request) error { // req.ContentLength, where 0 actually means zero (not unknown) and -1 // means unknown. func actualContentLength(req *http.Request) int64 { - if req.Body == nil { + if req.Body == nil || reqBodyIsNoBody(req.Body) { return 0 } if req.ContentLength != 0 { @@ -718,15 +764,14 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { hasTrailers := trailers != "" cc.mu.Lock() - cc.lastActive = time.Now() - if cc.closed || !cc.canTakeNewRequestLocked() { + if err := cc.awaitOpenSlotForRequest(req); err != nil { cc.mu.Unlock() - return nil, errClientConnUnusable + return nil, err } body := req.Body - hasBody := body != nil contentLen := actualContentLength(req) + hasBody := contentLen != 0 // TODO(bradfitz): this is a copy of the logic in net/http. Unify somewhere? var requestedGzip bool @@ -809,21 +854,20 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { // 2xx, however, then assume the server DOES potentially // want our body (e.g. full-duplex streaming: // golang.org/issue/13444). If it turns out the server - // doesn't, they'll RST_STREAM us soon enough. This is a - // heuristic to avoid adding knobs to Transport. Hopefully + // doesn't, they'll RST_STREAM us soon enough. This is a + // heuristic to avoid adding knobs to Transport. Hopefully // we can keep it. bodyWriter.cancel() cs.abortRequestBodyWrite(errStopReqBodyWrite) } if re.err != nil { - if re.err == errClientConnGotGoAway { - cc.mu.Lock() - if cs.startedWrite { - re.err = errClientConnGotGoAwayAfterSomeReqBody - } - cc.mu.Unlock() - } + cc.mu.Lock() + afterBodyWrite := cs.startedWrite + cc.mu.Unlock() cc.forgetStreamID(cs.ID) + if afterBodyWrite { + return nil, afterReqBodyWriteError{re.err} + } return nil, re.err } res.Request = req @@ -836,31 +880,31 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { case re := <-readLoopResCh: return handleReadLoopResponse(re) case <-respHeaderTimer: - cc.forgetStreamID(cs.ID) if !hasBody || bodyWritten { cc.writeStreamReset(cs.ID, ErrCodeCancel, nil) } else { bodyWriter.cancel() cs.abortRequestBodyWrite(errStopReqBodyWriteAndCancel) } + cc.forgetStreamID(cs.ID) return nil, errTimeout case <-ctx.Done(): - cc.forgetStreamID(cs.ID) if !hasBody || bodyWritten { cc.writeStreamReset(cs.ID, ErrCodeCancel, nil) } else { bodyWriter.cancel() cs.abortRequestBodyWrite(errStopReqBodyWriteAndCancel) } + cc.forgetStreamID(cs.ID) return nil, ctx.Err() case <-req.Cancel: - cc.forgetStreamID(cs.ID) if !hasBody || bodyWritten { cc.writeStreamReset(cs.ID, ErrCodeCancel, nil) } else { bodyWriter.cancel() cs.abortRequestBodyWrite(errStopReqBodyWriteAndCancel) } + cc.forgetStreamID(cs.ID) return nil, errRequestCanceled case <-cs.peerReset: // processResetStream already removed the @@ -887,6 +931,45 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { } } +// awaitOpenSlotForRequest waits until len(streams) < maxConcurrentStreams. +// Must hold cc.mu. +func (cc *ClientConn) awaitOpenSlotForRequest(req *http.Request) error { + var waitingForConn chan struct{} + var waitingForConnErr error // guarded by cc.mu + for { + cc.lastActive = time.Now() + if cc.closed || !cc.canTakeNewRequestLocked() { + return errClientConnUnusable + } + if int64(len(cc.streams))+1 <= int64(cc.maxConcurrentStreams) { + if waitingForConn != nil { + close(waitingForConn) + } + return nil + } + // Unfortunately, we cannot wait on a condition variable and channel at + // the same time, so instead, we spin up a goroutine to check if the + // request is canceled while we wait for a slot to open in the connection. + if waitingForConn == nil { + waitingForConn = make(chan struct{}) + go func() { + if err := awaitRequestCancel(req, waitingForConn); err != nil { + cc.mu.Lock() + waitingForConnErr = err + cc.cond.Broadcast() + cc.mu.Unlock() + } + }() + } + cc.pendingRequests++ + cc.cond.Wait() + cc.pendingRequests-- + if waitingForConnErr != nil { + return waitingForConnErr + } + } +} + // requires cc.wmu be held func (cc *ClientConn) writeHeaders(streamID uint32, endStream bool, hdrs []byte) error { first := true // first frame written (HEADERS is first, then CONTINUATION) @@ -1246,7 +1329,9 @@ func (cc *ClientConn) streamByID(id uint32, andRemove bool) *clientStream { cc.idleTimer.Reset(cc.idleTimeout) } close(cs.done) - cc.cond.Broadcast() // wake up checkResetOrDone via clientStream.awaitFlowControl + // Wake up checkResetOrDone via clientStream.awaitFlowControl and + // wake up RoundTrip if there is a pending request. + cc.cond.Broadcast() } return cs } @@ -1345,8 +1430,9 @@ func (rl *clientConnReadLoop) run() error { cc.vlogf("http2: Transport readFrame error on conn %p: (%T) %v", cc, err, err) } if se, ok := err.(StreamError); ok { - if cs := cc.streamByID(se.StreamID, true /*ended; remove it*/); cs != nil { + if cs := cc.streamByID(se.StreamID, false); cs != nil { cs.cc.writeStreamReset(cs.ID, se.Code, err) + cs.cc.forgetStreamID(cs.ID) if se.Cause == nil { se.Cause = cc.fr.errDetail } @@ -1528,8 +1614,7 @@ func (rl *clientConnReadLoop) handleResponse(cs *clientStream, f *MetaHeadersFra return res, nil } - buf := new(bytes.Buffer) // TODO(bradfitz): recycle this garbage - cs.bufPipe = pipe{b: buf} + cs.bufPipe = pipe{b: &dataBuffer{expected: res.ContentLength}} cs.bytesRemain = res.ContentLength res.Body = transportResponseBody{cs} go cs.awaitRequestCancel(cs.req) @@ -1656,6 +1741,7 @@ func (b transportResponseBody) Close() error { cc.wmu.Lock() if !serverSentStreamEnd { cc.fr.WriteRSTStream(cs.ID, ErrCodeCancel) + cs.didReset = true } // Return connection-level flow control. if unread > 0 { @@ -1668,6 +1754,7 @@ func (b transportResponseBody) Close() error { } cs.bufPipe.BreakWithError(errClosedResponseBody) + cc.forgetStreamID(cs.ID) return nil } @@ -1703,12 +1790,6 @@ func (rl *clientConnReadLoop) processData(f *DataFrame) error { return nil } if f.Length > 0 { - if len(data) > 0 && cs.bufPipe.b == nil { - // Data frame after it's already closed? - cc.logf("http2: Transport received DATA frame for closed stream; closing connection") - return ConnectionError(ErrCodeProtocol) - } - // Check connection-level flow control. cc.mu.Lock() if cs.inflow.available() >= int32(f.Length) { @@ -1719,16 +1800,27 @@ func (rl *clientConnReadLoop) processData(f *DataFrame) error { } // Return any padded flow control now, since we won't // refund it later on body reads. - if pad := int32(f.Length) - int32(len(data)); pad > 0 { - cs.inflow.add(pad) - cc.inflow.add(pad) + var refund int + if pad := int(f.Length) - len(data); pad > 0 { + refund += pad + } + // Return len(data) now if the stream is already closed, + // since data will never be read. + didReset := cs.didReset + if didReset { + refund += len(data) + } + if refund > 0 { + cc.inflow.add(int32(refund)) cc.wmu.Lock() - cc.fr.WriteWindowUpdate(0, uint32(pad)) - cc.fr.WriteWindowUpdate(cs.ID, uint32(pad)) + cc.fr.WriteWindowUpdate(0, uint32(refund)) + if !didReset { + cs.inflow.add(int32(refund)) + cc.fr.WriteWindowUpdate(cs.ID, uint32(refund)) + } cc.bw.Flush() cc.wmu.Unlock() } - didReset := cs.didReset cc.mu.Unlock() if len(data) > 0 && !didReset { diff --git a/vendor/golang.org/x/net/http2/writesched_priority.go b/vendor/golang.org/x/net/http2/writesched_priority.go index 01132721bdd..848fed6ec76 100644 --- a/vendor/golang.org/x/net/http2/writesched_priority.go +++ b/vendor/golang.org/x/net/http2/writesched_priority.go @@ -53,7 +53,7 @@ type PriorityWriteSchedulerConfig struct { } // NewPriorityWriteScheduler constructs a WriteScheduler that schedules -// frames by following HTTP/2 priorities as described in RFC 7340 Section 5.3. +// frames by following HTTP/2 priorities as described in RFC 7540 Section 5.3. // If cfg is nil, default options are used. func NewPriorityWriteScheduler(cfg *PriorityWriteSchedulerConfig) WriteScheduler { if cfg == nil { diff --git a/vendor/golang.org/x/net/idna/BUILD b/vendor/golang.org/x/net/idna/BUILD index f16a929c55f..58f9b754402 100644 --- a/vendor/golang.org/x/net/idna/BUILD +++ b/vendor/golang.org/x/net/idna/BUILD @@ -5,8 +5,15 @@ go_library( srcs = [ "idna.go", "punycode.go", + "tables.go", + "trie.go", + "trieval.go", ], visibility = ["//visibility:public"], + deps = [ + "//vendor/golang.org/x/text/secure/bidirule:go_default_library", + "//vendor/golang.org/x/text/unicode/norm:go_default_library", + ], ) filegroup( diff --git a/vendor/golang.org/x/net/idna/idna.go b/vendor/golang.org/x/net/idna/idna.go index 35ff39d81b1..1810100bfd8 100644 --- a/vendor/golang.org/x/net/idna/idna.go +++ b/vendor/golang.org/x/net/idna/idna.go @@ -1,61 +1,673 @@ -// Copyright 2012 The Go Authors. All rights reserved. +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// Copyright 2016 The Go Authors. All rights reserved. // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// Package idna implements IDNA2008 (Internationalized Domain Names for -// Applications), defined in RFC 5890, RFC 5891, RFC 5892, RFC 5893 and -// RFC 5894. +// Package idna implements IDNA2008 using the compatibility processing +// defined by UTS (Unicode Technical Standard) #46, which defines a standard to +// deal with the transition from IDNA2003. +// +// IDNA2008 (Internationalized Domain Names for Applications), is defined in RFC +// 5890, RFC 5891, RFC 5892, RFC 5893 and RFC 5894. +// UTS #46 is defined in http://www.unicode.org/reports/tr46. +// See http://unicode.org/cldr/utility/idna.jsp for a visualization of the +// differences between these two standards. package idna import ( + "fmt" "strings" "unicode/utf8" + + "golang.org/x/text/secure/bidirule" + "golang.org/x/text/unicode/norm" ) -// TODO(nigeltao): specify when errors occur. For example, is ToASCII(".") or -// ToASCII("foo\x00") an error? See also http://www.unicode.org/faq/idn.html#11 +// NOTE: Unlike common practice in Go APIs, the functions will return a +// sanitized domain name in case of errors. Browsers sometimes use a partially +// evaluated string as lookup. +// TODO: the current error handling is, in my opinion, the least opinionated. +// Other strategies are also viable, though: +// Option 1) Return an empty string in case of error, but allow the user to +// specify explicitly which errors to ignore. +// Option 2) Return the partially evaluated string if it is itself a valid +// string, otherwise return the empty string in case of error. +// Option 3) Option 1 and 2. +// Option 4) Always return an empty string for now and implement Option 1 as +// needed, and document that the return string may not be empty in case of +// error in the future. +// I think Option 1 is best, but it is quite opinionated. -// acePrefix is the ASCII Compatible Encoding prefix. -const acePrefix = "xn--" +// ToASCII is a wrapper for Punycode.ToASCII. +func ToASCII(s string) (string, error) { + return Punycode.process(s, true) +} + +// ToUnicode is a wrapper for Punycode.ToUnicode. +func ToUnicode(s string) (string, error) { + return Punycode.process(s, false) +} + +// An Option configures a Profile at creation time. +type Option func(*options) + +// Transitional sets a Profile to use the Transitional mapping as defined in UTS +// #46. This will cause, for example, "ß" to be mapped to "ss". Using the +// transitional mapping provides a compromise between IDNA2003 and IDNA2008 +// compatibility. It is used by most browsers when resolving domain names. This +// option is only meaningful if combined with MapForLookup. +func Transitional(transitional bool) Option { + return func(o *options) { o.transitional = true } +} + +// VerifyDNSLength sets whether a Profile should fail if any of the IDN parts +// are longer than allowed by the RFC. +func VerifyDNSLength(verify bool) Option { + return func(o *options) { o.verifyDNSLength = verify } +} + +// RemoveLeadingDots removes leading label separators. Leading runes that map to +// dots, such as U+3002, are removed as well. +// +// This is the behavior suggested by the UTS #46 and is adopted by some +// browsers. +func RemoveLeadingDots(remove bool) Option { + return func(o *options) { o.removeLeadingDots = remove } +} + +// ValidateLabels sets whether to check the mandatory label validation criteria +// as defined in Section 5.4 of RFC 5891. This includes testing for correct use +// of hyphens ('-'), normalization, validity of runes, and the context rules. +func ValidateLabels(enable bool) Option { + return func(o *options) { + // Don't override existing mappings, but set one that at least checks + // normalization if it is not set. + if o.mapping == nil && enable { + o.mapping = normalize + } + o.trie = trie + o.validateLabels = enable + o.fromPuny = validateFromPunycode + } +} + +// StrictDomainName limits the set of permissable ASCII characters to those +// allowed in domain names as defined in RFC 1034 (A-Z, a-z, 0-9 and the +// hyphen). This is set by default for MapForLookup and ValidateForRegistration. +// +// This option is useful, for instance, for browsers that allow characters +// outside this range, for example a '_' (U+005F LOW LINE). See +// http://www.rfc-editor.org/std/std3.txt for more details This option +// corresponds to the UseSTD3ASCIIRules option in UTS #46. +func StrictDomainName(use bool) Option { + return func(o *options) { + o.trie = trie + o.useSTD3Rules = use + o.fromPuny = validateFromPunycode + } +} + +// NOTE: the following options pull in tables. The tables should not be linked +// in as long as the options are not used. + +// BidiRule enables the Bidi rule as defined in RFC 5893. Any application +// that relies on proper validation of labels should include this rule. +func BidiRule() Option { + return func(o *options) { o.bidirule = bidirule.ValidString } +} + +// ValidateForRegistration sets validation options to verify that a given IDN is +// properly formatted for registration as defined by Section 4 of RFC 5891. +func ValidateForRegistration() Option { + return func(o *options) { + o.mapping = validateRegistration + StrictDomainName(true)(o) + ValidateLabels(true)(o) + VerifyDNSLength(true)(o) + BidiRule()(o) + } +} + +// MapForLookup sets validation and mapping options such that a given IDN is +// transformed for domain name lookup according to the requirements set out in +// Section 5 of RFC 5891. The mappings follow the recommendations of RFC 5894, +// RFC 5895 and UTS 46. It does not add the Bidi Rule. Use the BidiRule option +// to add this check. +// +// The mappings include normalization and mapping case, width and other +// compatibility mappings. +func MapForLookup() Option { + return func(o *options) { + o.mapping = validateAndMap + StrictDomainName(true)(o) + ValidateLabels(true)(o) + RemoveLeadingDots(true)(o) + } +} + +type options struct { + transitional bool + useSTD3Rules bool + validateLabels bool + verifyDNSLength bool + removeLeadingDots bool + + trie *idnaTrie + + // fromPuny calls validation rules when converting A-labels to U-labels. + fromPuny func(p *Profile, s string) error + + // mapping implements a validation and mapping step as defined in RFC 5895 + // or UTS 46, tailored to, for example, domain registration or lookup. + mapping func(p *Profile, s string) (string, error) + + // bidirule, if specified, checks whether s conforms to the Bidi Rule + // defined in RFC 5893. + bidirule func(s string) bool +} + +// A Profile defines the configuration of a IDNA mapper. +type Profile struct { + options +} + +func apply(o *options, opts []Option) { + for _, f := range opts { + f(o) + } +} + +// New creates a new Profile. +// +// With no options, the returned Profile is the most permissive and equals the +// Punycode Profile. Options can be passed to further restrict the Profile. The +// MapForLookup and ValidateForRegistration options set a collection of options, +// for lookup and registration purposes respectively, which can be tailored by +// adding more fine-grained options, where later options override earlier +// options. +func New(o ...Option) *Profile { + p := &Profile{} + apply(&p.options, o) + return p +} // ToASCII converts a domain or domain label to its ASCII form. For example, // ToASCII("bücher.example.com") is "xn--bcher-kva.example.com", and -// ToASCII("golang") is "golang". -func ToASCII(s string) (string, error) { - if ascii(s) { - return s, nil - } - labels := strings.Split(s, ".") - for i, label := range labels { - if !ascii(label) { - a, err := encode(acePrefix, label) - if err != nil { - return "", err - } - labels[i] = a - } - } - return strings.Join(labels, "."), nil +// ToASCII("golang") is "golang". If an error is encountered it will return +// an error and a (partially) processed result. +func (p *Profile) ToASCII(s string) (string, error) { + return p.process(s, true) } // ToUnicode converts a domain or domain label to its Unicode form. For example, // ToUnicode("xn--bcher-kva.example.com") is "bücher.example.com", and -// ToUnicode("golang") is "golang". -func ToUnicode(s string) (string, error) { - if !strings.Contains(s, acePrefix) { - return s, nil +// ToUnicode("golang") is "golang". If an error is encountered it will return +// an error and a (partially) processed result. +func (p *Profile) ToUnicode(s string) (string, error) { + pp := *p + pp.transitional = false + return pp.process(s, false) +} + +// String reports a string with a description of the profile for debugging +// purposes. The string format may change with different versions. +func (p *Profile) String() string { + s := "" + if p.transitional { + s = "Transitional" + } else { + s = "NonTransitional" } - labels := strings.Split(s, ".") - for i, label := range labels { - if strings.HasPrefix(label, acePrefix) { - u, err := decode(label[len(acePrefix):]) - if err != nil { - return "", err - } - labels[i] = u + if p.useSTD3Rules { + s += ":UseSTD3Rules" + } + if p.validateLabels { + s += ":ValidateLabels" + } + if p.verifyDNSLength { + s += ":VerifyDNSLength" + } + return s +} + +var ( + // Punycode is a Profile that does raw punycode processing with a minimum + // of validation. + Punycode *Profile = punycode + + // Lookup is the recommended profile for looking up domain names, according + // to Section 5 of RFC 5891. The exact configuration of this profile may + // change over time. + Lookup *Profile = lookup + + // Display is the recommended profile for displaying domain names. + // The configuration of this profile may change over time. + Display *Profile = display + + // Registration is the recommended profile for checking whether a given + // IDN is valid for registration, according to Section 4 of RFC 5891. + Registration *Profile = registration + + punycode = &Profile{} + lookup = &Profile{options{ + transitional: true, + useSTD3Rules: true, + validateLabels: true, + removeLeadingDots: true, + trie: trie, + fromPuny: validateFromPunycode, + mapping: validateAndMap, + bidirule: bidirule.ValidString, + }} + display = &Profile{options{ + useSTD3Rules: true, + validateLabels: true, + removeLeadingDots: true, + trie: trie, + fromPuny: validateFromPunycode, + mapping: validateAndMap, + bidirule: bidirule.ValidString, + }} + registration = &Profile{options{ + useSTD3Rules: true, + validateLabels: true, + verifyDNSLength: true, + trie: trie, + fromPuny: validateFromPunycode, + mapping: validateRegistration, + bidirule: bidirule.ValidString, + }} + + // TODO: profiles + // Register: recommended for approving domain names: don't do any mappings + // but rather reject on invalid input. Bundle or block deviation characters. +) + +type labelError struct{ label, code_ string } + +func (e labelError) code() string { return e.code_ } +func (e labelError) Error() string { + return fmt.Sprintf("idna: invalid label %q", e.label) +} + +type runeError rune + +func (e runeError) code() string { return "P1" } +func (e runeError) Error() string { + return fmt.Sprintf("idna: disallowed rune %U", e) +} + +// process implements the algorithm described in section 4 of UTS #46, +// see http://www.unicode.org/reports/tr46. +func (p *Profile) process(s string, toASCII bool) (string, error) { + var err error + if p.mapping != nil { + s, err = p.mapping(p, s) + } + // Remove leading empty labels. + if p.removeLeadingDots { + for ; len(s) > 0 && s[0] == '.'; s = s[1:] { } } - return strings.Join(labels, "."), nil + // It seems like we should only create this error on ToASCII, but the + // UTS 46 conformance tests suggests we should always check this. + if err == nil && p.verifyDNSLength && s == "" { + err = &labelError{s, "A4"} + } + labels := labelIter{orig: s} + for ; !labels.done(); labels.next() { + label := labels.label() + if label == "" { + // Empty labels are not okay. The label iterator skips the last + // label if it is empty. + if err == nil && p.verifyDNSLength { + err = &labelError{s, "A4"} + } + continue + } + if strings.HasPrefix(label, acePrefix) { + u, err2 := decode(label[len(acePrefix):]) + if err2 != nil { + if err == nil { + err = err2 + } + // Spec says keep the old label. + continue + } + labels.set(u) + if err == nil && p.validateLabels { + err = p.fromPuny(p, u) + } + if err == nil { + // This should be called on NonTransitional, according to the + // spec, but that currently does not have any effect. Use the + // original profile to preserve options. + err = p.validateLabel(u) + } + } else if err == nil { + err = p.validateLabel(label) + } + } + if toASCII { + for labels.reset(); !labels.done(); labels.next() { + label := labels.label() + if !ascii(label) { + a, err2 := encode(acePrefix, label) + if err == nil { + err = err2 + } + label = a + labels.set(a) + } + n := len(label) + if p.verifyDNSLength && err == nil && (n == 0 || n > 63) { + err = &labelError{label, "A4"} + } + } + } + s = labels.result() + if toASCII && p.verifyDNSLength && err == nil { + // Compute the length of the domain name minus the root label and its dot. + n := len(s) + if n > 0 && s[n-1] == '.' { + n-- + } + if len(s) < 1 || n > 253 { + err = &labelError{s, "A4"} + } + } + return s, err +} + +func normalize(p *Profile, s string) (string, error) { + return norm.NFC.String(s), nil +} + +func validateRegistration(p *Profile, s string) (string, error) { + if !norm.NFC.IsNormalString(s) { + return s, &labelError{s, "V1"} + } + for i := 0; i < len(s); { + v, sz := trie.lookupString(s[i:]) + // Copy bytes not copied so far. + switch p.simplify(info(v).category()) { + // TODO: handle the NV8 defined in the Unicode idna data set to allow + // for strict conformance to IDNA2008. + case valid, deviation: + case disallowed, mapped, unknown, ignored: + r, _ := utf8.DecodeRuneInString(s[i:]) + return s, runeError(r) + } + i += sz + } + return s, nil +} + +func validateAndMap(p *Profile, s string) (string, error) { + var ( + err error + b []byte + k int + ) + for i := 0; i < len(s); { + v, sz := trie.lookupString(s[i:]) + start := i + i += sz + // Copy bytes not copied so far. + switch p.simplify(info(v).category()) { + case valid: + continue + case disallowed: + if err == nil { + r, _ := utf8.DecodeRuneInString(s[start:]) + err = runeError(r) + } + continue + case mapped, deviation: + b = append(b, s[k:start]...) + b = info(v).appendMapping(b, s[start:i]) + case ignored: + b = append(b, s[k:start]...) + // drop the rune + case unknown: + b = append(b, s[k:start]...) + b = append(b, "\ufffd"...) + } + k = i + } + if k == 0 { + // No changes so far. + s = norm.NFC.String(s) + } else { + b = append(b, s[k:]...) + if norm.NFC.QuickSpan(b) != len(b) { + b = norm.NFC.Bytes(b) + } + // TODO: the punycode converters require strings as input. + s = string(b) + } + return s, err +} + +// A labelIter allows iterating over domain name labels. +type labelIter struct { + orig string + slice []string + curStart int + curEnd int + i int +} + +func (l *labelIter) reset() { + l.curStart = 0 + l.curEnd = 0 + l.i = 0 +} + +func (l *labelIter) done() bool { + return l.curStart >= len(l.orig) +} + +func (l *labelIter) result() string { + if l.slice != nil { + return strings.Join(l.slice, ".") + } + return l.orig +} + +func (l *labelIter) label() string { + if l.slice != nil { + return l.slice[l.i] + } + p := strings.IndexByte(l.orig[l.curStart:], '.') + l.curEnd = l.curStart + p + if p == -1 { + l.curEnd = len(l.orig) + } + return l.orig[l.curStart:l.curEnd] +} + +// next sets the value to the next label. It skips the last label if it is empty. +func (l *labelIter) next() { + l.i++ + if l.slice != nil { + if l.i >= len(l.slice) || l.i == len(l.slice)-1 && l.slice[l.i] == "" { + l.curStart = len(l.orig) + } + } else { + l.curStart = l.curEnd + 1 + if l.curStart == len(l.orig)-1 && l.orig[l.curStart] == '.' { + l.curStart = len(l.orig) + } + } +} + +func (l *labelIter) set(s string) { + if l.slice == nil { + l.slice = strings.Split(l.orig, ".") + } + l.slice[l.i] = s +} + +// acePrefix is the ASCII Compatible Encoding prefix. +const acePrefix = "xn--" + +func (p *Profile) simplify(cat category) category { + switch cat { + case disallowedSTD3Mapped: + if p.useSTD3Rules { + cat = disallowed + } else { + cat = mapped + } + case disallowedSTD3Valid: + if p.useSTD3Rules { + cat = disallowed + } else { + cat = valid + } + case deviation: + if !p.transitional { + cat = valid + } + case validNV8, validXV8: + // TODO: handle V2008 + cat = valid + } + return cat +} + +func validateFromPunycode(p *Profile, s string) error { + if !norm.NFC.IsNormalString(s) { + return &labelError{s, "V1"} + } + for i := 0; i < len(s); { + v, sz := trie.lookupString(s[i:]) + if c := p.simplify(info(v).category()); c != valid && c != deviation { + return &labelError{s, "V6"} + } + i += sz + } + return nil +} + +const ( + zwnj = "\u200c" + zwj = "\u200d" +) + +type joinState int8 + +const ( + stateStart joinState = iota + stateVirama + stateBefore + stateBeforeVirama + stateAfter + stateFAIL +) + +var joinStates = [][numJoinTypes]joinState{ + stateStart: { + joiningL: stateBefore, + joiningD: stateBefore, + joinZWNJ: stateFAIL, + joinZWJ: stateFAIL, + joinVirama: stateVirama, + }, + stateVirama: { + joiningL: stateBefore, + joiningD: stateBefore, + }, + stateBefore: { + joiningL: stateBefore, + joiningD: stateBefore, + joiningT: stateBefore, + joinZWNJ: stateAfter, + joinZWJ: stateFAIL, + joinVirama: stateBeforeVirama, + }, + stateBeforeVirama: { + joiningL: stateBefore, + joiningD: stateBefore, + joiningT: stateBefore, + }, + stateAfter: { + joiningL: stateFAIL, + joiningD: stateBefore, + joiningT: stateAfter, + joiningR: stateStart, + joinZWNJ: stateFAIL, + joinZWJ: stateFAIL, + joinVirama: stateAfter, // no-op as we can't accept joiners here + }, + stateFAIL: { + 0: stateFAIL, + joiningL: stateFAIL, + joiningD: stateFAIL, + joiningT: stateFAIL, + joiningR: stateFAIL, + joinZWNJ: stateFAIL, + joinZWJ: stateFAIL, + joinVirama: stateFAIL, + }, +} + +// validateLabel validates the criteria from Section 4.1. Item 1, 4, and 6 are +// already implicitly satisfied by the overall implementation. +func (p *Profile) validateLabel(s string) error { + if s == "" { + if p.verifyDNSLength { + return &labelError{s, "A4"} + } + return nil + } + if p.bidirule != nil && !p.bidirule(s) { + return &labelError{s, "B"} + } + if !p.validateLabels { + return nil + } + trie := p.trie // p.validateLabels is only set if trie is set. + if len(s) > 4 && s[2] == '-' && s[3] == '-' { + return &labelError{s, "V2"} + } + if s[0] == '-' || s[len(s)-1] == '-' { + return &labelError{s, "V3"} + } + // TODO: merge the use of this in the trie. + v, sz := trie.lookupString(s) + x := info(v) + if x.isModifier() { + return &labelError{s, "V5"} + } + // Quickly return in the absence of zero-width (non) joiners. + if strings.Index(s, zwj) == -1 && strings.Index(s, zwnj) == -1 { + return nil + } + st := stateStart + for i := 0; ; { + jt := x.joinType() + if s[i:i+sz] == zwj { + jt = joinZWJ + } else if s[i:i+sz] == zwnj { + jt = joinZWNJ + } + st = joinStates[st][jt] + if x.isViramaModifier() { + st = joinStates[st][joinVirama] + } + if i += sz; i == len(s) { + break + } + v, sz = trie.lookupString(s[i:]) + x = info(v) + } + if st == stateFAIL || st == stateAfter { + return &labelError{s, "C"} + } + return nil } func ascii(s string) bool { diff --git a/vendor/golang.org/x/net/idna/punycode.go b/vendor/golang.org/x/net/idna/punycode.go index 92e733f6a7b..02c7d59af3b 100644 --- a/vendor/golang.org/x/net/idna/punycode.go +++ b/vendor/golang.org/x/net/idna/punycode.go @@ -1,4 +1,6 @@ -// Copyright 2012 The Go Authors. All rights reserved. +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// Copyright 2016 The Go Authors. All rights reserved. // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. @@ -7,7 +9,6 @@ package idna // This file implements the Punycode algorithm from RFC 3492. import ( - "fmt" "math" "strings" "unicode/utf8" @@ -27,6 +28,8 @@ const ( tmin int32 = 1 ) +func punyError(s string) error { return &labelError{s, "A3"} } + // decode decodes a string as specified in section 6.2. func decode(encoded string) (string, error) { if encoded == "" { @@ -34,7 +37,7 @@ func decode(encoded string) (string, error) { } pos := 1 + strings.LastIndex(encoded, "-") if pos == 1 { - return "", fmt.Errorf("idna: invalid label %q", encoded) + return "", punyError(encoded) } if pos == len(encoded) { return encoded[:len(encoded)-1], nil @@ -50,16 +53,16 @@ func decode(encoded string) (string, error) { oldI, w := i, int32(1) for k := base; ; k += base { if pos == len(encoded) { - return "", fmt.Errorf("idna: invalid label %q", encoded) + return "", punyError(encoded) } digit, ok := decodeDigit(encoded[pos]) if !ok { - return "", fmt.Errorf("idna: invalid label %q", encoded) + return "", punyError(encoded) } pos++ i += digit * w if i < 0 { - return "", fmt.Errorf("idna: invalid label %q", encoded) + return "", punyError(encoded) } t := k - bias if t < tmin { @@ -72,7 +75,7 @@ func decode(encoded string) (string, error) { } w *= base - t if w >= math.MaxInt32/base { - return "", fmt.Errorf("idna: invalid label %q", encoded) + return "", punyError(encoded) } } x := int32(len(output) + 1) @@ -80,7 +83,7 @@ func decode(encoded string) (string, error) { n += i / x i %= x if n > utf8.MaxRune || len(output) >= 1024 { - return "", fmt.Errorf("idna: invalid label %q", encoded) + return "", punyError(encoded) } output = append(output, 0) copy(output[i+1:], output[i:]) @@ -121,14 +124,14 @@ func encode(prefix, s string) (string, error) { } delta += (m - n) * (h + 1) if delta < 0 { - return "", fmt.Errorf("idna: invalid label %q", s) + return "", punyError(s) } n = m for _, r := range s { if r < n { delta++ if delta < 0 { - return "", fmt.Errorf("idna: invalid label %q", s) + return "", punyError(s) } continue } diff --git a/vendor/golang.org/x/net/idna/tables.go b/vendor/golang.org/x/net/idna/tables.go new file mode 100644 index 00000000000..d2819345fcd --- /dev/null +++ b/vendor/golang.org/x/net/idna/tables.go @@ -0,0 +1,4477 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package idna + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "9.0.0" + +var mappings string = "" + // Size: 8176 bytes + "\x00\x01 \x03 ̈\x01a\x03 ̄\x012\x013\x03 ́\x03 ̧\x011\x01o\x051⁄4\x051⁄2" + + "\x053⁄4\x03i̇\x03l·\x03ʼn\x01s\x03dž\x03ⱥ\x03ⱦ\x01h\x01j\x01r\x01w\x01y" + + "\x03 ̆\x03 ̇\x03 ̊\x03 ̨\x03 ̃\x03 ̋\x01l\x01x\x04̈́\x03 ι\x01;\x05 ̈́" + + "\x04եւ\x04اٴ\x04وٴ\x04ۇٴ\x04يٴ\x06क़\x06ख़\x06ग़\x06ज़\x06ड़\x06ढ़\x06फ़" + + "\x06य़\x06ড়\x06ঢ়\x06য়\x06ਲ਼\x06ਸ਼\x06ਖ਼\x06ਗ਼\x06ਜ਼\x06ਫ਼\x06ଡ଼\x06ଢ଼" + + "\x06ํา\x06ໍາ\x06ຫນ\x06ຫມ\x06གྷ\x06ཌྷ\x06དྷ\x06བྷ\x06ཛྷ\x06ཀྵ\x06ཱི\x06ཱུ" + + "\x06ྲྀ\x09ྲཱྀ\x06ླྀ\x09ླཱྀ\x06ཱྀ\x06ྒྷ\x06ྜྷ\x06ྡྷ\x06ྦྷ\x06ྫྷ\x06ྐྵ\x02" + + "в\x02д\x02о\x02с\x02т\x02ъ\x02ѣ\x02æ\x01b\x01d\x01e\x02ǝ\x01g\x01i\x01k" + + "\x01m\x01n\x02ȣ\x01p\x01t\x01u\x02ɐ\x02ɑ\x02ə\x02ɛ\x02ɜ\x02ŋ\x02ɔ\x02ɯ" + + "\x01v\x02β\x02γ\x02δ\x02φ\x02χ\x02ρ\x02н\x02ɒ\x01c\x02ɕ\x02ð\x01f\x02ɟ" + + "\x02ɡ\x02ɥ\x02ɨ\x02ɩ\x02ɪ\x02ʝ\x02ɭ\x02ʟ\x02ɱ\x02ɰ\x02ɲ\x02ɳ\x02ɴ\x02ɵ" + + "\x02ɸ\x02ʂ\x02ʃ\x02ƫ\x02ʉ\x02ʊ\x02ʋ\x02ʌ\x01z\x02ʐ\x02ʑ\x02ʒ\x02θ\x02ss" + + "\x02ά\x02έ\x02ή\x02ί\x02ό\x02ύ\x02ώ\x05ἀι\x05ἁι\x05ἂι\x05ἃι\x05ἄι\x05ἅι" + + "\x05ἆι\x05ἇι\x05ἠι\x05ἡι\x05ἢι\x05ἣι\x05ἤι\x05ἥι\x05ἦι\x05ἧι\x05ὠι\x05ὡι" + + "\x05ὢι\x05ὣι\x05ὤι\x05ὥι\x05ὦι\x05ὧι\x05ὰι\x04αι\x04άι\x05ᾶι\x02ι\x05 ̈͂" + + "\x05ὴι\x04ηι\x04ήι\x05ῆι\x05 ̓̀\x05 ̓́\x05 ̓͂\x02ΐ\x05 ̔̀\x05 ̔́\x05 ̔͂" + + "\x02ΰ\x05 ̈̀\x01`\x05ὼι\x04ωι\x04ώι\x05ῶι\x06′′\x09′′′\x06‵‵\x09‵‵‵\x02!" + + "!\x02??\x02?!\x02!?\x0c′′′′\x010\x014\x015\x016\x017\x018\x019\x01+\x01=" + + "\x01(\x01)\x02rs\x02ħ\x02no\x01q\x02sm\x02tm\x02ω\x02å\x02א\x02ב\x02ג" + + "\x02ד\x02π\x051⁄7\x051⁄9\x061⁄10\x051⁄3\x052⁄3\x051⁄5\x052⁄5\x053⁄5\x054" + + "⁄5\x051⁄6\x055⁄6\x051⁄8\x053⁄8\x055⁄8\x057⁄8\x041⁄\x02ii\x02iv\x02vi" + + "\x04viii\x02ix\x02xi\x050⁄3\x06∫∫\x09∫∫∫\x06∮∮\x09∮∮∮\x0210\x0211\x0212" + + "\x0213\x0214\x0215\x0216\x0217\x0218\x0219\x0220\x04(10)\x04(11)\x04(12)" + + "\x04(13)\x04(14)\x04(15)\x04(16)\x04(17)\x04(18)\x04(19)\x04(20)\x0c∫∫∫∫" + + "\x02==\x05⫝̸\x02ɫ\x02ɽ\x02ȿ\x02ɀ\x01.\x04 ゙\x04 ゚\x06より\x06コト\x05(ᄀ)\x05" + + "(ᄂ)\x05(ᄃ)\x05(ᄅ)\x05(ᄆ)\x05(ᄇ)\x05(ᄉ)\x05(ᄋ)\x05(ᄌ)\x05(ᄎ)\x05(ᄏ)\x05(ᄐ" + + ")\x05(ᄑ)\x05(ᄒ)\x05(가)\x05(나)\x05(다)\x05(라)\x05(마)\x05(바)\x05(사)\x05(아)" + + "\x05(자)\x05(차)\x05(카)\x05(타)\x05(파)\x05(하)\x05(주)\x08(오전)\x08(오후)\x05(一)" + + "\x05(二)\x05(三)\x05(四)\x05(五)\x05(六)\x05(七)\x05(八)\x05(九)\x05(十)\x05(月)" + + "\x05(火)\x05(水)\x05(木)\x05(金)\x05(土)\x05(日)\x05(株)\x05(有)\x05(社)\x05(名)" + + "\x05(特)\x05(財)\x05(祝)\x05(労)\x05(代)\x05(呼)\x05(学)\x05(監)\x05(企)\x05(資)" + + "\x05(協)\x05(祭)\x05(休)\x05(自)\x05(至)\x0221\x0222\x0223\x0224\x0225\x0226" + + "\x0227\x0228\x0229\x0230\x0231\x0232\x0233\x0234\x0235\x06참고\x06주의\x0236" + + "\x0237\x0238\x0239\x0240\x0241\x0242\x0243\x0244\x0245\x0246\x0247\x0248" + + "\x0249\x0250\x041月\x042月\x043月\x044月\x045月\x046月\x047月\x048月\x049月\x0510" + + "月\x0511月\x0512月\x02hg\x02ev\x0cアパート\x0cアルファ\x0cアンペア\x09アール\x0cイニング\x09" + + "インチ\x09ウォン\x0fエスクード\x0cエーカー\x09オンス\x09オーム\x09カイリ\x0cカラット\x0cカロリー\x09ガロ" + + "ン\x09ガンマ\x06ギガ\x09ギニー\x0cキュリー\x0cギルダー\x06キロ\x0fキログラム\x12キロメートル\x0fキロワッ" + + "ト\x09グラム\x0fグラムトン\x0fクルゼイロ\x0cクローネ\x09ケース\x09コルナ\x09コーポ\x0cサイクル\x0fサンチ" + + "ーム\x0cシリング\x09センチ\x09セント\x09ダース\x06デシ\x06ドル\x06トン\x06ナノ\x09ノット\x09ハイツ" + + "\x0fパーセント\x09パーツ\x0cバーレル\x0fピアストル\x09ピクル\x06ピコ\x06ビル\x0fファラッド\x0cフィート" + + "\x0fブッシェル\x09フラン\x0fヘクタール\x06ペソ\x09ペニヒ\x09ヘルツ\x09ペンス\x09ページ\x09ベータ\x0cポイ" + + "ント\x09ボルト\x06ホン\x09ポンド\x09ホール\x09ホーン\x0cマイクロ\x09マイル\x09マッハ\x09マルク\x0fマ" + + "ンション\x0cミクロン\x06ミリ\x0fミリバール\x06メガ\x0cメガトン\x0cメートル\x09ヤード\x09ヤール\x09ユアン" + + "\x0cリットル\x06リラ\x09ルピー\x0cルーブル\x06レム\x0fレントゲン\x09ワット\x040点\x041点\x042点" + + "\x043点\x044点\x045点\x046点\x047点\x048点\x049点\x0510点\x0511点\x0512点\x0513点" + + "\x0514点\x0515点\x0516点\x0517点\x0518点\x0519点\x0520点\x0521点\x0522点\x0523点" + + "\x0524点\x02da\x02au\x02ov\x02pc\x02dm\x02iu\x06平成\x06昭和\x06大正\x06明治\x0c株" + + "式会社\x02pa\x02na\x02ma\x02ka\x02kb\x02mb\x02gb\x04kcal\x02pf\x02nf\x02m" + + "g\x02kg\x02hz\x02ml\x02dl\x02kl\x02fm\x02nm\x02mm\x02cm\x02km\x02m2\x02m" + + "3\x05m∕s\x06m∕s2\x07rad∕s\x08rad∕s2\x02ps\x02ns\x02ms\x02pv\x02nv\x02mv" + + "\x02kv\x02pw\x02nw\x02mw\x02kw\x02bq\x02cc\x02cd\x06c∕kg\x02db\x02gy\x02" + + "ha\x02hp\x02in\x02kk\x02kt\x02lm\x02ln\x02lx\x02ph\x02pr\x02sr\x02sv\x02" + + "wb\x05v∕m\x05a∕m\x041日\x042日\x043日\x044日\x045日\x046日\x047日\x048日\x049日" + + "\x0510日\x0511日\x0512日\x0513日\x0514日\x0515日\x0516日\x0517日\x0518日\x0519日" + + "\x0520日\x0521日\x0522日\x0523日\x0524日\x0525日\x0526日\x0527日\x0528日\x0529日" + + "\x0530日\x0531日\x02ь\x02ɦ\x02ɬ\x02ʞ\x02ʇ\x02œ\x04𤋮\x04𢡊\x04𢡄\x04𣏕\x04𥉉" + + "\x04𥳐\x04𧻓\x02ff\x02fi\x02fl\x02st\x04մն\x04մե\x04մի\x04վն\x04մխ\x04יִ" + + "\x04ײַ\x02ע\x02ה\x02כ\x02ל\x02ם\x02ר\x02ת\x04שׁ\x04שׂ\x06שּׁ\x06שּׂ\x04א" + + "ַ\x04אָ\x04אּ\x04בּ\x04גּ\x04דּ\x04הּ\x04וּ\x04זּ\x04טּ\x04יּ\x04ךּ\x04" + + "כּ\x04לּ\x04מּ\x04נּ\x04סּ\x04ףּ\x04פּ\x04צּ\x04קּ\x04רּ\x04שּ\x04תּ" + + "\x04וֹ\x04בֿ\x04כֿ\x04פֿ\x04אל\x02ٱ\x02ٻ\x02پ\x02ڀ\x02ٺ\x02ٿ\x02ٹ\x02ڤ" + + "\x02ڦ\x02ڄ\x02ڃ\x02چ\x02ڇ\x02ڍ\x02ڌ\x02ڎ\x02ڈ\x02ژ\x02ڑ\x02ک\x02گ\x02ڳ" + + "\x02ڱ\x02ں\x02ڻ\x02ۀ\x02ہ\x02ھ\x02ے\x02ۓ\x02ڭ\x02ۇ\x02ۆ\x02ۈ\x02ۋ\x02ۅ" + + "\x02ۉ\x02ې\x02ى\x04ئا\x04ئە\x04ئو\x04ئۇ\x04ئۆ\x04ئۈ\x04ئې\x04ئى\x02ی\x04" + + "ئج\x04ئح\x04ئم\x04ئي\x04بج\x04بح\x04بخ\x04بم\x04بى\x04بي\x04تج\x04تح" + + "\x04تخ\x04تم\x04تى\x04تي\x04ثج\x04ثم\x04ثى\x04ثي\x04جح\x04جم\x04حج\x04حم" + + "\x04خج\x04خح\x04خم\x04سج\x04سح\x04سخ\x04سم\x04صح\x04صم\x04ضج\x04ضح\x04ضخ" + + "\x04ضم\x04طح\x04طم\x04ظم\x04عج\x04عم\x04غج\x04غم\x04فج\x04فح\x04فخ\x04فم" + + "\x04فى\x04في\x04قح\x04قم\x04قى\x04قي\x04كا\x04كج\x04كح\x04كخ\x04كل\x04كم" + + "\x04كى\x04كي\x04لج\x04لح\x04لخ\x04لم\x04لى\x04لي\x04مج\x04مح\x04مخ\x04مم" + + "\x04مى\x04مي\x04نج\x04نح\x04نخ\x04نم\x04نى\x04ني\x04هج\x04هم\x04هى\x04هي" + + "\x04يج\x04يح\x04يخ\x04يم\x04يى\x04يي\x04ذٰ\x04رٰ\x04ىٰ\x05 ٌّ\x05 ٍّ\x05" + + " َّ\x05 ُّ\x05 ِّ\x05 ّٰ\x04ئر\x04ئز\x04ئن\x04بر\x04بز\x04بن\x04تر\x04تز" + + "\x04تن\x04ثر\x04ثز\x04ثن\x04ما\x04نر\x04نز\x04نن\x04ير\x04يز\x04ين\x04ئخ" + + "\x04ئه\x04به\x04ته\x04صخ\x04له\x04نه\x04هٰ\x04يه\x04ثه\x04سه\x04شم\x04شه" + + "\x06ـَّ\x06ـُّ\x06ـِّ\x04طى\x04طي\x04عى\x04عي\x04غى\x04غي\x04سى\x04سي" + + "\x04شى\x04شي\x04حى\x04حي\x04جى\x04جي\x04خى\x04خي\x04صى\x04صي\x04ضى\x04ضي" + + "\x04شج\x04شح\x04شخ\x04شر\x04سر\x04صر\x04ضر\x04اً\x06تجم\x06تحج\x06تحم" + + "\x06تخم\x06تمج\x06تمح\x06تمخ\x06جمح\x06حمي\x06حمى\x06سحج\x06سجح\x06سجى" + + "\x06سمح\x06سمج\x06سمم\x06صحح\x06صمم\x06شحم\x06شجي\x06شمخ\x06شمم\x06ضحى" + + "\x06ضخم\x06طمح\x06طمم\x06طمي\x06عجم\x06عمم\x06عمى\x06غمم\x06غمي\x06غمى" + + "\x06فخم\x06قمح\x06قمم\x06لحم\x06لحي\x06لحى\x06لجج\x06لخم\x06لمح\x06محج" + + "\x06محم\x06محي\x06مجح\x06مجم\x06مخج\x06مخم\x06مجخ\x06همج\x06همم\x06نحم" + + "\x06نحى\x06نجم\x06نجى\x06نمي\x06نمى\x06يمم\x06بخي\x06تجي\x06تجى\x06تخي" + + "\x06تخى\x06تمي\x06تمى\x06جمي\x06جحى\x06جمى\x06سخى\x06صحي\x06شحي\x06ضحي" + + "\x06لجي\x06لمي\x06يحي\x06يجي\x06يمي\x06ممي\x06قمي\x06نحي\x06عمي\x06كمي" + + "\x06نجح\x06مخي\x06لجم\x06كمم\x06جحي\x06حجي\x06مجي\x06فمي\x06بحي\x06سخي" + + "\x06نجي\x06صلے\x06قلے\x08الله\x08اكبر\x08محمد\x08صلعم\x08رسول\x08عليه" + + "\x08وسلم\x06صلى!صلى الله عليه وسلم\x0fجل جلاله\x08ریال\x01,\x01:\x01!" + + "\x01?\x01_\x01{\x01}\x01[\x01]\x01#\x01&\x01*\x01-\x01<\x01>\x01\\\x01$" + + "\x01%\x01@\x04ـً\x04ـَ\x04ـُ\x04ـِ\x04ـّ\x04ـْ\x02ء\x02آ\x02أ\x02ؤ\x02إ" + + "\x02ئ\x02ا\x02ب\x02ة\x02ت\x02ث\x02ج\x02ح\x02خ\x02د\x02ذ\x02ر\x02ز\x02س" + + "\x02ش\x02ص\x02ض\x02ط\x02ظ\x02ع\x02غ\x02ف\x02ق\x02ك\x02ل\x02م\x02ن\x02ه" + + "\x02و\x02ي\x04لآ\x04لأ\x04لإ\x04لا\x01\x22\x01'\x01/\x01^\x01|\x01~\x02¢" + + "\x02£\x02¬\x02¦\x02¥\x08𝅗𝅥\x08𝅘𝅥\x0c𝅘𝅥𝅮\x0c𝅘𝅥𝅯\x0c𝅘𝅥𝅰\x0c𝅘𝅥𝅱\x0c𝅘𝅥𝅲\x08𝆹" + + "𝅥\x08𝆺𝅥\x0c𝆹𝅥𝅮\x0c𝆺𝅥𝅮\x0c𝆹𝅥𝅯\x0c𝆺𝅥𝅯\x02ı\x02ȷ\x02α\x02ε\x02ζ\x02η\x02" + + "κ\x02λ\x02μ\x02ν\x02ξ\x02ο\x02σ\x02τ\x02υ\x02ψ\x03∇\x03∂\x02ϝ\x02ٮ\x02ڡ" + + "\x02ٯ\x020,\x021,\x022,\x023,\x024,\x025,\x026,\x027,\x028,\x029,\x03(a)" + + "\x03(b)\x03(c)\x03(d)\x03(e)\x03(f)\x03(g)\x03(h)\x03(i)\x03(j)\x03(k)" + + "\x03(l)\x03(m)\x03(n)\x03(o)\x03(p)\x03(q)\x03(r)\x03(s)\x03(t)\x03(u)" + + "\x03(v)\x03(w)\x03(x)\x03(y)\x03(z)\x07〔s〕\x02wz\x02hv\x02sd\x03ppv\x02w" + + "c\x02mc\x02md\x02dj\x06ほか\x06ココ\x03サ\x03手\x03字\x03双\x03デ\x03二\x03多\x03解" + + "\x03天\x03交\x03映\x03無\x03料\x03前\x03後\x03再\x03新\x03初\x03終\x03生\x03販\x03声" + + "\x03吹\x03演\x03投\x03捕\x03一\x03三\x03遊\x03左\x03中\x03右\x03指\x03走\x03打\x03禁" + + "\x03空\x03合\x03満\x03有\x03月\x03申\x03割\x03営\x03配\x09〔本〕\x09〔三〕\x09〔二〕\x09〔安" + + "〕\x09〔点〕\x09〔打〕\x09〔盗〕\x09〔勝〕\x09〔敗〕\x03得\x03可\x03丽\x03丸\x03乁\x03你\x03" + + "侮\x03侻\x03倂\x03偺\x03備\x03僧\x03像\x03㒞\x03免\x03兔\x03兤\x03具\x03㒹\x03內\x03" + + "冗\x03冤\x03仌\x03冬\x03况\x03凵\x03刃\x03㓟\x03刻\x03剆\x03剷\x03㔕\x03勇\x03勉\x03" + + "勤\x03勺\x03包\x03匆\x03北\x03卉\x03卑\x03博\x03即\x03卽\x03卿\x03灰\x03及\x03叟\x03" + + "叫\x03叱\x03吆\x03咞\x03吸\x03呈\x03周\x03咢\x03哶\x03唐\x03啓\x03啣\x03善\x03喙\x03" + + "喫\x03喳\x03嗂\x03圖\x03嘆\x03圗\x03噑\x03噴\x03切\x03壮\x03城\x03埴\x03堍\x03型\x03" + + "堲\x03報\x03墬\x03売\x03壷\x03夆\x03夢\x03奢\x03姬\x03娛\x03娧\x03姘\x03婦\x03㛮\x03" + + "嬈\x03嬾\x03寃\x03寘\x03寧\x03寳\x03寿\x03将\x03尢\x03㞁\x03屠\x03屮\x03峀\x03岍\x03" + + "嵃\x03嵮\x03嵫\x03嵼\x03巡\x03巢\x03㠯\x03巽\x03帨\x03帽\x03幩\x03㡢\x03㡼\x03庰\x03" + + "庳\x03庶\x03廊\x03廾\x03舁\x03弢\x03㣇\x03形\x03彫\x03㣣\x03徚\x03忍\x03志\x03忹\x03" + + "悁\x03㤺\x03㤜\x03悔\x03惇\x03慈\x03慌\x03慎\x03慺\x03憎\x03憲\x03憤\x03憯\x03懞\x03" + + "懲\x03懶\x03成\x03戛\x03扝\x03抱\x03拔\x03捐\x03挽\x03拼\x03捨\x03掃\x03揤\x03搢\x03" + + "揅\x03掩\x03㨮\x03摩\x03摾\x03撝\x03摷\x03㩬\x03敏\x03敬\x03旣\x03書\x03晉\x03㬙\x03" + + "暑\x03㬈\x03㫤\x03冒\x03冕\x03最\x03暜\x03肭\x03䏙\x03朗\x03望\x03朡\x03杞\x03杓\x03" + + "㭉\x03柺\x03枅\x03桒\x03梅\x03梎\x03栟\x03椔\x03㮝\x03楂\x03榣\x03槪\x03檨\x03櫛\x03" + + "㰘\x03次\x03歔\x03㱎\x03歲\x03殟\x03殺\x03殻\x03汎\x03沿\x03泍\x03汧\x03洖\x03派\x03" + + "海\x03流\x03浩\x03浸\x03涅\x03洴\x03港\x03湮\x03㴳\x03滋\x03滇\x03淹\x03潮\x03濆\x03" + + "瀹\x03瀞\x03瀛\x03㶖\x03灊\x03災\x03灷\x03炭\x03煅\x03熜\x03爨\x03爵\x03牐\x03犀\x03" + + "犕\x03獺\x03王\x03㺬\x03玥\x03㺸\x03瑇\x03瑜\x03瑱\x03璅\x03瓊\x03㼛\x03甤\x03甾\x03" + + "異\x03瘐\x03㿼\x03䀈\x03直\x03眞\x03真\x03睊\x03䀹\x03瞋\x03䁆\x03䂖\x03硎\x03碌\x03" + + "磌\x03䃣\x03祖\x03福\x03秫\x03䄯\x03穀\x03穊\x03穏\x03䈂\x03篆\x03築\x03䈧\x03糒\x03" + + "䊠\x03糨\x03糣\x03紀\x03絣\x03䌁\x03緇\x03縂\x03繅\x03䌴\x03䍙\x03罺\x03羕\x03翺\x03" + + "者\x03聠\x03聰\x03䏕\x03育\x03脃\x03䐋\x03脾\x03媵\x03舄\x03辞\x03䑫\x03芑\x03芋\x03" + + "芝\x03劳\x03花\x03芳\x03芽\x03苦\x03若\x03茝\x03荣\x03莭\x03茣\x03莽\x03菧\x03著\x03" + + "荓\x03菊\x03菌\x03菜\x03䔫\x03蓱\x03蓳\x03蔖\x03蕤\x03䕝\x03䕡\x03䕫\x03虐\x03虜\x03" + + "虧\x03虩\x03蚩\x03蚈\x03蜎\x03蛢\x03蝹\x03蜨\x03蝫\x03螆\x03蟡\x03蠁\x03䗹\x03衠\x03" + + "衣\x03裗\x03裞\x03䘵\x03裺\x03㒻\x03䚾\x03䛇\x03誠\x03諭\x03變\x03豕\x03貫\x03賁\x03" + + "贛\x03起\x03跋\x03趼\x03跰\x03軔\x03輸\x03邔\x03郱\x03鄑\x03鄛\x03鈸\x03鋗\x03鋘\x03" + + "鉼\x03鏹\x03鐕\x03開\x03䦕\x03閷\x03䧦\x03雃\x03嶲\x03霣\x03䩮\x03䩶\x03韠\x03䪲\x03" + + "頋\x03頩\x03飢\x03䬳\x03餩\x03馧\x03駂\x03駾\x03䯎\x03鬒\x03鱀\x03鳽\x03䳎\x03䳭\x03" + + "鵧\x03䳸\x03麻\x03䵖\x03黹\x03黾\x03鼅\x03鼏\x03鼖\x03鼻" + +var xorData string = "" + // Size: 4855 bytes + "\x02\x0c\x09\x02\xb0\xec\x02\xad\xd8\x02\xad\xd9\x02\x06\x07\x02\x0f\x12" + + "\x02\x0f\x1f\x02\x0f\x1d\x02\x01\x13\x02\x0f\x16\x02\x0f\x0b\x02\x0f3" + + "\x02\x0f7\x02\x0f?\x02\x0f/\x02\x0f*\x02\x0c&\x02\x0c*\x02\x0c;\x02\x0c9" + + "\x02\x0c%\x02\xab\xed\x02\xab\xe2\x02\xab\xe3\x02\xa9\xe0\x02\xa9\xe1" + + "\x02\xa9\xe6\x02\xa3\xcb\x02\xa3\xc8\x02\xa3\xc9\x02\x01#\x02\x01\x08" + + "\x02\x0e>\x02\x0e'\x02\x0f\x03\x02\x03\x0d\x02\x03\x09\x02\x03\x17\x02" + + "\x03\x0e\x02\x02\x03\x02\x011\x02\x01\x00\x02\x01\x10\x02\x03<\x02\x07" + + "\x0d\x02\x02\x0c\x02\x0c0\x02\x01\x03\x02\x01\x01\x02\x01 \x02\x01\x22" + + "\x02\x01)\x02\x01\x0a\x02\x01\x0c\x02\x02\x06\x02\x02\x02\x02\x03\x10" + + "\x03\x037 \x03\x0b+\x03\x02\x01\x04\x02\x01\x02\x02\x019\x02\x03\x1c\x02" + + "\x02$\x03\x80p$\x02\x03:\x02\x03\x0a\x03\xc1r.\x03\xc1r,\x03\xc1r\x02" + + "\x02\x02:\x02\x02>\x02\x02,\x02\x02\x10\x02\x02\x00\x03\xc1s<\x03\xc1s*" + + "\x03\xc2L$\x03\xc2L;\x02\x09)\x02\x0a\x19\x03\x83\xab\xe3\x03\x83\xab" + + "\xf2\x03 4\xe0\x03\x81\xab\xea\x03\x81\xab\xf3\x03 4\xef\x03\x96\xe1\xcd" + + "\x03\x84\xe5\xc3\x02\x0d\x11\x03\x8b\xec\xcb\x03\x94\xec\xcf\x03\x9a\xec" + + "\xc2\x03\x8b\xec\xdb\x03\x94\xec\xdf\x03\x9a\xec\xd2\x03\x01\x0c!\x03" + + "\x01\x0c#\x03ʠ\x9d\x03ʣ\x9c\x03ʢ\x9f\x03ʥ\x9e\x03ʤ\x91\x03ʧ\x90\x03ʦ\x93" + + "\x03ʩ\x92\x03ʨ\x95\x03\xca\xf3\xb5\x03\xca\xf0\xb4\x03\xca\xf1\xb7\x03" + + "\xca\xf6\xb6\x03\xca\xf7\x89\x03\xca\xf4\x88\x03\xca\xf5\x8b\x03\xca\xfa" + + "\x8a\x03\xca\xfb\x8d\x03\xca\xf8\x8c\x03\xca\xf9\x8f\x03\xca\xfe\x8e\x03" + + "\xca\xff\x81\x03\xca\xfc\x80\x03\xca\xfd\x83\x03\xca\xe2\x82\x03\xca\xe3" + + "\x85\x03\xca\xe0\x84\x03\xca\xe1\x87\x03\xca\xe6\x86\x03\xca\xe7\x99\x03" + + "\xca\xe4\x98\x03\xca\xe5\x9b\x03\xca\xea\x9a\x03\xca\xeb\x9d\x03\xca\xe8" + + "\x9c\x03ؓ\x89\x03ߔ\x8b\x02\x010\x03\x03\x04\x1e\x03\x04\x15\x12\x03\x0b" + + "\x05,\x03\x06\x04\x00\x03\x06\x04)\x03\x06\x044\x03\x06\x04<\x03\x06\x05" + + "\x1d\x03\x06\x06\x00\x03\x06\x06\x0a\x03\x06\x06'\x03\x06\x062\x03\x0786" + + "\x03\x079/\x03\x079 \x03\x07:\x0e\x03\x07:\x1b\x03\x07:%\x03\x07;/\x03" + + "\x07;%\x03\x074\x11\x03\x076\x09\x03\x077*\x03\x070\x01\x03\x070\x0f\x03" + + "\x070.\x03\x071\x16\x03\x071\x04\x03\x0710\x03\x072\x18\x03\x072-\x03" + + "\x073\x14\x03\x073>\x03\x07'\x09\x03\x07 \x00\x03\x07\x1f\x0b\x03\x07" + + "\x18#\x03\x07\x18(\x03\x07\x186\x03\x07\x18\x03\x03\x07\x19\x16\x03\x07" + + "\x116\x03\x07\x12'\x03\x07\x13\x10\x03\x07\x0c&\x03\x07\x0c\x08\x03\x07" + + "\x0c\x13\x03\x07\x0d\x02\x03\x07\x0d\x1c\x03\x07\x0b5\x03\x07\x0b\x0a" + + "\x03\x07\x0b\x01\x03\x07\x0b\x0f\x03\x07\x05\x00\x03\x07\x05\x09\x03\x07" + + "\x05\x0b\x03\x07\x07\x01\x03\x07\x07\x08\x03\x07\x00<\x03\x07\x00+\x03" + + "\x07\x01)\x03\x07\x01\x1b\x03\x07\x01\x08\x03\x07\x03?\x03\x0445\x03\x04" + + "4\x08\x03\x0454\x03\x04)/\x03\x04)5\x03\x04+\x05\x03\x04+\x14\x03\x04+ " + + "\x03\x04+<\x03\x04*&\x03\x04*\x22\x03\x04&8\x03\x04!\x01\x03\x04!\x22" + + "\x03\x04\x11+\x03\x04\x10.\x03\x04\x104\x03\x04\x13=\x03\x04\x12\x04\x03" + + "\x04\x12\x0a\x03\x04\x0d\x1d\x03\x04\x0d\x07\x03\x04\x0d \x03\x05<>\x03" + + "\x055<\x03\x055!\x03\x055#\x03\x055&\x03\x054\x1d\x03\x054\x02\x03\x054" + + "\x07\x03\x0571\x03\x053\x1a\x03\x053\x16\x03\x05.<\x03\x05.\x07\x03\x05)" + + ":\x03\x05)<\x03\x05)\x0c\x03\x05)\x15\x03\x05+-\x03\x05+5\x03\x05$\x1e" + + "\x03\x05$\x14\x03\x05'\x04\x03\x05'\x14\x03\x05&\x02\x03\x05\x226\x03" + + "\x05\x22\x0c\x03\x05\x22\x1c\x03\x05\x19\x0a\x03\x05\x1b\x09\x03\x05\x1b" + + "\x0c\x03\x05\x14\x07\x03\x05\x16?\x03\x05\x16\x0c\x03\x05\x0c\x05\x03" + + "\x05\x0e\x0f\x03\x05\x01\x0e\x03\x05\x00(\x03\x05\x030\x03\x05\x03\x06" + + "\x03\x0a==\x03\x0a=1\x03\x0a=,\x03\x0a=\x0c\x03\x0a??\x03\x0a<\x08\x03" + + "\x0a9!\x03\x0a9)\x03\x0a97\x03\x0a99\x03\x0a6\x0a\x03\x0a6\x1c\x03\x0a6" + + "\x17\x03\x0a7'\x03\x0a78\x03\x0a73\x03\x0a'\x01\x03\x0a'&\x03\x0a\x1f" + + "\x0e\x03\x0a\x1f\x03\x03\x0a\x1f3\x03\x0a\x1b/\x03\x0a\x18\x19\x03\x0a" + + "\x19\x01\x03\x0a\x16\x14\x03\x0a\x0e\x22\x03\x0a\x0f\x10\x03\x0a\x0f\x02" + + "\x03\x0a\x0f \x03\x0a\x0c\x04\x03\x0a\x0b>\x03\x0a\x0b+\x03\x0a\x08/\x03" + + "\x0a\x046\x03\x0a\x05\x14\x03\x0a\x00\x04\x03\x0a\x00\x10\x03\x0a\x00" + + "\x14\x03\x0b<3\x03\x0b;*\x03\x0b9\x22\x03\x0b9)\x03\x0b97\x03\x0b+\x10" + + "\x03\x0b((\x03\x0b&5\x03\x0b$\x1c\x03\x0b$\x12\x03\x0b%\x04\x03\x0b#<" + + "\x03\x0b#0\x03\x0b#\x0d\x03\x0b#\x19\x03\x0b!:\x03\x0b!\x1f\x03\x0b!\x00" + + "\x03\x0b\x1e5\x03\x0b\x1c\x1d\x03\x0b\x1d-\x03\x0b\x1d(\x03\x0b\x18.\x03" + + "\x0b\x18 \x03\x0b\x18\x16\x03\x0b\x14\x13\x03\x0b\x15$\x03\x0b\x15\x22" + + "\x03\x0b\x12\x1b\x03\x0b\x12\x10\x03\x0b\x132\x03\x0b\x13=\x03\x0b\x12" + + "\x18\x03\x0b\x0c&\x03\x0b\x061\x03\x0b\x06:\x03\x0b\x05#\x03\x0b\x05<" + + "\x03\x0b\x04\x0b\x03\x0b\x04\x04\x03\x0b\x04\x1b\x03\x0b\x042\x03\x0b" + + "\x041\x03\x0b\x03\x03\x03\x0b\x03\x1d\x03\x0b\x03/\x03\x0b\x03+\x03\x0b" + + "\x02\x1b\x03\x0b\x02\x00\x03\x0b\x01\x1e\x03\x0b\x01\x08\x03\x0b\x015" + + "\x03\x06\x0d9\x03\x06\x0d=\x03\x06\x0d?\x03\x02\x001\x03\x02\x003\x03" + + "\x02\x02\x19\x03\x02\x006\x03\x02\x02\x1b\x03\x02\x004\x03\x02\x00<\x03" + + "\x02\x02\x0a\x03\x02\x02\x0e\x03\x02\x01\x1a\x03\x02\x01\x07\x03\x02\x01" + + "\x05\x03\x02\x01\x0b\x03\x02\x01%\x03\x02\x01\x0c\x03\x02\x01\x04\x03" + + "\x02\x01\x1c\x03\x02\x00.\x03\x02\x002\x03\x02\x00>\x03\x02\x00\x12\x03" + + "\x02\x00\x16\x03\x02\x011\x03\x02\x013\x03\x02\x02 \x03\x02\x02%\x03\x02" + + "\x02$\x03\x02\x028\x03\x02\x02;\x03\x02\x024\x03\x02\x012\x03\x02\x022" + + "\x03\x02\x02/\x03\x02\x01,\x03\x02\x01\x13\x03\x02\x01\x16\x03\x02\x01" + + "\x11\x03\x02\x01\x1e\x03\x02\x01\x15\x03\x02\x01\x17\x03\x02\x01\x0f\x03" + + "\x02\x01\x08\x03\x02\x00?\x03\x02\x03\x07\x03\x02\x03\x0d\x03\x02\x03" + + "\x13\x03\x02\x03\x1d\x03\x02\x03\x1f\x03\x02\x00\x03\x03\x02\x00\x0d\x03" + + "\x02\x00\x01\x03\x02\x00\x1b\x03\x02\x00\x19\x03\x02\x00\x18\x03\x02\x00" + + "\x13\x03\x02\x00/\x03\x07>\x12\x03\x07<\x1f\x03\x07>\x1d\x03\x06\x1d\x0e" + + "\x03\x07>\x1c\x03\x07>:\x03\x07>\x13\x03\x04\x12+\x03\x07?\x03\x03\x07>" + + "\x02\x03\x06\x224\x03\x06\x1a.\x03\x07<%\x03\x06\x1c\x0b\x03\x0609\x03" + + "\x05\x1f\x01\x03\x04'\x08\x03\x93\xfd\xf5\x03\x02\x0d \x03\x02\x0d#\x03" + + "\x02\x0d!\x03\x02\x0d&\x03\x02\x0d\x22\x03\x02\x0d/\x03\x02\x0d,\x03\x02" + + "\x0d$\x03\x02\x0d'\x03\x02\x0d%\x03\x02\x0d;\x03\x02\x0d=\x03\x02\x0d?" + + "\x03\x099.\x03\x08\x0b7\x03\x08\x02\x14\x03\x08\x14\x0d\x03\x08.:\x03" + + "\x089'\x03\x0f\x0b\x18\x03\x0f\x1c1\x03\x0f\x17&\x03\x0f9\x1f\x03\x0f0" + + "\x0c\x03\x0e\x0a9\x03\x0e\x056\x03\x0e\x1c#\x03\x0f\x13\x0e\x03\x072\x00" + + "\x03\x070\x0d\x03\x072\x0b\x03\x06\x11\x18\x03\x070\x10\x03\x06\x0f(\x03" + + "\x072\x05\x03\x06\x0f,\x03\x073\x15\x03\x06\x07\x08\x03\x05\x16\x02\x03" + + "\x04\x0b \x03\x05:8\x03\x05\x16%\x03\x0a\x0d\x1f\x03\x06\x16\x10\x03\x05" + + "\x1d5\x03\x05*;\x03\x05\x16\x1b\x03\x04.-\x03\x06\x1a\x19\x03\x04\x03," + + "\x03\x0b87\x03\x04/\x0a\x03\x06\x00,\x03\x04-\x01\x03\x04\x1e-\x03\x06/(" + + "\x03\x0a\x0b5\x03\x06\x0e7\x03\x06\x07.\x03\x0597\x03\x0a*%\x03\x0760" + + "\x03\x06\x0c;\x03\x05'\x00\x03\x072.\x03\x072\x08\x03\x06=\x01\x03\x06" + + "\x05\x1b\x03\x06\x06\x12\x03\x06$=\x03\x06'\x0d\x03\x04\x11\x0f\x03\x076" + + ",\x03\x06\x07;\x03\x06.,\x03\x86\xf9\xea\x03\x8f\xff\xeb\x02\x092\x02" + + "\x095\x02\x094\x02\x09;\x02\x09>\x02\x098\x02\x09*\x02\x09/\x02\x09,\x02" + + "\x09%\x02\x09&\x02\x09#\x02\x09 \x02\x08!\x02\x08%\x02\x08$\x02\x08+\x02" + + "\x08.\x02\x08*\x02\x08&\x02\x088\x02\x08>\x02\x084\x02\x086\x02\x080\x02" + + "\x08\x10\x02\x08\x17\x02\x08\x12\x02\x08\x1d\x02\x08\x1f\x02\x08\x13\x02" + + "\x08\x15\x02\x08\x14\x02\x08\x0c\x03\x8b\xfd\xd0\x03\x81\xec\xc6\x03\x87" + + "\xe0\x8a\x03-2\xe3\x03\x80\xef\xe4\x03-2\xea\x03\x88\xe6\xeb\x03\x8e\xe6" + + "\xe8\x03\x84\xe6\xe9\x03\x97\xe6\xee\x03-2\xf9\x03-2\xf6\x03\x8e\xe3\xad" + + "\x03\x80\xe3\x92\x03\x88\xe3\x90\x03\x8e\xe3\x90\x03\x80\xe3\x97\x03\x88" + + "\xe3\x95\x03\x88\xfe\xcb\x03\x8e\xfe\xca\x03\x84\xfe\xcd\x03\x91\xef\xc9" + + "\x03-2\xc1\x03-2\xc0\x03-2\xcb\x03\x88@\x09\x03\x8e@\x08\x03\x8f\xe0\xf5" + + "\x03\x8e\xe6\xf9\x03\x8e\xe0\xfa\x03\x93\xff\xf4\x03\x84\xee\xd3\x03\x0b" + + "(\x04\x023 \x021;\x02\x01*\x03\x0b#\x10\x03\x0b 0\x03\x0b!\x10\x03\x0b!0" + + "\x03\x07\x15\x08\x03\x09?5\x03\x07\x1f\x08\x03\x07\x17\x0b\x03\x09\x1f" + + "\x15\x03\x0b\x1c7\x03\x0a+#\x03\x06\x1a\x1b\x03\x06\x1a\x14\x03\x0a\x01" + + "\x18\x03\x06#\x1b\x03\x0a2\x0c\x03\x0a\x01\x04\x03\x09#;\x03\x08='\x03" + + "\x08\x1a\x0a\x03\x07\x03\x0a\x111\x03\x09\x1b\x09\x03\x073.\x03\x07\x01\x00" + + "\x03\x09/,\x03\x07#>\x03\x07\x048\x03\x0a\x1f\x22\x03\x098>\x03\x09\x11" + + "\x00\x03\x08/\x17\x03\x06'\x22\x03\x0b\x1a+\x03\x0a\x22\x19\x03\x0a/1" + + "\x03\x0974\x03\x09\x0f\x22\x03\x08,\x22\x03\x08?\x14\x03\x07$5\x03\x07<3" + + "\x03\x07=*\x03\x07\x13\x18\x03\x068\x0a\x03\x06\x09\x16\x03\x06\x13\x00" + + "\x03\x08\x067\x03\x08\x01\x03\x03\x08\x12\x1d\x03\x07+7\x03\x06(;\x03" + + "\x06\x1c?\x03\x07\x0e\x17\x03\x0a\x06\x1d\x03\x0a\x19\x07\x03\x08\x14$" + + "\x03\x07$;\x03\x08,$\x03\x08\x06\x0d\x03\x07\x16\x0a\x03\x06>>\x03\x0a" + + "\x06\x12\x03\x0a\x14)\x03\x09\x0d\x1f\x03\x09\x12\x17\x03\x09\x19\x01" + + "\x03\x08\x11 \x03\x08\x1d'\x03\x06<\x1a\x03\x0a.\x00\x03\x07'\x18\x03" + + "\x0a\x22\x08\x03\x08\x0d\x0a\x03\x08\x13)\x03\x07*)\x03\x06<,\x03\x07" + + "\x0b\x1a\x03\x09.\x14\x03\x09\x0d\x1e\x03\x07\x0e#\x03\x0b\x1d'\x03\x0a" + + "\x0a8\x03\x09%2\x03\x08+&\x03\x080\x12\x03\x0a)4\x03\x08\x06\x1f\x03\x0b" + + "\x1b\x1a\x03\x0a\x1b\x0f\x03\x0b\x1d*\x03\x09\x16$\x03\x090\x11\x03\x08" + + "\x11\x08\x03\x0a*(\x03\x0a\x042\x03\x089,\x03\x074'\x03\x07\x0f\x05\x03" + + "\x09\x0b\x0a\x03\x07\x1b\x01\x03\x09\x17:\x03\x09.\x0d\x03\x07.\x11\x03" + + "\x09+\x15\x03\x080\x13\x03\x0b\x1f\x19\x03\x0a \x11\x03\x0a\x220\x03\x09" + + "\x07;\x03\x08\x16\x1c\x03\x07,\x13\x03\x07\x0e/\x03\x06\x221\x03\x0a." + + "\x0a\x03\x0a7\x02\x03\x0a\x032\x03\x0a\x1d.\x03\x091\x06\x03\x09\x19:" + + "\x03\x08\x02/\x03\x060+\x03\x06\x0f-\x03\x06\x1c\x1f\x03\x06\x1d\x07\x03" + + "\x0a,\x11\x03\x09=\x0d\x03\x09\x0b;\x03\x07\x1b/\x03\x0a\x1f:\x03\x09 " + + "\x1f\x03\x09.\x10\x03\x094\x0b\x03\x09\x1a1\x03\x08#\x1a\x03\x084\x1d" + + "\x03\x08\x01\x1f\x03\x08\x11\x22\x03\x07'8\x03\x07\x1a>\x03\x0757\x03" + + "\x06&9\x03\x06+\x11\x03\x0a.\x0b\x03\x0a,>\x03\x0a4#\x03\x08%\x17\x03" + + "\x07\x05\x22\x03\x07\x0c\x0b\x03\x0a\x1d+\x03\x0a\x19\x16\x03\x09+\x1f" + + "\x03\x09\x08\x0b\x03\x08\x16\x18\x03\x08+\x12\x03\x0b\x1d\x0c\x03\x0a=" + + "\x10\x03\x0a\x09\x0d\x03\x0a\x10\x11\x03\x09&0\x03\x08(\x1f\x03\x087\x07" + + "\x03\x08\x185\x03\x07'6\x03\x06.\x05\x03\x06=\x04\x03\x06;;\x03\x06\x06," + + "\x03\x0b\x18>\x03\x08\x00\x18\x03\x06 \x03\x03\x06<\x00\x03\x09%\x18\x03" + + "\x0b\x1c<\x03\x0a%!\x03\x0a\x09\x12\x03\x0a\x16\x02\x03\x090'\x03\x09" + + "\x0e=\x03\x08 \x0e\x03\x08>\x03\x03\x074>\x03\x06&?\x03\x06\x19\x09\x03" + + "\x06?(\x03\x0a-\x0e\x03\x09:3\x03\x098:\x03\x09\x12\x0b\x03\x09\x1d\x17" + + "\x03\x087\x05\x03\x082\x14\x03\x08\x06%\x03\x08\x13\x1f\x03\x06\x06\x0e" + + "\x03\x0a\x22<\x03\x09/<\x03\x06>+\x03\x0a'?\x03\x0a\x13\x0c\x03\x09\x10<" + + "\x03\x07\x1b=\x03\x0a\x19\x13\x03\x09\x22\x1d\x03\x09\x07\x0d\x03\x08)" + + "\x1c\x03\x06=\x1a\x03\x0a/4\x03\x0a7\x11\x03\x0a\x16:\x03\x09?3\x03\x09:" + + "/\x03\x09\x05\x0a\x03\x09\x14\x06\x03\x087\x22\x03\x080\x07\x03\x08\x1a" + + "\x1f\x03\x07\x04(\x03\x07\x04\x09\x03\x06 %\x03\x06<\x08\x03\x0a+\x14" + + "\x03\x09\x1d\x16\x03\x0a70\x03\x08 >\x03\x0857\x03\x070\x0a\x03\x06=\x12" + + "\x03\x06\x16%\x03\x06\x1d,\x03\x099#\x03\x09\x10>\x03\x07 \x1e\x03\x08" + + "\x0c<\x03\x08\x0b\x18\x03\x08\x15+\x03\x08,:\x03\x08%\x22\x03\x07\x0a$" + + "\x03\x0b\x1c=\x03\x07+\x08\x03\x0a/\x05\x03\x0a \x07\x03\x0a\x12'\x03" + + "\x09#\x11\x03\x08\x1b\x15\x03\x0a\x06\x01\x03\x09\x1c\x1b\x03\x0922\x03" + + "\x07\x14<\x03\x07\x09\x04\x03\x061\x04\x03\x07\x0e\x01\x03\x0a\x13\x18" + + "\x03\x0a-\x0c\x03\x0a?\x0d\x03\x0a\x09\x0a\x03\x091&\x03\x0a/\x0b\x03" + + "\x08$<\x03\x083\x1d\x03\x08\x0c$\x03\x08\x0d\x07\x03\x08\x0d?\x03\x08" + + "\x0e\x14\x03\x065\x0a\x03\x08\x1a#\x03\x08\x16#\x03\x0702\x03\x07\x03" + + "\x1a\x03\x06(\x1d\x03\x06+\x1b\x03\x06\x0b\x05\x03\x06\x0b\x17\x03\x06" + + "\x0c\x04\x03\x06\x1e\x19\x03\x06+0\x03\x062\x18\x03\x0b\x16\x1e\x03\x0a+" + + "\x16\x03\x0a-?\x03\x0a#:\x03\x0a#\x10\x03\x0a%$\x03\x0a>+\x03\x0a01\x03" + + "\x0a1\x10\x03\x0a\x099\x03\x0a\x0a\x12\x03\x0a\x19\x1f\x03\x0a\x19\x12" + + "\x03\x09*)\x03\x09-\x16\x03\x09.1\x03\x09.2\x03\x09<\x0e\x03\x09> \x03" + + "\x093\x12\x03\x09\x0b\x01\x03\x09\x1c2\x03\x09\x11\x1c\x03\x09\x15%\x03" + + "\x08,&\x03\x08!\x22\x03\x089(\x03\x08\x0b\x1a\x03\x08\x0d2\x03\x08\x0c" + + "\x04\x03\x08\x0c\x06\x03\x08\x0c\x1f\x03\x08\x0c\x0c\x03\x08\x0f\x1f\x03" + + "\x08\x0f\x1d\x03\x08\x00\x14\x03\x08\x03\x14\x03\x08\x06\x16\x03\x08\x1e" + + "#\x03\x08\x11\x11\x03\x08\x10\x18\x03\x08\x14(\x03\x07)\x1e\x03\x07.1" + + "\x03\x07 $\x03\x07 '\x03\x078\x08\x03\x07\x0d0\x03\x07\x0f7\x03\x07\x05#" + + "\x03\x07\x05\x1a\x03\x07\x1a7\x03\x07\x1d-\x03\x07\x17\x10\x03\x06)\x1f" + + "\x03\x062\x0b\x03\x066\x16\x03\x06\x09\x11\x03\x09(\x1e\x03\x07!5\x03" + + "\x0b\x11\x16\x03\x0a/\x04\x03\x0a,\x1a\x03\x0b\x173\x03\x0a,1\x03\x0a/5" + + "\x03\x0a\x221\x03\x0a\x22\x0d\x03\x0a?%\x03\x0a<,\x03\x0a?#\x03\x0a>\x19" + + "\x03\x0a\x08&\x03\x0a\x0b\x0e\x03\x0a\x0c:\x03\x0a\x0c+\x03\x0a\x03\x22" + + "\x03\x0a\x06)\x03\x0a\x11\x10\x03\x0a\x11\x1a\x03\x0a\x17-\x03\x0a\x14(" + + "\x03\x09)\x1e\x03\x09/\x09\x03\x09.\x00\x03\x09,\x07\x03\x09/*\x03\x09-9" + + "\x03\x09\x228\x03\x09%\x09\x03\x09:\x12\x03\x09;\x1d\x03\x09?\x06\x03" + + "\x093%\x03\x096\x05\x03\x096\x08\x03\x097\x02\x03\x09\x07,\x03\x09\x04," + + "\x03\x09\x1f\x16\x03\x09\x11\x03\x03\x09\x11\x12\x03\x09\x168\x03\x08*" + + "\x05\x03\x08/2\x03\x084:\x03\x08\x22+\x03\x08 0\x03\x08&\x0a\x03\x08;" + + "\x10\x03\x08>$\x03\x08>\x18\x03\x0829\x03\x082:\x03\x081,\x03\x081<\x03" + + "\x081\x1c\x03\x087#\x03\x087*\x03\x08\x09'\x03\x08\x00\x1d\x03\x08\x05-" + + "\x03\x08\x1f4\x03\x08\x1d\x04\x03\x08\x16\x0f\x03\x07*7\x03\x07'!\x03" + + "\x07%\x1b\x03\x077\x0c\x03\x07\x0c1\x03\x07\x0c.\x03\x07\x00\x06\x03\x07" + + "\x01\x02\x03\x07\x010\x03\x07\x06=\x03\x07\x01\x03\x03\x07\x01\x13\x03" + + "\x07\x06\x06\x03\x07\x05\x0a\x03\x07\x1f\x09\x03\x07\x17:\x03\x06*1\x03" + + "\x06-\x1d\x03\x06\x223\x03\x062:\x03\x060$\x03\x066\x1e\x03\x064\x12\x03" + + "\x0645\x03\x06\x0b\x00\x03\x06\x0b7\x03\x06\x07\x1f\x03\x06\x15\x12\x03" + + "\x0c\x05\x0f\x03\x0b+\x0b\x03\x0b+-\x03\x06\x16\x1b\x03\x06\x15\x17\x03" + + "\x89\xca\xea\x03\x89\xca\xe8\x03\x0c8\x10\x03\x0c8\x01\x03\x0c8\x0f\x03" + + "\x0d8%\x03\x0d8!\x03\x0c8-\x03\x0c8/\x03\x0c8+\x03\x0c87\x03\x0c85\x03" + + "\x0c9\x09\x03\x0c9\x0d\x03\x0c9\x0f\x03\x0c9\x0b\x03\xcfu\x0c\x03\xcfu" + + "\x0f\x03\xcfu\x0e\x03\xcfu\x09\x03\x0c9\x10\x03\x0d9\x0c\x03\xcf`;\x03" + + "\xcf`>\x03\xcf`9\x03\xcf`8\x03\xcf`7\x03\xcf`*\x03\xcf`-\x03\xcf`,\x03" + + "\x0d\x1b\x1a\x03\x0d\x1b&\x03\x0c=.\x03\x0c=%\x03\x0c>\x1e\x03\x0c>\x14" + + "\x03\x0c?\x06\x03\x0c?\x0b\x03\x0c?\x0c\x03\x0c?\x0d\x03\x0c?\x02\x03" + + "\x0c>\x0f\x03\x0c>\x08\x03\x0c>\x09\x03\x0c>,\x03\x0c>\x0c\x03\x0c?\x13" + + "\x03\x0c?\x16\x03\x0c?\x15\x03\x0c?\x1c\x03\x0c?\x1f\x03\x0c?\x1d\x03" + + "\x0c?\x1a\x03\x0c?\x17\x03\x0c?\x08\x03\x0c?\x09\x03\x0c?\x0e\x03\x0c?" + + "\x04\x03\x0c?\x05\x03\x0c" + + "\x03\x0c=2\x03\x0c=6\x03\x0c<\x07\x03\x0c<\x05\x03\x0e:!\x03\x0e:#\x03" + + "\x0e8\x09\x03\x0e:&\x03\x0e8\x0b\x03\x0e:$\x03\x0e:,\x03\x0e8\x1a\x03" + + "\x0e8\x1e\x03\x0e:*\x03\x0e:7\x03\x0e:5\x03\x0e:;\x03\x0e:\x15\x03\x0e:<" + + "\x03\x0e:4\x03\x0e:'\x03\x0e:-\x03\x0e:%\x03\x0e:?\x03\x0e:=\x03\x0e:)" + + "\x03\x0e:/\x03\xcfs'\x03\x0d=\x0f\x03\x0d+*\x03\x0d99\x03\x0d9;\x03\x0d9" + + "?\x03\x0d)\x0d\x03\x0d(%\x02\x01\x18\x02\x01(\x02\x01\x1e\x03\x0f$!\x03" + + "\x0f87\x03\x0f4\x0e\x03\x0f5\x1d\x03\x06'\x03\x03\x0f\x08\x18\x03\x0f" + + "\x0d\x1b\x03\x0e2=\x03\x0e;\x08\x03\x0e:\x0b\x03\x0e\x06$\x03\x0e\x0d)" + + "\x03\x0e\x16\x1f\x03\x0e\x16\x1b\x03\x0d$\x0a\x03\x05,\x1d\x03\x0d. \x03" + + "\x0d.#\x03\x0c(/\x03\x09%\x02\x03\x0d90\x03\x0d\x0e4\x03\x0d\x0d\x0f\x03" + + "\x0c#\x00\x03\x0c,\x1e\x03\x0c2\x0e\x03\x0c\x01\x17\x03\x0c\x09:\x03\x0e" + + "\x173\x03\x0c\x08\x03\x03\x0c\x11\x07\x03\x0c\x10\x18\x03\x0c\x1f\x1c" + + "\x03\x0c\x19\x0e\x03\x0c\x1a\x1f\x03\x0f0>\x03\x0b->\x03\x0b<+\x03\x0b8" + + "\x13\x03\x0b\x043\x03\x0b\x14\x03\x03\x0b\x16%\x03\x0d\x22&\x03\x0b\x1a" + + "\x1a\x03\x0b\x1a\x04\x03\x0a%9\x03\x0a&2\x03\x0a&0\x03\x0a!\x1a\x03\x0a!" + + "7\x03\x0a5\x10\x03\x0a=4\x03\x0a?\x0e\x03\x0a>\x10\x03\x0a\x00 \x03\x0a" + + "\x0f:\x03\x0a\x0f9\x03\x0a\x0b\x0a\x03\x0a\x17%\x03\x0a\x1b-\x03\x09-" + + "\x1a\x03\x09,4\x03\x09.,\x03\x09)\x09\x03\x096!\x03\x091\x1f\x03\x093" + + "\x16\x03\x0c+\x1f\x03\x098 \x03\x098=\x03\x0c(\x1a\x03\x0c(\x16\x03\x09" + + "\x0a+\x03\x09\x16\x12\x03\x09\x13\x0e\x03\x09\x153\x03\x08)!\x03\x09\x1a" + + "\x01\x03\x09\x18\x01\x03\x08%#\x03\x08>\x22\x03\x08\x05%\x03\x08\x02*" + + "\x03\x08\x15;\x03\x08\x1b7\x03\x0f\x07\x1d\x03\x0f\x04\x03\x03\x070\x0c" + + "\x03\x07;\x0b\x03\x07\x08\x17\x03\x07\x12\x06\x03\x06/-\x03\x0671\x03" + + "\x065+\x03\x06>7\x03\x06\x049\x03\x05+\x1e\x03\x05,\x17\x03\x05 \x1d\x03" + + "\x05\x22\x05\x03\x050\x1d" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *idnaTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return idnaValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = idnaIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *idnaTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return idnaValues[c0] + } + i := idnaIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *idnaTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return idnaValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = idnaIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *idnaTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return idnaValues[c0] + } + i := idnaIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// idnaTrie. Total size: 28496 bytes (27.83 KiB). Checksum: 43288b883596640e. +type idnaTrie struct{} + +func newIdnaTrie(i int) *idnaTrie { + return &idnaTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *idnaTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 123: + return uint16(idnaValues[n<<6+uint32(b)]) + default: + n -= 123 + return uint16(idnaSparse.lookup(n, b)) + } +} + +// idnaValues: 125 blocks, 8000 entries, 16000 bytes +// The third block is the zero block. +var idnaValues = [8000]uint16{ + // Block 0x0, offset 0x0 + 0x00: 0x0080, 0x01: 0x0080, 0x02: 0x0080, 0x03: 0x0080, 0x04: 0x0080, 0x05: 0x0080, + 0x06: 0x0080, 0x07: 0x0080, 0x08: 0x0080, 0x09: 0x0080, 0x0a: 0x0080, 0x0b: 0x0080, + 0x0c: 0x0080, 0x0d: 0x0080, 0x0e: 0x0080, 0x0f: 0x0080, 0x10: 0x0080, 0x11: 0x0080, + 0x12: 0x0080, 0x13: 0x0080, 0x14: 0x0080, 0x15: 0x0080, 0x16: 0x0080, 0x17: 0x0080, + 0x18: 0x0080, 0x19: 0x0080, 0x1a: 0x0080, 0x1b: 0x0080, 0x1c: 0x0080, 0x1d: 0x0080, + 0x1e: 0x0080, 0x1f: 0x0080, 0x20: 0x0080, 0x21: 0x0080, 0x22: 0x0080, 0x23: 0x0080, + 0x24: 0x0080, 0x25: 0x0080, 0x26: 0x0080, 0x27: 0x0080, 0x28: 0x0080, 0x29: 0x0080, + 0x2a: 0x0080, 0x2b: 0x0080, 0x2c: 0x0080, 0x2d: 0x0008, 0x2e: 0x0008, 0x2f: 0x0080, + 0x30: 0x0008, 0x31: 0x0008, 0x32: 0x0008, 0x33: 0x0008, 0x34: 0x0008, 0x35: 0x0008, + 0x36: 0x0008, 0x37: 0x0008, 0x38: 0x0008, 0x39: 0x0008, 0x3a: 0x0080, 0x3b: 0x0080, + 0x3c: 0x0080, 0x3d: 0x0080, 0x3e: 0x0080, 0x3f: 0x0080, + // Block 0x1, offset 0x40 + 0x40: 0x0080, 0x41: 0xe105, 0x42: 0xe105, 0x43: 0xe105, 0x44: 0xe105, 0x45: 0xe105, + 0x46: 0xe105, 0x47: 0xe105, 0x48: 0xe105, 0x49: 0xe105, 0x4a: 0xe105, 0x4b: 0xe105, + 0x4c: 0xe105, 0x4d: 0xe105, 0x4e: 0xe105, 0x4f: 0xe105, 0x50: 0xe105, 0x51: 0xe105, + 0x52: 0xe105, 0x53: 0xe105, 0x54: 0xe105, 0x55: 0xe105, 0x56: 0xe105, 0x57: 0xe105, + 0x58: 0xe105, 0x59: 0xe105, 0x5a: 0xe105, 0x5b: 0x0080, 0x5c: 0x0080, 0x5d: 0x0080, + 0x5e: 0x0080, 0x5f: 0x0080, 0x60: 0x0080, 0x61: 0x0008, 0x62: 0x0008, 0x63: 0x0008, + 0x64: 0x0008, 0x65: 0x0008, 0x66: 0x0008, 0x67: 0x0008, 0x68: 0x0008, 0x69: 0x0008, + 0x6a: 0x0008, 0x6b: 0x0008, 0x6c: 0x0008, 0x6d: 0x0008, 0x6e: 0x0008, 0x6f: 0x0008, + 0x70: 0x0008, 0x71: 0x0008, 0x72: 0x0008, 0x73: 0x0008, 0x74: 0x0008, 0x75: 0x0008, + 0x76: 0x0008, 0x77: 0x0008, 0x78: 0x0008, 0x79: 0x0008, 0x7a: 0x0008, 0x7b: 0x0080, + 0x7c: 0x0080, 0x7d: 0x0080, 0x7e: 0x0080, 0x7f: 0x0080, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0040, 0xc1: 0x0040, 0xc2: 0x0040, 0xc3: 0x0040, 0xc4: 0x0040, 0xc5: 0x0040, + 0xc6: 0x0040, 0xc7: 0x0040, 0xc8: 0x0040, 0xc9: 0x0040, 0xca: 0x0040, 0xcb: 0x0040, + 0xcc: 0x0040, 0xcd: 0x0040, 0xce: 0x0040, 0xcf: 0x0040, 0xd0: 0x0040, 0xd1: 0x0040, + 0xd2: 0x0040, 0xd3: 0x0040, 0xd4: 0x0040, 0xd5: 0x0040, 0xd6: 0x0040, 0xd7: 0x0040, + 0xd8: 0x0040, 0xd9: 0x0040, 0xda: 0x0040, 0xdb: 0x0040, 0xdc: 0x0040, 0xdd: 0x0040, + 0xde: 0x0040, 0xdf: 0x0040, 0xe0: 0x000a, 0xe1: 0x0018, 0xe2: 0x0018, 0xe3: 0x0018, + 0xe4: 0x0018, 0xe5: 0x0018, 0xe6: 0x0018, 0xe7: 0x0018, 0xe8: 0x001a, 0xe9: 0x0018, + 0xea: 0x0039, 0xeb: 0x0018, 0xec: 0x0018, 0xed: 0x03c0, 0xee: 0x0018, 0xef: 0x004a, + 0xf0: 0x0018, 0xf1: 0x0018, 0xf2: 0x0069, 0xf3: 0x0079, 0xf4: 0x008a, 0xf5: 0x0005, + 0xf6: 0x0018, 0xf7: 0x0008, 0xf8: 0x00aa, 0xf9: 0x00c9, 0xfa: 0x00d9, 0xfb: 0x0018, + 0xfc: 0x00e9, 0xfd: 0x0119, 0xfe: 0x0149, 0xff: 0x0018, + // Block 0x4, offset 0x100 + 0x100: 0xe00d, 0x101: 0x0008, 0x102: 0xe00d, 0x103: 0x0008, 0x104: 0xe00d, 0x105: 0x0008, + 0x106: 0xe00d, 0x107: 0x0008, 0x108: 0xe00d, 0x109: 0x0008, 0x10a: 0xe00d, 0x10b: 0x0008, + 0x10c: 0xe00d, 0x10d: 0x0008, 0x10e: 0xe00d, 0x10f: 0x0008, 0x110: 0xe00d, 0x111: 0x0008, + 0x112: 0xe00d, 0x113: 0x0008, 0x114: 0xe00d, 0x115: 0x0008, 0x116: 0xe00d, 0x117: 0x0008, + 0x118: 0xe00d, 0x119: 0x0008, 0x11a: 0xe00d, 0x11b: 0x0008, 0x11c: 0xe00d, 0x11d: 0x0008, + 0x11e: 0xe00d, 0x11f: 0x0008, 0x120: 0xe00d, 0x121: 0x0008, 0x122: 0xe00d, 0x123: 0x0008, + 0x124: 0xe00d, 0x125: 0x0008, 0x126: 0xe00d, 0x127: 0x0008, 0x128: 0xe00d, 0x129: 0x0008, + 0x12a: 0xe00d, 0x12b: 0x0008, 0x12c: 0xe00d, 0x12d: 0x0008, 0x12e: 0xe00d, 0x12f: 0x0008, + 0x130: 0x0179, 0x131: 0x0008, 0x132: 0x0035, 0x133: 0x004d, 0x134: 0xe00d, 0x135: 0x0008, + 0x136: 0xe00d, 0x137: 0x0008, 0x138: 0x0008, 0x139: 0xe01d, 0x13a: 0x0008, 0x13b: 0xe03d, + 0x13c: 0x0008, 0x13d: 0xe01d, 0x13e: 0x0008, 0x13f: 0x0199, + // Block 0x5, offset 0x140 + 0x140: 0x0199, 0x141: 0xe01d, 0x142: 0x0008, 0x143: 0xe03d, 0x144: 0x0008, 0x145: 0xe01d, + 0x146: 0x0008, 0x147: 0xe07d, 0x148: 0x0008, 0x149: 0x01b9, 0x14a: 0xe00d, 0x14b: 0x0008, + 0x14c: 0xe00d, 0x14d: 0x0008, 0x14e: 0xe00d, 0x14f: 0x0008, 0x150: 0xe00d, 0x151: 0x0008, + 0x152: 0xe00d, 0x153: 0x0008, 0x154: 0xe00d, 0x155: 0x0008, 0x156: 0xe00d, 0x157: 0x0008, + 0x158: 0xe00d, 0x159: 0x0008, 0x15a: 0xe00d, 0x15b: 0x0008, 0x15c: 0xe00d, 0x15d: 0x0008, + 0x15e: 0xe00d, 0x15f: 0x0008, 0x160: 0xe00d, 0x161: 0x0008, 0x162: 0xe00d, 0x163: 0x0008, + 0x164: 0xe00d, 0x165: 0x0008, 0x166: 0xe00d, 0x167: 0x0008, 0x168: 0xe00d, 0x169: 0x0008, + 0x16a: 0xe00d, 0x16b: 0x0008, 0x16c: 0xe00d, 0x16d: 0x0008, 0x16e: 0xe00d, 0x16f: 0x0008, + 0x170: 0xe00d, 0x171: 0x0008, 0x172: 0xe00d, 0x173: 0x0008, 0x174: 0xe00d, 0x175: 0x0008, + 0x176: 0xe00d, 0x177: 0x0008, 0x178: 0x0065, 0x179: 0xe01d, 0x17a: 0x0008, 0x17b: 0xe03d, + 0x17c: 0x0008, 0x17d: 0xe01d, 0x17e: 0x0008, 0x17f: 0x01d9, + // Block 0x6, offset 0x180 + 0x180: 0x0008, 0x181: 0x007d, 0x182: 0xe00d, 0x183: 0x0008, 0x184: 0xe00d, 0x185: 0x0008, + 0x186: 0x007d, 0x187: 0xe07d, 0x188: 0x0008, 0x189: 0x0095, 0x18a: 0x00ad, 0x18b: 0xe03d, + 0x18c: 0x0008, 0x18d: 0x0008, 0x18e: 0x00c5, 0x18f: 0x00dd, 0x190: 0x00f5, 0x191: 0xe01d, + 0x192: 0x0008, 0x193: 0x010d, 0x194: 0x0125, 0x195: 0x0008, 0x196: 0x013d, 0x197: 0x013d, + 0x198: 0xe00d, 0x199: 0x0008, 0x19a: 0x0008, 0x19b: 0x0008, 0x19c: 0x010d, 0x19d: 0x0155, + 0x19e: 0x0008, 0x19f: 0x016d, 0x1a0: 0xe00d, 0x1a1: 0x0008, 0x1a2: 0xe00d, 0x1a3: 0x0008, + 0x1a4: 0xe00d, 0x1a5: 0x0008, 0x1a6: 0x0185, 0x1a7: 0xe07d, 0x1a8: 0x0008, 0x1a9: 0x019d, + 0x1aa: 0x0008, 0x1ab: 0x0008, 0x1ac: 0xe00d, 0x1ad: 0x0008, 0x1ae: 0x0185, 0x1af: 0xe0fd, + 0x1b0: 0x0008, 0x1b1: 0x01b5, 0x1b2: 0x01cd, 0x1b3: 0xe03d, 0x1b4: 0x0008, 0x1b5: 0xe01d, + 0x1b6: 0x0008, 0x1b7: 0x01e5, 0x1b8: 0xe00d, 0x1b9: 0x0008, 0x1ba: 0x0008, 0x1bb: 0x0008, + 0x1bc: 0xe00d, 0x1bd: 0x0008, 0x1be: 0x0008, 0x1bf: 0x0008, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0008, 0x1c1: 0x0008, 0x1c2: 0x0008, 0x1c3: 0x0008, 0x1c4: 0x01e9, 0x1c5: 0x01e9, + 0x1c6: 0x01e9, 0x1c7: 0x01fd, 0x1c8: 0x0215, 0x1c9: 0x022d, 0x1ca: 0x0245, 0x1cb: 0x025d, + 0x1cc: 0x0275, 0x1cd: 0xe01d, 0x1ce: 0x0008, 0x1cf: 0xe0fd, 0x1d0: 0x0008, 0x1d1: 0xe01d, + 0x1d2: 0x0008, 0x1d3: 0xe03d, 0x1d4: 0x0008, 0x1d5: 0xe01d, 0x1d6: 0x0008, 0x1d7: 0xe07d, + 0x1d8: 0x0008, 0x1d9: 0xe01d, 0x1da: 0x0008, 0x1db: 0xe03d, 0x1dc: 0x0008, 0x1dd: 0x0008, + 0x1de: 0xe00d, 0x1df: 0x0008, 0x1e0: 0xe00d, 0x1e1: 0x0008, 0x1e2: 0xe00d, 0x1e3: 0x0008, + 0x1e4: 0xe00d, 0x1e5: 0x0008, 0x1e6: 0xe00d, 0x1e7: 0x0008, 0x1e8: 0xe00d, 0x1e9: 0x0008, + 0x1ea: 0xe00d, 0x1eb: 0x0008, 0x1ec: 0xe00d, 0x1ed: 0x0008, 0x1ee: 0xe00d, 0x1ef: 0x0008, + 0x1f0: 0x0008, 0x1f1: 0x028d, 0x1f2: 0x02a5, 0x1f3: 0x02bd, 0x1f4: 0xe00d, 0x1f5: 0x0008, + 0x1f6: 0x02d5, 0x1f7: 0x02ed, 0x1f8: 0xe00d, 0x1f9: 0x0008, 0x1fa: 0xe00d, 0x1fb: 0x0008, + 0x1fc: 0xe00d, 0x1fd: 0x0008, 0x1fe: 0xe00d, 0x1ff: 0x0008, + // Block 0x8, offset 0x200 + 0x200: 0xe00d, 0x201: 0x0008, 0x202: 0xe00d, 0x203: 0x0008, 0x204: 0xe00d, 0x205: 0x0008, + 0x206: 0xe00d, 0x207: 0x0008, 0x208: 0xe00d, 0x209: 0x0008, 0x20a: 0xe00d, 0x20b: 0x0008, + 0x20c: 0xe00d, 0x20d: 0x0008, 0x20e: 0xe00d, 0x20f: 0x0008, 0x210: 0xe00d, 0x211: 0x0008, + 0x212: 0xe00d, 0x213: 0x0008, 0x214: 0xe00d, 0x215: 0x0008, 0x216: 0xe00d, 0x217: 0x0008, + 0x218: 0xe00d, 0x219: 0x0008, 0x21a: 0xe00d, 0x21b: 0x0008, 0x21c: 0xe00d, 0x21d: 0x0008, + 0x21e: 0xe00d, 0x21f: 0x0008, 0x220: 0x0305, 0x221: 0x0008, 0x222: 0xe00d, 0x223: 0x0008, + 0x224: 0xe00d, 0x225: 0x0008, 0x226: 0xe00d, 0x227: 0x0008, 0x228: 0xe00d, 0x229: 0x0008, + 0x22a: 0xe00d, 0x22b: 0x0008, 0x22c: 0xe00d, 0x22d: 0x0008, 0x22e: 0xe00d, 0x22f: 0x0008, + 0x230: 0xe00d, 0x231: 0x0008, 0x232: 0xe00d, 0x233: 0x0008, 0x234: 0x0008, 0x235: 0x0008, + 0x236: 0x0008, 0x237: 0x0008, 0x238: 0x0008, 0x239: 0x0008, 0x23a: 0x0209, 0x23b: 0xe03d, + 0x23c: 0x0008, 0x23d: 0x031d, 0x23e: 0x0229, 0x23f: 0x0008, + // Block 0x9, offset 0x240 + 0x240: 0x0008, 0x241: 0x0008, 0x242: 0x0018, 0x243: 0x0018, 0x244: 0x0018, 0x245: 0x0018, + 0x246: 0x0008, 0x247: 0x0008, 0x248: 0x0008, 0x249: 0x0008, 0x24a: 0x0008, 0x24b: 0x0008, + 0x24c: 0x0008, 0x24d: 0x0008, 0x24e: 0x0008, 0x24f: 0x0008, 0x250: 0x0008, 0x251: 0x0008, + 0x252: 0x0018, 0x253: 0x0018, 0x254: 0x0018, 0x255: 0x0018, 0x256: 0x0018, 0x257: 0x0018, + 0x258: 0x029a, 0x259: 0x02ba, 0x25a: 0x02da, 0x25b: 0x02fa, 0x25c: 0x031a, 0x25d: 0x033a, + 0x25e: 0x0018, 0x25f: 0x0018, 0x260: 0x03ad, 0x261: 0x0359, 0x262: 0x01d9, 0x263: 0x0369, + 0x264: 0x03c5, 0x265: 0x0018, 0x266: 0x0018, 0x267: 0x0018, 0x268: 0x0018, 0x269: 0x0018, + 0x26a: 0x0018, 0x26b: 0x0018, 0x26c: 0x0008, 0x26d: 0x0018, 0x26e: 0x0008, 0x26f: 0x0018, + 0x270: 0x0018, 0x271: 0x0018, 0x272: 0x0018, 0x273: 0x0018, 0x274: 0x0018, 0x275: 0x0018, + 0x276: 0x0018, 0x277: 0x0018, 0x278: 0x0018, 0x279: 0x0018, 0x27a: 0x0018, 0x27b: 0x0018, + 0x27c: 0x0018, 0x27d: 0x0018, 0x27e: 0x0018, 0x27f: 0x0018, + // Block 0xa, offset 0x280 + 0x280: 0x03dd, 0x281: 0x03dd, 0x282: 0x1308, 0x283: 0x03f5, 0x284: 0x0379, 0x285: 0x040d, + 0x286: 0x1308, 0x287: 0x1308, 0x288: 0x1308, 0x289: 0x1308, 0x28a: 0x1308, 0x28b: 0x1308, + 0x28c: 0x1308, 0x28d: 0x1308, 0x28e: 0x1308, 0x28f: 0x13c0, 0x290: 0x1308, 0x291: 0x1308, + 0x292: 0x1308, 0x293: 0x1308, 0x294: 0x1308, 0x295: 0x1308, 0x296: 0x1308, 0x297: 0x1308, + 0x298: 0x1308, 0x299: 0x1308, 0x29a: 0x1308, 0x29b: 0x1308, 0x29c: 0x1308, 0x29d: 0x1308, + 0x29e: 0x1308, 0x29f: 0x1308, 0x2a0: 0x1308, 0x2a1: 0x1308, 0x2a2: 0x1308, 0x2a3: 0x1308, + 0x2a4: 0x1308, 0x2a5: 0x1308, 0x2a6: 0x1308, 0x2a7: 0x1308, 0x2a8: 0x1308, 0x2a9: 0x1308, + 0x2aa: 0x1308, 0x2ab: 0x1308, 0x2ac: 0x1308, 0x2ad: 0x1308, 0x2ae: 0x1308, 0x2af: 0x1308, + 0x2b0: 0xe00d, 0x2b1: 0x0008, 0x2b2: 0xe00d, 0x2b3: 0x0008, 0x2b4: 0x0425, 0x2b5: 0x0008, + 0x2b6: 0xe00d, 0x2b7: 0x0008, 0x2b8: 0x0040, 0x2b9: 0x0040, 0x2ba: 0x03a2, 0x2bb: 0x0008, + 0x2bc: 0x0008, 0x2bd: 0x0008, 0x2be: 0x03c2, 0x2bf: 0x043d, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x0040, 0x2c1: 0x0040, 0x2c2: 0x0040, 0x2c3: 0x0040, 0x2c4: 0x008a, 0x2c5: 0x03d2, + 0x2c6: 0xe155, 0x2c7: 0x0455, 0x2c8: 0xe12d, 0x2c9: 0xe13d, 0x2ca: 0xe12d, 0x2cb: 0x0040, + 0x2cc: 0x03dd, 0x2cd: 0x0040, 0x2ce: 0x046d, 0x2cf: 0x0485, 0x2d0: 0x0008, 0x2d1: 0xe105, + 0x2d2: 0xe105, 0x2d3: 0xe105, 0x2d4: 0xe105, 0x2d5: 0xe105, 0x2d6: 0xe105, 0x2d7: 0xe105, + 0x2d8: 0xe105, 0x2d9: 0xe105, 0x2da: 0xe105, 0x2db: 0xe105, 0x2dc: 0xe105, 0x2dd: 0xe105, + 0x2de: 0xe105, 0x2df: 0xe105, 0x2e0: 0x049d, 0x2e1: 0x049d, 0x2e2: 0x0040, 0x2e3: 0x049d, + 0x2e4: 0x049d, 0x2e5: 0x049d, 0x2e6: 0x049d, 0x2e7: 0x049d, 0x2e8: 0x049d, 0x2e9: 0x049d, + 0x2ea: 0x049d, 0x2eb: 0x049d, 0x2ec: 0x0008, 0x2ed: 0x0008, 0x2ee: 0x0008, 0x2ef: 0x0008, + 0x2f0: 0x0008, 0x2f1: 0x0008, 0x2f2: 0x0008, 0x2f3: 0x0008, 0x2f4: 0x0008, 0x2f5: 0x0008, + 0x2f6: 0x0008, 0x2f7: 0x0008, 0x2f8: 0x0008, 0x2f9: 0x0008, 0x2fa: 0x0008, 0x2fb: 0x0008, + 0x2fc: 0x0008, 0x2fd: 0x0008, 0x2fe: 0x0008, 0x2ff: 0x0008, + // Block 0xc, offset 0x300 + 0x300: 0x0008, 0x301: 0x0008, 0x302: 0xe00f, 0x303: 0x0008, 0x304: 0x0008, 0x305: 0x0008, + 0x306: 0x0008, 0x307: 0x0008, 0x308: 0x0008, 0x309: 0x0008, 0x30a: 0x0008, 0x30b: 0x0008, + 0x30c: 0x0008, 0x30d: 0x0008, 0x30e: 0x0008, 0x30f: 0xe0c5, 0x310: 0x04b5, 0x311: 0x04cd, + 0x312: 0xe0bd, 0x313: 0xe0f5, 0x314: 0xe0fd, 0x315: 0xe09d, 0x316: 0xe0b5, 0x317: 0x0008, + 0x318: 0xe00d, 0x319: 0x0008, 0x31a: 0xe00d, 0x31b: 0x0008, 0x31c: 0xe00d, 0x31d: 0x0008, + 0x31e: 0xe00d, 0x31f: 0x0008, 0x320: 0xe00d, 0x321: 0x0008, 0x322: 0xe00d, 0x323: 0x0008, + 0x324: 0xe00d, 0x325: 0x0008, 0x326: 0xe00d, 0x327: 0x0008, 0x328: 0xe00d, 0x329: 0x0008, + 0x32a: 0xe00d, 0x32b: 0x0008, 0x32c: 0xe00d, 0x32d: 0x0008, 0x32e: 0xe00d, 0x32f: 0x0008, + 0x330: 0x04e5, 0x331: 0xe185, 0x332: 0xe18d, 0x333: 0x0008, 0x334: 0x04fd, 0x335: 0x03dd, + 0x336: 0x0018, 0x337: 0xe07d, 0x338: 0x0008, 0x339: 0xe1d5, 0x33a: 0xe00d, 0x33b: 0x0008, + 0x33c: 0x0008, 0x33d: 0x0515, 0x33e: 0x052d, 0x33f: 0x052d, + // Block 0xd, offset 0x340 + 0x340: 0x0008, 0x341: 0x0008, 0x342: 0x0008, 0x343: 0x0008, 0x344: 0x0008, 0x345: 0x0008, + 0x346: 0x0008, 0x347: 0x0008, 0x348: 0x0008, 0x349: 0x0008, 0x34a: 0x0008, 0x34b: 0x0008, + 0x34c: 0x0008, 0x34d: 0x0008, 0x34e: 0x0008, 0x34f: 0x0008, 0x350: 0x0008, 0x351: 0x0008, + 0x352: 0x0008, 0x353: 0x0008, 0x354: 0x0008, 0x355: 0x0008, 0x356: 0x0008, 0x357: 0x0008, + 0x358: 0x0008, 0x359: 0x0008, 0x35a: 0x0008, 0x35b: 0x0008, 0x35c: 0x0008, 0x35d: 0x0008, + 0x35e: 0x0008, 0x35f: 0x0008, 0x360: 0xe00d, 0x361: 0x0008, 0x362: 0xe00d, 0x363: 0x0008, + 0x364: 0xe00d, 0x365: 0x0008, 0x366: 0xe00d, 0x367: 0x0008, 0x368: 0xe00d, 0x369: 0x0008, + 0x36a: 0xe00d, 0x36b: 0x0008, 0x36c: 0xe00d, 0x36d: 0x0008, 0x36e: 0xe00d, 0x36f: 0x0008, + 0x370: 0xe00d, 0x371: 0x0008, 0x372: 0xe00d, 0x373: 0x0008, 0x374: 0xe00d, 0x375: 0x0008, + 0x376: 0xe00d, 0x377: 0x0008, 0x378: 0xe00d, 0x379: 0x0008, 0x37a: 0xe00d, 0x37b: 0x0008, + 0x37c: 0xe00d, 0x37d: 0x0008, 0x37e: 0xe00d, 0x37f: 0x0008, + // Block 0xe, offset 0x380 + 0x380: 0xe00d, 0x381: 0x0008, 0x382: 0x0018, 0x383: 0x1308, 0x384: 0x1308, 0x385: 0x1308, + 0x386: 0x1308, 0x387: 0x1308, 0x388: 0x1318, 0x389: 0x1318, 0x38a: 0xe00d, 0x38b: 0x0008, + 0x38c: 0xe00d, 0x38d: 0x0008, 0x38e: 0xe00d, 0x38f: 0x0008, 0x390: 0xe00d, 0x391: 0x0008, + 0x392: 0xe00d, 0x393: 0x0008, 0x394: 0xe00d, 0x395: 0x0008, 0x396: 0xe00d, 0x397: 0x0008, + 0x398: 0xe00d, 0x399: 0x0008, 0x39a: 0xe00d, 0x39b: 0x0008, 0x39c: 0xe00d, 0x39d: 0x0008, + 0x39e: 0xe00d, 0x39f: 0x0008, 0x3a0: 0xe00d, 0x3a1: 0x0008, 0x3a2: 0xe00d, 0x3a3: 0x0008, + 0x3a4: 0xe00d, 0x3a5: 0x0008, 0x3a6: 0xe00d, 0x3a7: 0x0008, 0x3a8: 0xe00d, 0x3a9: 0x0008, + 0x3aa: 0xe00d, 0x3ab: 0x0008, 0x3ac: 0xe00d, 0x3ad: 0x0008, 0x3ae: 0xe00d, 0x3af: 0x0008, + 0x3b0: 0xe00d, 0x3b1: 0x0008, 0x3b2: 0xe00d, 0x3b3: 0x0008, 0x3b4: 0xe00d, 0x3b5: 0x0008, + 0x3b6: 0xe00d, 0x3b7: 0x0008, 0x3b8: 0xe00d, 0x3b9: 0x0008, 0x3ba: 0xe00d, 0x3bb: 0x0008, + 0x3bc: 0xe00d, 0x3bd: 0x0008, 0x3be: 0xe00d, 0x3bf: 0x0008, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x0040, 0x3c1: 0xe01d, 0x3c2: 0x0008, 0x3c3: 0xe03d, 0x3c4: 0x0008, 0x3c5: 0xe01d, + 0x3c6: 0x0008, 0x3c7: 0xe07d, 0x3c8: 0x0008, 0x3c9: 0xe01d, 0x3ca: 0x0008, 0x3cb: 0xe03d, + 0x3cc: 0x0008, 0x3cd: 0xe01d, 0x3ce: 0x0008, 0x3cf: 0x0008, 0x3d0: 0xe00d, 0x3d1: 0x0008, + 0x3d2: 0xe00d, 0x3d3: 0x0008, 0x3d4: 0xe00d, 0x3d5: 0x0008, 0x3d6: 0xe00d, 0x3d7: 0x0008, + 0x3d8: 0xe00d, 0x3d9: 0x0008, 0x3da: 0xe00d, 0x3db: 0x0008, 0x3dc: 0xe00d, 0x3dd: 0x0008, + 0x3de: 0xe00d, 0x3df: 0x0008, 0x3e0: 0xe00d, 0x3e1: 0x0008, 0x3e2: 0xe00d, 0x3e3: 0x0008, + 0x3e4: 0xe00d, 0x3e5: 0x0008, 0x3e6: 0xe00d, 0x3e7: 0x0008, 0x3e8: 0xe00d, 0x3e9: 0x0008, + 0x3ea: 0xe00d, 0x3eb: 0x0008, 0x3ec: 0xe00d, 0x3ed: 0x0008, 0x3ee: 0xe00d, 0x3ef: 0x0008, + 0x3f0: 0xe00d, 0x3f1: 0x0008, 0x3f2: 0xe00d, 0x3f3: 0x0008, 0x3f4: 0xe00d, 0x3f5: 0x0008, + 0x3f6: 0xe00d, 0x3f7: 0x0008, 0x3f8: 0xe00d, 0x3f9: 0x0008, 0x3fa: 0xe00d, 0x3fb: 0x0008, + 0x3fc: 0xe00d, 0x3fd: 0x0008, 0x3fe: 0xe00d, 0x3ff: 0x0008, + // Block 0x10, offset 0x400 + 0x400: 0xe00d, 0x401: 0x0008, 0x402: 0xe00d, 0x403: 0x0008, 0x404: 0xe00d, 0x405: 0x0008, + 0x406: 0xe00d, 0x407: 0x0008, 0x408: 0xe00d, 0x409: 0x0008, 0x40a: 0xe00d, 0x40b: 0x0008, + 0x40c: 0xe00d, 0x40d: 0x0008, 0x40e: 0xe00d, 0x40f: 0x0008, 0x410: 0xe00d, 0x411: 0x0008, + 0x412: 0xe00d, 0x413: 0x0008, 0x414: 0xe00d, 0x415: 0x0008, 0x416: 0xe00d, 0x417: 0x0008, + 0x418: 0xe00d, 0x419: 0x0008, 0x41a: 0xe00d, 0x41b: 0x0008, 0x41c: 0xe00d, 0x41d: 0x0008, + 0x41e: 0xe00d, 0x41f: 0x0008, 0x420: 0xe00d, 0x421: 0x0008, 0x422: 0xe00d, 0x423: 0x0008, + 0x424: 0xe00d, 0x425: 0x0008, 0x426: 0xe00d, 0x427: 0x0008, 0x428: 0xe00d, 0x429: 0x0008, + 0x42a: 0xe00d, 0x42b: 0x0008, 0x42c: 0xe00d, 0x42d: 0x0008, 0x42e: 0xe00d, 0x42f: 0x0008, + 0x430: 0x0040, 0x431: 0x03f5, 0x432: 0x03f5, 0x433: 0x03f5, 0x434: 0x03f5, 0x435: 0x03f5, + 0x436: 0x03f5, 0x437: 0x03f5, 0x438: 0x03f5, 0x439: 0x03f5, 0x43a: 0x03f5, 0x43b: 0x03f5, + 0x43c: 0x03f5, 0x43d: 0x03f5, 0x43e: 0x03f5, 0x43f: 0x03f5, + // Block 0x11, offset 0x440 + 0x440: 0x0040, 0x441: 0x0040, 0x442: 0x0040, 0x443: 0x0040, 0x444: 0x0040, 0x445: 0x0040, + 0x446: 0x0018, 0x447: 0x0018, 0x448: 0x0018, 0x449: 0x0018, 0x44a: 0x0018, 0x44b: 0x0018, + 0x44c: 0x0018, 0x44d: 0x0018, 0x44e: 0x0018, 0x44f: 0x0018, 0x450: 0x1308, 0x451: 0x1308, + 0x452: 0x1308, 0x453: 0x1308, 0x454: 0x1308, 0x455: 0x1308, 0x456: 0x1308, 0x457: 0x1308, + 0x458: 0x1308, 0x459: 0x1308, 0x45a: 0x1308, 0x45b: 0x0018, 0x45c: 0x0340, 0x45d: 0x0040, + 0x45e: 0x0018, 0x45f: 0x0018, 0x460: 0x0208, 0x461: 0x0008, 0x462: 0x0408, 0x463: 0x0408, + 0x464: 0x0408, 0x465: 0x0408, 0x466: 0x0208, 0x467: 0x0408, 0x468: 0x0208, 0x469: 0x0408, + 0x46a: 0x0208, 0x46b: 0x0208, 0x46c: 0x0208, 0x46d: 0x0208, 0x46e: 0x0208, 0x46f: 0x0408, + 0x470: 0x0408, 0x471: 0x0408, 0x472: 0x0408, 0x473: 0x0208, 0x474: 0x0208, 0x475: 0x0208, + 0x476: 0x0208, 0x477: 0x0208, 0x478: 0x0208, 0x479: 0x0208, 0x47a: 0x0208, 0x47b: 0x0208, + 0x47c: 0x0208, 0x47d: 0x0208, 0x47e: 0x0208, 0x47f: 0x0208, + // Block 0x12, offset 0x480 + 0x480: 0x0408, 0x481: 0x0208, 0x482: 0x0208, 0x483: 0x0408, 0x484: 0x0408, 0x485: 0x0408, + 0x486: 0x0408, 0x487: 0x0408, 0x488: 0x0408, 0x489: 0x0408, 0x48a: 0x0408, 0x48b: 0x0408, + 0x48c: 0x0208, 0x48d: 0x0408, 0x48e: 0x0208, 0x48f: 0x0408, 0x490: 0x0208, 0x491: 0x0208, + 0x492: 0x0408, 0x493: 0x0408, 0x494: 0x0018, 0x495: 0x0408, 0x496: 0x1308, 0x497: 0x1308, + 0x498: 0x1308, 0x499: 0x1308, 0x49a: 0x1308, 0x49b: 0x1308, 0x49c: 0x1308, 0x49d: 0x0040, + 0x49e: 0x0018, 0x49f: 0x1308, 0x4a0: 0x1308, 0x4a1: 0x1308, 0x4a2: 0x1308, 0x4a3: 0x1308, + 0x4a4: 0x1308, 0x4a5: 0x0008, 0x4a6: 0x0008, 0x4a7: 0x1308, 0x4a8: 0x1308, 0x4a9: 0x0018, + 0x4aa: 0x1308, 0x4ab: 0x1308, 0x4ac: 0x1308, 0x4ad: 0x1308, 0x4ae: 0x0408, 0x4af: 0x0408, + 0x4b0: 0x0008, 0x4b1: 0x0008, 0x4b2: 0x0008, 0x4b3: 0x0008, 0x4b4: 0x0008, 0x4b5: 0x0008, + 0x4b6: 0x0008, 0x4b7: 0x0008, 0x4b8: 0x0008, 0x4b9: 0x0008, 0x4ba: 0x0208, 0x4bb: 0x0208, + 0x4bc: 0x0208, 0x4bd: 0x0008, 0x4be: 0x0008, 0x4bf: 0x0208, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x0018, 0x4c1: 0x0018, 0x4c2: 0x0018, 0x4c3: 0x0018, 0x4c4: 0x0018, 0x4c5: 0x0018, + 0x4c6: 0x0018, 0x4c7: 0x0018, 0x4c8: 0x0018, 0x4c9: 0x0018, 0x4ca: 0x0018, 0x4cb: 0x0018, + 0x4cc: 0x0018, 0x4cd: 0x0018, 0x4ce: 0x0040, 0x4cf: 0x0340, 0x4d0: 0x0408, 0x4d1: 0x1308, + 0x4d2: 0x0208, 0x4d3: 0x0208, 0x4d4: 0x0208, 0x4d5: 0x0408, 0x4d6: 0x0408, 0x4d7: 0x0408, + 0x4d8: 0x0408, 0x4d9: 0x0408, 0x4da: 0x0208, 0x4db: 0x0208, 0x4dc: 0x0208, 0x4dd: 0x0208, + 0x4de: 0x0408, 0x4df: 0x0208, 0x4e0: 0x0208, 0x4e1: 0x0208, 0x4e2: 0x0208, 0x4e3: 0x0208, + 0x4e4: 0x0208, 0x4e5: 0x0208, 0x4e6: 0x0208, 0x4e7: 0x0208, 0x4e8: 0x0408, 0x4e9: 0x0208, + 0x4ea: 0x0408, 0x4eb: 0x0208, 0x4ec: 0x0408, 0x4ed: 0x0208, 0x4ee: 0x0208, 0x4ef: 0x0408, + 0x4f0: 0x1308, 0x4f1: 0x1308, 0x4f2: 0x1308, 0x4f3: 0x1308, 0x4f4: 0x1308, 0x4f5: 0x1308, + 0x4f6: 0x1308, 0x4f7: 0x1308, 0x4f8: 0x1308, 0x4f9: 0x1308, 0x4fa: 0x1308, 0x4fb: 0x1308, + 0x4fc: 0x1308, 0x4fd: 0x1308, 0x4fe: 0x1308, 0x4ff: 0x1308, + // Block 0x14, offset 0x500 + 0x500: 0x1008, 0x501: 0x1308, 0x502: 0x1308, 0x503: 0x1308, 0x504: 0x1308, 0x505: 0x1308, + 0x506: 0x1308, 0x507: 0x1308, 0x508: 0x1308, 0x509: 0x1008, 0x50a: 0x1008, 0x50b: 0x1008, + 0x50c: 0x1008, 0x50d: 0x1b08, 0x50e: 0x1008, 0x50f: 0x1008, 0x510: 0x0008, 0x511: 0x1308, + 0x512: 0x1308, 0x513: 0x1308, 0x514: 0x1308, 0x515: 0x1308, 0x516: 0x1308, 0x517: 0x1308, + 0x518: 0x04c9, 0x519: 0x0501, 0x51a: 0x0539, 0x51b: 0x0571, 0x51c: 0x05a9, 0x51d: 0x05e1, + 0x51e: 0x0619, 0x51f: 0x0651, 0x520: 0x0008, 0x521: 0x0008, 0x522: 0x1308, 0x523: 0x1308, + 0x524: 0x0018, 0x525: 0x0018, 0x526: 0x0008, 0x527: 0x0008, 0x528: 0x0008, 0x529: 0x0008, + 0x52a: 0x0008, 0x52b: 0x0008, 0x52c: 0x0008, 0x52d: 0x0008, 0x52e: 0x0008, 0x52f: 0x0008, + 0x530: 0x0018, 0x531: 0x0008, 0x532: 0x0008, 0x533: 0x0008, 0x534: 0x0008, 0x535: 0x0008, + 0x536: 0x0008, 0x537: 0x0008, 0x538: 0x0008, 0x539: 0x0008, 0x53a: 0x0008, 0x53b: 0x0008, + 0x53c: 0x0008, 0x53d: 0x0008, 0x53e: 0x0008, 0x53f: 0x0008, + // Block 0x15, offset 0x540 + 0x540: 0x0008, 0x541: 0x1308, 0x542: 0x1008, 0x543: 0x1008, 0x544: 0x0040, 0x545: 0x0008, + 0x546: 0x0008, 0x547: 0x0008, 0x548: 0x0008, 0x549: 0x0008, 0x54a: 0x0008, 0x54b: 0x0008, + 0x54c: 0x0008, 0x54d: 0x0040, 0x54e: 0x0040, 0x54f: 0x0008, 0x550: 0x0008, 0x551: 0x0040, + 0x552: 0x0040, 0x553: 0x0008, 0x554: 0x0008, 0x555: 0x0008, 0x556: 0x0008, 0x557: 0x0008, + 0x558: 0x0008, 0x559: 0x0008, 0x55a: 0x0008, 0x55b: 0x0008, 0x55c: 0x0008, 0x55d: 0x0008, + 0x55e: 0x0008, 0x55f: 0x0008, 0x560: 0x0008, 0x561: 0x0008, 0x562: 0x0008, 0x563: 0x0008, + 0x564: 0x0008, 0x565: 0x0008, 0x566: 0x0008, 0x567: 0x0008, 0x568: 0x0008, 0x569: 0x0040, + 0x56a: 0x0008, 0x56b: 0x0008, 0x56c: 0x0008, 0x56d: 0x0008, 0x56e: 0x0008, 0x56f: 0x0008, + 0x570: 0x0008, 0x571: 0x0040, 0x572: 0x0008, 0x573: 0x0040, 0x574: 0x0040, 0x575: 0x0040, + 0x576: 0x0008, 0x577: 0x0008, 0x578: 0x0008, 0x579: 0x0008, 0x57a: 0x0040, 0x57b: 0x0040, + 0x57c: 0x1308, 0x57d: 0x0008, 0x57e: 0x1008, 0x57f: 0x1008, + // Block 0x16, offset 0x580 + 0x580: 0x1008, 0x581: 0x1308, 0x582: 0x1308, 0x583: 0x1308, 0x584: 0x1308, 0x585: 0x0040, + 0x586: 0x0040, 0x587: 0x1008, 0x588: 0x1008, 0x589: 0x0040, 0x58a: 0x0040, 0x58b: 0x1008, + 0x58c: 0x1008, 0x58d: 0x1b08, 0x58e: 0x0008, 0x58f: 0x0040, 0x590: 0x0040, 0x591: 0x0040, + 0x592: 0x0040, 0x593: 0x0040, 0x594: 0x0040, 0x595: 0x0040, 0x596: 0x0040, 0x597: 0x1008, + 0x598: 0x0040, 0x599: 0x0040, 0x59a: 0x0040, 0x59b: 0x0040, 0x59c: 0x0689, 0x59d: 0x06c1, + 0x59e: 0x0040, 0x59f: 0x06f9, 0x5a0: 0x0008, 0x5a1: 0x0008, 0x5a2: 0x1308, 0x5a3: 0x1308, + 0x5a4: 0x0040, 0x5a5: 0x0040, 0x5a6: 0x0008, 0x5a7: 0x0008, 0x5a8: 0x0008, 0x5a9: 0x0008, + 0x5aa: 0x0008, 0x5ab: 0x0008, 0x5ac: 0x0008, 0x5ad: 0x0008, 0x5ae: 0x0008, 0x5af: 0x0008, + 0x5b0: 0x0008, 0x5b1: 0x0008, 0x5b2: 0x0018, 0x5b3: 0x0018, 0x5b4: 0x0018, 0x5b5: 0x0018, + 0x5b6: 0x0018, 0x5b7: 0x0018, 0x5b8: 0x0018, 0x5b9: 0x0018, 0x5ba: 0x0018, 0x5bb: 0x0018, + 0x5bc: 0x0040, 0x5bd: 0x0040, 0x5be: 0x0040, 0x5bf: 0x0040, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x0040, 0x5c1: 0x1308, 0x5c2: 0x1308, 0x5c3: 0x1008, 0x5c4: 0x0040, 0x5c5: 0x0008, + 0x5c6: 0x0008, 0x5c7: 0x0008, 0x5c8: 0x0008, 0x5c9: 0x0008, 0x5ca: 0x0008, 0x5cb: 0x0040, + 0x5cc: 0x0040, 0x5cd: 0x0040, 0x5ce: 0x0040, 0x5cf: 0x0008, 0x5d0: 0x0008, 0x5d1: 0x0040, + 0x5d2: 0x0040, 0x5d3: 0x0008, 0x5d4: 0x0008, 0x5d5: 0x0008, 0x5d6: 0x0008, 0x5d7: 0x0008, + 0x5d8: 0x0008, 0x5d9: 0x0008, 0x5da: 0x0008, 0x5db: 0x0008, 0x5dc: 0x0008, 0x5dd: 0x0008, + 0x5de: 0x0008, 0x5df: 0x0008, 0x5e0: 0x0008, 0x5e1: 0x0008, 0x5e2: 0x0008, 0x5e3: 0x0008, + 0x5e4: 0x0008, 0x5e5: 0x0008, 0x5e6: 0x0008, 0x5e7: 0x0008, 0x5e8: 0x0008, 0x5e9: 0x0040, + 0x5ea: 0x0008, 0x5eb: 0x0008, 0x5ec: 0x0008, 0x5ed: 0x0008, 0x5ee: 0x0008, 0x5ef: 0x0008, + 0x5f0: 0x0008, 0x5f1: 0x0040, 0x5f2: 0x0008, 0x5f3: 0x0731, 0x5f4: 0x0040, 0x5f5: 0x0008, + 0x5f6: 0x0769, 0x5f7: 0x0040, 0x5f8: 0x0008, 0x5f9: 0x0008, 0x5fa: 0x0040, 0x5fb: 0x0040, + 0x5fc: 0x1308, 0x5fd: 0x0040, 0x5fe: 0x1008, 0x5ff: 0x1008, + // Block 0x18, offset 0x600 + 0x600: 0x1008, 0x601: 0x1308, 0x602: 0x1308, 0x603: 0x0040, 0x604: 0x0040, 0x605: 0x0040, + 0x606: 0x0040, 0x607: 0x1308, 0x608: 0x1308, 0x609: 0x0040, 0x60a: 0x0040, 0x60b: 0x1308, + 0x60c: 0x1308, 0x60d: 0x1b08, 0x60e: 0x0040, 0x60f: 0x0040, 0x610: 0x0040, 0x611: 0x1308, + 0x612: 0x0040, 0x613: 0x0040, 0x614: 0x0040, 0x615: 0x0040, 0x616: 0x0040, 0x617: 0x0040, + 0x618: 0x0040, 0x619: 0x07a1, 0x61a: 0x07d9, 0x61b: 0x0811, 0x61c: 0x0008, 0x61d: 0x0040, + 0x61e: 0x0849, 0x61f: 0x0040, 0x620: 0x0040, 0x621: 0x0040, 0x622: 0x0040, 0x623: 0x0040, + 0x624: 0x0040, 0x625: 0x0040, 0x626: 0x0008, 0x627: 0x0008, 0x628: 0x0008, 0x629: 0x0008, + 0x62a: 0x0008, 0x62b: 0x0008, 0x62c: 0x0008, 0x62d: 0x0008, 0x62e: 0x0008, 0x62f: 0x0008, + 0x630: 0x1308, 0x631: 0x1308, 0x632: 0x0008, 0x633: 0x0008, 0x634: 0x0008, 0x635: 0x1308, + 0x636: 0x0040, 0x637: 0x0040, 0x638: 0x0040, 0x639: 0x0040, 0x63a: 0x0040, 0x63b: 0x0040, + 0x63c: 0x0040, 0x63d: 0x0040, 0x63e: 0x0040, 0x63f: 0x0040, + // Block 0x19, offset 0x640 + 0x640: 0x0040, 0x641: 0x1308, 0x642: 0x1308, 0x643: 0x1008, 0x644: 0x0040, 0x645: 0x0008, + 0x646: 0x0008, 0x647: 0x0008, 0x648: 0x0008, 0x649: 0x0008, 0x64a: 0x0008, 0x64b: 0x0008, + 0x64c: 0x0008, 0x64d: 0x0008, 0x64e: 0x0040, 0x64f: 0x0008, 0x650: 0x0008, 0x651: 0x0008, + 0x652: 0x0040, 0x653: 0x0008, 0x654: 0x0008, 0x655: 0x0008, 0x656: 0x0008, 0x657: 0x0008, + 0x658: 0x0008, 0x659: 0x0008, 0x65a: 0x0008, 0x65b: 0x0008, 0x65c: 0x0008, 0x65d: 0x0008, + 0x65e: 0x0008, 0x65f: 0x0008, 0x660: 0x0008, 0x661: 0x0008, 0x662: 0x0008, 0x663: 0x0008, + 0x664: 0x0008, 0x665: 0x0008, 0x666: 0x0008, 0x667: 0x0008, 0x668: 0x0008, 0x669: 0x0040, + 0x66a: 0x0008, 0x66b: 0x0008, 0x66c: 0x0008, 0x66d: 0x0008, 0x66e: 0x0008, 0x66f: 0x0008, + 0x670: 0x0008, 0x671: 0x0040, 0x672: 0x0008, 0x673: 0x0008, 0x674: 0x0040, 0x675: 0x0008, + 0x676: 0x0008, 0x677: 0x0008, 0x678: 0x0008, 0x679: 0x0008, 0x67a: 0x0040, 0x67b: 0x0040, + 0x67c: 0x1308, 0x67d: 0x0008, 0x67e: 0x1008, 0x67f: 0x1008, + // Block 0x1a, offset 0x680 + 0x680: 0x1008, 0x681: 0x1308, 0x682: 0x1308, 0x683: 0x1308, 0x684: 0x1308, 0x685: 0x1308, + 0x686: 0x0040, 0x687: 0x1308, 0x688: 0x1308, 0x689: 0x1008, 0x68a: 0x0040, 0x68b: 0x1008, + 0x68c: 0x1008, 0x68d: 0x1b08, 0x68e: 0x0040, 0x68f: 0x0040, 0x690: 0x0008, 0x691: 0x0040, + 0x692: 0x0040, 0x693: 0x0040, 0x694: 0x0040, 0x695: 0x0040, 0x696: 0x0040, 0x697: 0x0040, + 0x698: 0x0040, 0x699: 0x0040, 0x69a: 0x0040, 0x69b: 0x0040, 0x69c: 0x0040, 0x69d: 0x0040, + 0x69e: 0x0040, 0x69f: 0x0040, 0x6a0: 0x0008, 0x6a1: 0x0008, 0x6a2: 0x1308, 0x6a3: 0x1308, + 0x6a4: 0x0040, 0x6a5: 0x0040, 0x6a6: 0x0008, 0x6a7: 0x0008, 0x6a8: 0x0008, 0x6a9: 0x0008, + 0x6aa: 0x0008, 0x6ab: 0x0008, 0x6ac: 0x0008, 0x6ad: 0x0008, 0x6ae: 0x0008, 0x6af: 0x0008, + 0x6b0: 0x0018, 0x6b1: 0x0018, 0x6b2: 0x0040, 0x6b3: 0x0040, 0x6b4: 0x0040, 0x6b5: 0x0040, + 0x6b6: 0x0040, 0x6b7: 0x0040, 0x6b8: 0x0040, 0x6b9: 0x0008, 0x6ba: 0x0040, 0x6bb: 0x0040, + 0x6bc: 0x0040, 0x6bd: 0x0040, 0x6be: 0x0040, 0x6bf: 0x0040, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x0040, 0x6c1: 0x1308, 0x6c2: 0x1008, 0x6c3: 0x1008, 0x6c4: 0x0040, 0x6c5: 0x0008, + 0x6c6: 0x0008, 0x6c7: 0x0008, 0x6c8: 0x0008, 0x6c9: 0x0008, 0x6ca: 0x0008, 0x6cb: 0x0008, + 0x6cc: 0x0008, 0x6cd: 0x0040, 0x6ce: 0x0040, 0x6cf: 0x0008, 0x6d0: 0x0008, 0x6d1: 0x0040, + 0x6d2: 0x0040, 0x6d3: 0x0008, 0x6d4: 0x0008, 0x6d5: 0x0008, 0x6d6: 0x0008, 0x6d7: 0x0008, + 0x6d8: 0x0008, 0x6d9: 0x0008, 0x6da: 0x0008, 0x6db: 0x0008, 0x6dc: 0x0008, 0x6dd: 0x0008, + 0x6de: 0x0008, 0x6df: 0x0008, 0x6e0: 0x0008, 0x6e1: 0x0008, 0x6e2: 0x0008, 0x6e3: 0x0008, + 0x6e4: 0x0008, 0x6e5: 0x0008, 0x6e6: 0x0008, 0x6e7: 0x0008, 0x6e8: 0x0008, 0x6e9: 0x0040, + 0x6ea: 0x0008, 0x6eb: 0x0008, 0x6ec: 0x0008, 0x6ed: 0x0008, 0x6ee: 0x0008, 0x6ef: 0x0008, + 0x6f0: 0x0008, 0x6f1: 0x0040, 0x6f2: 0x0008, 0x6f3: 0x0008, 0x6f4: 0x0040, 0x6f5: 0x0008, + 0x6f6: 0x0008, 0x6f7: 0x0008, 0x6f8: 0x0008, 0x6f9: 0x0008, 0x6fa: 0x0040, 0x6fb: 0x0040, + 0x6fc: 0x1308, 0x6fd: 0x0008, 0x6fe: 0x1008, 0x6ff: 0x1308, + // Block 0x1c, offset 0x700 + 0x700: 0x1008, 0x701: 0x1308, 0x702: 0x1308, 0x703: 0x1308, 0x704: 0x1308, 0x705: 0x0040, + 0x706: 0x0040, 0x707: 0x1008, 0x708: 0x1008, 0x709: 0x0040, 0x70a: 0x0040, 0x70b: 0x1008, + 0x70c: 0x1008, 0x70d: 0x1b08, 0x70e: 0x0040, 0x70f: 0x0040, 0x710: 0x0040, 0x711: 0x0040, + 0x712: 0x0040, 0x713: 0x0040, 0x714: 0x0040, 0x715: 0x0040, 0x716: 0x1308, 0x717: 0x1008, + 0x718: 0x0040, 0x719: 0x0040, 0x71a: 0x0040, 0x71b: 0x0040, 0x71c: 0x0881, 0x71d: 0x08b9, + 0x71e: 0x0040, 0x71f: 0x0008, 0x720: 0x0008, 0x721: 0x0008, 0x722: 0x1308, 0x723: 0x1308, + 0x724: 0x0040, 0x725: 0x0040, 0x726: 0x0008, 0x727: 0x0008, 0x728: 0x0008, 0x729: 0x0008, + 0x72a: 0x0008, 0x72b: 0x0008, 0x72c: 0x0008, 0x72d: 0x0008, 0x72e: 0x0008, 0x72f: 0x0008, + 0x730: 0x0018, 0x731: 0x0008, 0x732: 0x0018, 0x733: 0x0018, 0x734: 0x0018, 0x735: 0x0018, + 0x736: 0x0018, 0x737: 0x0018, 0x738: 0x0040, 0x739: 0x0040, 0x73a: 0x0040, 0x73b: 0x0040, + 0x73c: 0x0040, 0x73d: 0x0040, 0x73e: 0x0040, 0x73f: 0x0040, + // Block 0x1d, offset 0x740 + 0x740: 0x0040, 0x741: 0x0040, 0x742: 0x1308, 0x743: 0x0008, 0x744: 0x0040, 0x745: 0x0008, + 0x746: 0x0008, 0x747: 0x0008, 0x748: 0x0008, 0x749: 0x0008, 0x74a: 0x0008, 0x74b: 0x0040, + 0x74c: 0x0040, 0x74d: 0x0040, 0x74e: 0x0008, 0x74f: 0x0008, 0x750: 0x0008, 0x751: 0x0040, + 0x752: 0x0008, 0x753: 0x0008, 0x754: 0x0008, 0x755: 0x0008, 0x756: 0x0040, 0x757: 0x0040, + 0x758: 0x0040, 0x759: 0x0008, 0x75a: 0x0008, 0x75b: 0x0040, 0x75c: 0x0008, 0x75d: 0x0040, + 0x75e: 0x0008, 0x75f: 0x0008, 0x760: 0x0040, 0x761: 0x0040, 0x762: 0x0040, 0x763: 0x0008, + 0x764: 0x0008, 0x765: 0x0040, 0x766: 0x0040, 0x767: 0x0040, 0x768: 0x0008, 0x769: 0x0008, + 0x76a: 0x0008, 0x76b: 0x0040, 0x76c: 0x0040, 0x76d: 0x0040, 0x76e: 0x0008, 0x76f: 0x0008, + 0x770: 0x0008, 0x771: 0x0008, 0x772: 0x0008, 0x773: 0x0008, 0x774: 0x0008, 0x775: 0x0008, + 0x776: 0x0008, 0x777: 0x0008, 0x778: 0x0008, 0x779: 0x0008, 0x77a: 0x0040, 0x77b: 0x0040, + 0x77c: 0x0040, 0x77d: 0x0040, 0x77e: 0x1008, 0x77f: 0x1008, + // Block 0x1e, offset 0x780 + 0x780: 0x1308, 0x781: 0x1008, 0x782: 0x1008, 0x783: 0x1008, 0x784: 0x1008, 0x785: 0x0040, + 0x786: 0x1308, 0x787: 0x1308, 0x788: 0x1308, 0x789: 0x0040, 0x78a: 0x1308, 0x78b: 0x1308, + 0x78c: 0x1308, 0x78d: 0x1b08, 0x78e: 0x0040, 0x78f: 0x0040, 0x790: 0x0040, 0x791: 0x0040, + 0x792: 0x0040, 0x793: 0x0040, 0x794: 0x0040, 0x795: 0x1308, 0x796: 0x1308, 0x797: 0x0040, + 0x798: 0x0008, 0x799: 0x0008, 0x79a: 0x0008, 0x79b: 0x0040, 0x79c: 0x0040, 0x79d: 0x0040, + 0x79e: 0x0040, 0x79f: 0x0040, 0x7a0: 0x0008, 0x7a1: 0x0008, 0x7a2: 0x1308, 0x7a3: 0x1308, + 0x7a4: 0x0040, 0x7a5: 0x0040, 0x7a6: 0x0008, 0x7a7: 0x0008, 0x7a8: 0x0008, 0x7a9: 0x0008, + 0x7aa: 0x0008, 0x7ab: 0x0008, 0x7ac: 0x0008, 0x7ad: 0x0008, 0x7ae: 0x0008, 0x7af: 0x0008, + 0x7b0: 0x0040, 0x7b1: 0x0040, 0x7b2: 0x0040, 0x7b3: 0x0040, 0x7b4: 0x0040, 0x7b5: 0x0040, + 0x7b6: 0x0040, 0x7b7: 0x0040, 0x7b8: 0x0018, 0x7b9: 0x0018, 0x7ba: 0x0018, 0x7bb: 0x0018, + 0x7bc: 0x0018, 0x7bd: 0x0018, 0x7be: 0x0018, 0x7bf: 0x0018, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x0008, 0x7c1: 0x1308, 0x7c2: 0x1008, 0x7c3: 0x1008, 0x7c4: 0x0040, 0x7c5: 0x0008, + 0x7c6: 0x0008, 0x7c7: 0x0008, 0x7c8: 0x0008, 0x7c9: 0x0008, 0x7ca: 0x0008, 0x7cb: 0x0008, + 0x7cc: 0x0008, 0x7cd: 0x0040, 0x7ce: 0x0008, 0x7cf: 0x0008, 0x7d0: 0x0008, 0x7d1: 0x0040, + 0x7d2: 0x0008, 0x7d3: 0x0008, 0x7d4: 0x0008, 0x7d5: 0x0008, 0x7d6: 0x0008, 0x7d7: 0x0008, + 0x7d8: 0x0008, 0x7d9: 0x0008, 0x7da: 0x0008, 0x7db: 0x0008, 0x7dc: 0x0008, 0x7dd: 0x0008, + 0x7de: 0x0008, 0x7df: 0x0008, 0x7e0: 0x0008, 0x7e1: 0x0008, 0x7e2: 0x0008, 0x7e3: 0x0008, + 0x7e4: 0x0008, 0x7e5: 0x0008, 0x7e6: 0x0008, 0x7e7: 0x0008, 0x7e8: 0x0008, 0x7e9: 0x0040, + 0x7ea: 0x0008, 0x7eb: 0x0008, 0x7ec: 0x0008, 0x7ed: 0x0008, 0x7ee: 0x0008, 0x7ef: 0x0008, + 0x7f0: 0x0008, 0x7f1: 0x0008, 0x7f2: 0x0008, 0x7f3: 0x0008, 0x7f4: 0x0040, 0x7f5: 0x0008, + 0x7f6: 0x0008, 0x7f7: 0x0008, 0x7f8: 0x0008, 0x7f9: 0x0008, 0x7fa: 0x0040, 0x7fb: 0x0040, + 0x7fc: 0x1308, 0x7fd: 0x0008, 0x7fe: 0x1008, 0x7ff: 0x1308, + // Block 0x20, offset 0x800 + 0x800: 0x1008, 0x801: 0x1008, 0x802: 0x1008, 0x803: 0x1008, 0x804: 0x1008, 0x805: 0x0040, + 0x806: 0x1308, 0x807: 0x1008, 0x808: 0x1008, 0x809: 0x0040, 0x80a: 0x1008, 0x80b: 0x1008, + 0x80c: 0x1308, 0x80d: 0x1b08, 0x80e: 0x0040, 0x80f: 0x0040, 0x810: 0x0040, 0x811: 0x0040, + 0x812: 0x0040, 0x813: 0x0040, 0x814: 0x0040, 0x815: 0x1008, 0x816: 0x1008, 0x817: 0x0040, + 0x818: 0x0040, 0x819: 0x0040, 0x81a: 0x0040, 0x81b: 0x0040, 0x81c: 0x0040, 0x81d: 0x0040, + 0x81e: 0x0008, 0x81f: 0x0040, 0x820: 0x0008, 0x821: 0x0008, 0x822: 0x1308, 0x823: 0x1308, + 0x824: 0x0040, 0x825: 0x0040, 0x826: 0x0008, 0x827: 0x0008, 0x828: 0x0008, 0x829: 0x0008, + 0x82a: 0x0008, 0x82b: 0x0008, 0x82c: 0x0008, 0x82d: 0x0008, 0x82e: 0x0008, 0x82f: 0x0008, + 0x830: 0x0040, 0x831: 0x0008, 0x832: 0x0008, 0x833: 0x0040, 0x834: 0x0040, 0x835: 0x0040, + 0x836: 0x0040, 0x837: 0x0040, 0x838: 0x0040, 0x839: 0x0040, 0x83a: 0x0040, 0x83b: 0x0040, + 0x83c: 0x0040, 0x83d: 0x0040, 0x83e: 0x0040, 0x83f: 0x0040, + // Block 0x21, offset 0x840 + 0x840: 0x1008, 0x841: 0x1308, 0x842: 0x1308, 0x843: 0x1308, 0x844: 0x1308, 0x845: 0x0040, + 0x846: 0x1008, 0x847: 0x1008, 0x848: 0x1008, 0x849: 0x0040, 0x84a: 0x1008, 0x84b: 0x1008, + 0x84c: 0x1008, 0x84d: 0x1b08, 0x84e: 0x0008, 0x84f: 0x0018, 0x850: 0x0040, 0x851: 0x0040, + 0x852: 0x0040, 0x853: 0x0040, 0x854: 0x0008, 0x855: 0x0008, 0x856: 0x0008, 0x857: 0x1008, + 0x858: 0x0018, 0x859: 0x0018, 0x85a: 0x0018, 0x85b: 0x0018, 0x85c: 0x0018, 0x85d: 0x0018, + 0x85e: 0x0018, 0x85f: 0x0008, 0x860: 0x0008, 0x861: 0x0008, 0x862: 0x1308, 0x863: 0x1308, + 0x864: 0x0040, 0x865: 0x0040, 0x866: 0x0008, 0x867: 0x0008, 0x868: 0x0008, 0x869: 0x0008, + 0x86a: 0x0008, 0x86b: 0x0008, 0x86c: 0x0008, 0x86d: 0x0008, 0x86e: 0x0008, 0x86f: 0x0008, + 0x870: 0x0018, 0x871: 0x0018, 0x872: 0x0018, 0x873: 0x0018, 0x874: 0x0018, 0x875: 0x0018, + 0x876: 0x0018, 0x877: 0x0018, 0x878: 0x0018, 0x879: 0x0018, 0x87a: 0x0008, 0x87b: 0x0008, + 0x87c: 0x0008, 0x87d: 0x0008, 0x87e: 0x0008, 0x87f: 0x0008, + // Block 0x22, offset 0x880 + 0x880: 0x0040, 0x881: 0x0008, 0x882: 0x0008, 0x883: 0x0040, 0x884: 0x0008, 0x885: 0x0040, + 0x886: 0x0040, 0x887: 0x0008, 0x888: 0x0008, 0x889: 0x0040, 0x88a: 0x0008, 0x88b: 0x0040, + 0x88c: 0x0040, 0x88d: 0x0008, 0x88e: 0x0040, 0x88f: 0x0040, 0x890: 0x0040, 0x891: 0x0040, + 0x892: 0x0040, 0x893: 0x0040, 0x894: 0x0008, 0x895: 0x0008, 0x896: 0x0008, 0x897: 0x0008, + 0x898: 0x0040, 0x899: 0x0008, 0x89a: 0x0008, 0x89b: 0x0008, 0x89c: 0x0008, 0x89d: 0x0008, + 0x89e: 0x0008, 0x89f: 0x0008, 0x8a0: 0x0040, 0x8a1: 0x0008, 0x8a2: 0x0008, 0x8a3: 0x0008, + 0x8a4: 0x0040, 0x8a5: 0x0008, 0x8a6: 0x0040, 0x8a7: 0x0008, 0x8a8: 0x0040, 0x8a9: 0x0040, + 0x8aa: 0x0008, 0x8ab: 0x0008, 0x8ac: 0x0040, 0x8ad: 0x0008, 0x8ae: 0x0008, 0x8af: 0x0008, + 0x8b0: 0x0008, 0x8b1: 0x1308, 0x8b2: 0x0008, 0x8b3: 0x0929, 0x8b4: 0x1308, 0x8b5: 0x1308, + 0x8b6: 0x1308, 0x8b7: 0x1308, 0x8b8: 0x1308, 0x8b9: 0x1308, 0x8ba: 0x0040, 0x8bb: 0x1308, + 0x8bc: 0x1308, 0x8bd: 0x0008, 0x8be: 0x0040, 0x8bf: 0x0040, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0008, 0x8c1: 0x0008, 0x8c2: 0x0008, 0x8c3: 0x09d1, 0x8c4: 0x0008, 0x8c5: 0x0008, + 0x8c6: 0x0008, 0x8c7: 0x0008, 0x8c8: 0x0040, 0x8c9: 0x0008, 0x8ca: 0x0008, 0x8cb: 0x0008, + 0x8cc: 0x0008, 0x8cd: 0x0a09, 0x8ce: 0x0008, 0x8cf: 0x0008, 0x8d0: 0x0008, 0x8d1: 0x0008, + 0x8d2: 0x0a41, 0x8d3: 0x0008, 0x8d4: 0x0008, 0x8d5: 0x0008, 0x8d6: 0x0008, 0x8d7: 0x0a79, + 0x8d8: 0x0008, 0x8d9: 0x0008, 0x8da: 0x0008, 0x8db: 0x0008, 0x8dc: 0x0ab1, 0x8dd: 0x0008, + 0x8de: 0x0008, 0x8df: 0x0008, 0x8e0: 0x0008, 0x8e1: 0x0008, 0x8e2: 0x0008, 0x8e3: 0x0008, + 0x8e4: 0x0008, 0x8e5: 0x0008, 0x8e6: 0x0008, 0x8e7: 0x0008, 0x8e8: 0x0008, 0x8e9: 0x0ae9, + 0x8ea: 0x0008, 0x8eb: 0x0008, 0x8ec: 0x0008, 0x8ed: 0x0040, 0x8ee: 0x0040, 0x8ef: 0x0040, + 0x8f0: 0x0040, 0x8f1: 0x1308, 0x8f2: 0x1308, 0x8f3: 0x0b21, 0x8f4: 0x1308, 0x8f5: 0x0b59, + 0x8f6: 0x0b91, 0x8f7: 0x0bc9, 0x8f8: 0x0c19, 0x8f9: 0x0c51, 0x8fa: 0x1308, 0x8fb: 0x1308, + 0x8fc: 0x1308, 0x8fd: 0x1308, 0x8fe: 0x1308, 0x8ff: 0x1008, + // Block 0x24, offset 0x900 + 0x900: 0x1308, 0x901: 0x0ca1, 0x902: 0x1308, 0x903: 0x1308, 0x904: 0x1b08, 0x905: 0x0018, + 0x906: 0x1308, 0x907: 0x1308, 0x908: 0x0008, 0x909: 0x0008, 0x90a: 0x0008, 0x90b: 0x0008, + 0x90c: 0x0008, 0x90d: 0x1308, 0x90e: 0x1308, 0x90f: 0x1308, 0x910: 0x1308, 0x911: 0x1308, + 0x912: 0x1308, 0x913: 0x0cd9, 0x914: 0x1308, 0x915: 0x1308, 0x916: 0x1308, 0x917: 0x1308, + 0x918: 0x0040, 0x919: 0x1308, 0x91a: 0x1308, 0x91b: 0x1308, 0x91c: 0x1308, 0x91d: 0x0d11, + 0x91e: 0x1308, 0x91f: 0x1308, 0x920: 0x1308, 0x921: 0x1308, 0x922: 0x0d49, 0x923: 0x1308, + 0x924: 0x1308, 0x925: 0x1308, 0x926: 0x1308, 0x927: 0x0d81, 0x928: 0x1308, 0x929: 0x1308, + 0x92a: 0x1308, 0x92b: 0x1308, 0x92c: 0x0db9, 0x92d: 0x1308, 0x92e: 0x1308, 0x92f: 0x1308, + 0x930: 0x1308, 0x931: 0x1308, 0x932: 0x1308, 0x933: 0x1308, 0x934: 0x1308, 0x935: 0x1308, + 0x936: 0x1308, 0x937: 0x1308, 0x938: 0x1308, 0x939: 0x0df1, 0x93a: 0x1308, 0x93b: 0x1308, + 0x93c: 0x1308, 0x93d: 0x0040, 0x93e: 0x0018, 0x93f: 0x0018, + // Block 0x25, offset 0x940 + 0x940: 0x0008, 0x941: 0x0008, 0x942: 0x0008, 0x943: 0x0008, 0x944: 0x0008, 0x945: 0x0008, + 0x946: 0x0008, 0x947: 0x0008, 0x948: 0x0008, 0x949: 0x0008, 0x94a: 0x0008, 0x94b: 0x0008, + 0x94c: 0x0008, 0x94d: 0x0008, 0x94e: 0x0008, 0x94f: 0x0008, 0x950: 0x0008, 0x951: 0x0008, + 0x952: 0x0008, 0x953: 0x0008, 0x954: 0x0008, 0x955: 0x0008, 0x956: 0x0008, 0x957: 0x0008, + 0x958: 0x0008, 0x959: 0x0008, 0x95a: 0x0008, 0x95b: 0x0008, 0x95c: 0x0008, 0x95d: 0x0008, + 0x95e: 0x0008, 0x95f: 0x0008, 0x960: 0x0008, 0x961: 0x0008, 0x962: 0x0008, 0x963: 0x0008, + 0x964: 0x0008, 0x965: 0x0008, 0x966: 0x0008, 0x967: 0x0008, 0x968: 0x0008, 0x969: 0x0008, + 0x96a: 0x0008, 0x96b: 0x0008, 0x96c: 0x0039, 0x96d: 0x0ed1, 0x96e: 0x0ee9, 0x96f: 0x0008, + 0x970: 0x0ef9, 0x971: 0x0f09, 0x972: 0x0f19, 0x973: 0x0f31, 0x974: 0x0249, 0x975: 0x0f41, + 0x976: 0x0259, 0x977: 0x0f51, 0x978: 0x0359, 0x979: 0x0f61, 0x97a: 0x0f71, 0x97b: 0x0008, + 0x97c: 0x00d9, 0x97d: 0x0f81, 0x97e: 0x0f99, 0x97f: 0x0269, + // Block 0x26, offset 0x980 + 0x980: 0x0fa9, 0x981: 0x0fb9, 0x982: 0x0279, 0x983: 0x0039, 0x984: 0x0fc9, 0x985: 0x0fe1, + 0x986: 0x059d, 0x987: 0x0ee9, 0x988: 0x0ef9, 0x989: 0x0f09, 0x98a: 0x0ff9, 0x98b: 0x1011, + 0x98c: 0x1029, 0x98d: 0x0f31, 0x98e: 0x0008, 0x98f: 0x0f51, 0x990: 0x0f61, 0x991: 0x1041, + 0x992: 0x00d9, 0x993: 0x1059, 0x994: 0x05b5, 0x995: 0x05b5, 0x996: 0x0f99, 0x997: 0x0fa9, + 0x998: 0x0fb9, 0x999: 0x059d, 0x99a: 0x1071, 0x99b: 0x1089, 0x99c: 0x05cd, 0x99d: 0x1099, + 0x99e: 0x10b1, 0x99f: 0x10c9, 0x9a0: 0x10e1, 0x9a1: 0x10f9, 0x9a2: 0x0f41, 0x9a3: 0x0269, + 0x9a4: 0x0fb9, 0x9a5: 0x1089, 0x9a6: 0x1099, 0x9a7: 0x10b1, 0x9a8: 0x1111, 0x9a9: 0x10e1, + 0x9aa: 0x10f9, 0x9ab: 0x0008, 0x9ac: 0x0008, 0x9ad: 0x0008, 0x9ae: 0x0008, 0x9af: 0x0008, + 0x9b0: 0x0008, 0x9b1: 0x0008, 0x9b2: 0x0008, 0x9b3: 0x0008, 0x9b4: 0x0008, 0x9b5: 0x0008, + 0x9b6: 0x0008, 0x9b7: 0x0008, 0x9b8: 0x1129, 0x9b9: 0x0008, 0x9ba: 0x0008, 0x9bb: 0x0008, + 0x9bc: 0x0008, 0x9bd: 0x0008, 0x9be: 0x0008, 0x9bf: 0x0008, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x0008, 0x9c1: 0x0008, 0x9c2: 0x0008, 0x9c3: 0x0008, 0x9c4: 0x0008, 0x9c5: 0x0008, + 0x9c6: 0x0008, 0x9c7: 0x0008, 0x9c8: 0x0008, 0x9c9: 0x0008, 0x9ca: 0x0008, 0x9cb: 0x0008, + 0x9cc: 0x0008, 0x9cd: 0x0008, 0x9ce: 0x0008, 0x9cf: 0x0008, 0x9d0: 0x0008, 0x9d1: 0x0008, + 0x9d2: 0x0008, 0x9d3: 0x0008, 0x9d4: 0x0008, 0x9d5: 0x0008, 0x9d6: 0x0008, 0x9d7: 0x0008, + 0x9d8: 0x0008, 0x9d9: 0x0008, 0x9da: 0x0008, 0x9db: 0x1141, 0x9dc: 0x1159, 0x9dd: 0x1169, + 0x9de: 0x1181, 0x9df: 0x1029, 0x9e0: 0x1199, 0x9e1: 0x11a9, 0x9e2: 0x11c1, 0x9e3: 0x11d9, + 0x9e4: 0x11f1, 0x9e5: 0x1209, 0x9e6: 0x1221, 0x9e7: 0x05e5, 0x9e8: 0x1239, 0x9e9: 0x1251, + 0x9ea: 0xe17d, 0x9eb: 0x1269, 0x9ec: 0x1281, 0x9ed: 0x1299, 0x9ee: 0x12b1, 0x9ef: 0x12c9, + 0x9f0: 0x12e1, 0x9f1: 0x12f9, 0x9f2: 0x1311, 0x9f3: 0x1329, 0x9f4: 0x1341, 0x9f5: 0x1359, + 0x9f6: 0x1371, 0x9f7: 0x1389, 0x9f8: 0x05fd, 0x9f9: 0x13a1, 0x9fa: 0x13b9, 0x9fb: 0x13d1, + 0x9fc: 0x13e1, 0x9fd: 0x13f9, 0x9fe: 0x1411, 0x9ff: 0x1429, + // Block 0x28, offset 0xa00 + 0xa00: 0xe00d, 0xa01: 0x0008, 0xa02: 0xe00d, 0xa03: 0x0008, 0xa04: 0xe00d, 0xa05: 0x0008, + 0xa06: 0xe00d, 0xa07: 0x0008, 0xa08: 0xe00d, 0xa09: 0x0008, 0xa0a: 0xe00d, 0xa0b: 0x0008, + 0xa0c: 0xe00d, 0xa0d: 0x0008, 0xa0e: 0xe00d, 0xa0f: 0x0008, 0xa10: 0xe00d, 0xa11: 0x0008, + 0xa12: 0xe00d, 0xa13: 0x0008, 0xa14: 0xe00d, 0xa15: 0x0008, 0xa16: 0xe00d, 0xa17: 0x0008, + 0xa18: 0xe00d, 0xa19: 0x0008, 0xa1a: 0xe00d, 0xa1b: 0x0008, 0xa1c: 0xe00d, 0xa1d: 0x0008, + 0xa1e: 0xe00d, 0xa1f: 0x0008, 0xa20: 0xe00d, 0xa21: 0x0008, 0xa22: 0xe00d, 0xa23: 0x0008, + 0xa24: 0xe00d, 0xa25: 0x0008, 0xa26: 0xe00d, 0xa27: 0x0008, 0xa28: 0xe00d, 0xa29: 0x0008, + 0xa2a: 0xe00d, 0xa2b: 0x0008, 0xa2c: 0xe00d, 0xa2d: 0x0008, 0xa2e: 0xe00d, 0xa2f: 0x0008, + 0xa30: 0xe00d, 0xa31: 0x0008, 0xa32: 0xe00d, 0xa33: 0x0008, 0xa34: 0xe00d, 0xa35: 0x0008, + 0xa36: 0xe00d, 0xa37: 0x0008, 0xa38: 0xe00d, 0xa39: 0x0008, 0xa3a: 0xe00d, 0xa3b: 0x0008, + 0xa3c: 0xe00d, 0xa3d: 0x0008, 0xa3e: 0xe00d, 0xa3f: 0x0008, + // Block 0x29, offset 0xa40 + 0xa40: 0xe00d, 0xa41: 0x0008, 0xa42: 0xe00d, 0xa43: 0x0008, 0xa44: 0xe00d, 0xa45: 0x0008, + 0xa46: 0xe00d, 0xa47: 0x0008, 0xa48: 0xe00d, 0xa49: 0x0008, 0xa4a: 0xe00d, 0xa4b: 0x0008, + 0xa4c: 0xe00d, 0xa4d: 0x0008, 0xa4e: 0xe00d, 0xa4f: 0x0008, 0xa50: 0xe00d, 0xa51: 0x0008, + 0xa52: 0xe00d, 0xa53: 0x0008, 0xa54: 0xe00d, 0xa55: 0x0008, 0xa56: 0x0008, 0xa57: 0x0008, + 0xa58: 0x0008, 0xa59: 0x0008, 0xa5a: 0x0615, 0xa5b: 0x0635, 0xa5c: 0x0008, 0xa5d: 0x0008, + 0xa5e: 0x1441, 0xa5f: 0x0008, 0xa60: 0xe00d, 0xa61: 0x0008, 0xa62: 0xe00d, 0xa63: 0x0008, + 0xa64: 0xe00d, 0xa65: 0x0008, 0xa66: 0xe00d, 0xa67: 0x0008, 0xa68: 0xe00d, 0xa69: 0x0008, + 0xa6a: 0xe00d, 0xa6b: 0x0008, 0xa6c: 0xe00d, 0xa6d: 0x0008, 0xa6e: 0xe00d, 0xa6f: 0x0008, + 0xa70: 0xe00d, 0xa71: 0x0008, 0xa72: 0xe00d, 0xa73: 0x0008, 0xa74: 0xe00d, 0xa75: 0x0008, + 0xa76: 0xe00d, 0xa77: 0x0008, 0xa78: 0xe00d, 0xa79: 0x0008, 0xa7a: 0xe00d, 0xa7b: 0x0008, + 0xa7c: 0xe00d, 0xa7d: 0x0008, 0xa7e: 0xe00d, 0xa7f: 0x0008, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0008, 0xa81: 0x0008, 0xa82: 0x0008, 0xa83: 0x0008, 0xa84: 0x0008, 0xa85: 0x0008, + 0xa86: 0x0040, 0xa87: 0x0040, 0xa88: 0xe045, 0xa89: 0xe045, 0xa8a: 0xe045, 0xa8b: 0xe045, + 0xa8c: 0xe045, 0xa8d: 0xe045, 0xa8e: 0x0040, 0xa8f: 0x0040, 0xa90: 0x0008, 0xa91: 0x0008, + 0xa92: 0x0008, 0xa93: 0x0008, 0xa94: 0x0008, 0xa95: 0x0008, 0xa96: 0x0008, 0xa97: 0x0008, + 0xa98: 0x0040, 0xa99: 0xe045, 0xa9a: 0x0040, 0xa9b: 0xe045, 0xa9c: 0x0040, 0xa9d: 0xe045, + 0xa9e: 0x0040, 0xa9f: 0xe045, 0xaa0: 0x0008, 0xaa1: 0x0008, 0xaa2: 0x0008, 0xaa3: 0x0008, + 0xaa4: 0x0008, 0xaa5: 0x0008, 0xaa6: 0x0008, 0xaa7: 0x0008, 0xaa8: 0xe045, 0xaa9: 0xe045, + 0xaaa: 0xe045, 0xaab: 0xe045, 0xaac: 0xe045, 0xaad: 0xe045, 0xaae: 0xe045, 0xaaf: 0xe045, + 0xab0: 0x0008, 0xab1: 0x1459, 0xab2: 0x0008, 0xab3: 0x1471, 0xab4: 0x0008, 0xab5: 0x1489, + 0xab6: 0x0008, 0xab7: 0x14a1, 0xab8: 0x0008, 0xab9: 0x14b9, 0xaba: 0x0008, 0xabb: 0x14d1, + 0xabc: 0x0008, 0xabd: 0x14e9, 0xabe: 0x0040, 0xabf: 0x0040, + // Block 0x2b, offset 0xac0 + 0xac0: 0x1501, 0xac1: 0x1531, 0xac2: 0x1561, 0xac3: 0x1591, 0xac4: 0x15c1, 0xac5: 0x15f1, + 0xac6: 0x1621, 0xac7: 0x1651, 0xac8: 0x1501, 0xac9: 0x1531, 0xaca: 0x1561, 0xacb: 0x1591, + 0xacc: 0x15c1, 0xacd: 0x15f1, 0xace: 0x1621, 0xacf: 0x1651, 0xad0: 0x1681, 0xad1: 0x16b1, + 0xad2: 0x16e1, 0xad3: 0x1711, 0xad4: 0x1741, 0xad5: 0x1771, 0xad6: 0x17a1, 0xad7: 0x17d1, + 0xad8: 0x1681, 0xad9: 0x16b1, 0xada: 0x16e1, 0xadb: 0x1711, 0xadc: 0x1741, 0xadd: 0x1771, + 0xade: 0x17a1, 0xadf: 0x17d1, 0xae0: 0x1801, 0xae1: 0x1831, 0xae2: 0x1861, 0xae3: 0x1891, + 0xae4: 0x18c1, 0xae5: 0x18f1, 0xae6: 0x1921, 0xae7: 0x1951, 0xae8: 0x1801, 0xae9: 0x1831, + 0xaea: 0x1861, 0xaeb: 0x1891, 0xaec: 0x18c1, 0xaed: 0x18f1, 0xaee: 0x1921, 0xaef: 0x1951, + 0xaf0: 0x0008, 0xaf1: 0x0008, 0xaf2: 0x1981, 0xaf3: 0x19b1, 0xaf4: 0x19d9, 0xaf5: 0x0040, + 0xaf6: 0x0008, 0xaf7: 0x1a01, 0xaf8: 0xe045, 0xaf9: 0xe045, 0xafa: 0x064d, 0xafb: 0x1459, + 0xafc: 0x19b1, 0xafd: 0x0666, 0xafe: 0x1a31, 0xaff: 0x0686, + // Block 0x2c, offset 0xb00 + 0xb00: 0x06a6, 0xb01: 0x1a4a, 0xb02: 0x1a79, 0xb03: 0x1aa9, 0xb04: 0x1ad1, 0xb05: 0x0040, + 0xb06: 0x0008, 0xb07: 0x1af9, 0xb08: 0x06c5, 0xb09: 0x1471, 0xb0a: 0x06dd, 0xb0b: 0x1489, + 0xb0c: 0x1aa9, 0xb0d: 0x1b2a, 0xb0e: 0x1b5a, 0xb0f: 0x1b8a, 0xb10: 0x0008, 0xb11: 0x0008, + 0xb12: 0x0008, 0xb13: 0x1bb9, 0xb14: 0x0040, 0xb15: 0x0040, 0xb16: 0x0008, 0xb17: 0x0008, + 0xb18: 0xe045, 0xb19: 0xe045, 0xb1a: 0x06f5, 0xb1b: 0x14a1, 0xb1c: 0x0040, 0xb1d: 0x1bd2, + 0xb1e: 0x1c02, 0xb1f: 0x1c32, 0xb20: 0x0008, 0xb21: 0x0008, 0xb22: 0x0008, 0xb23: 0x1c61, + 0xb24: 0x0008, 0xb25: 0x0008, 0xb26: 0x0008, 0xb27: 0x0008, 0xb28: 0xe045, 0xb29: 0xe045, + 0xb2a: 0x070d, 0xb2b: 0x14d1, 0xb2c: 0xe04d, 0xb2d: 0x1c7a, 0xb2e: 0x03d2, 0xb2f: 0x1caa, + 0xb30: 0x0040, 0xb31: 0x0040, 0xb32: 0x1cb9, 0xb33: 0x1ce9, 0xb34: 0x1d11, 0xb35: 0x0040, + 0xb36: 0x0008, 0xb37: 0x1d39, 0xb38: 0x0725, 0xb39: 0x14b9, 0xb3a: 0x0515, 0xb3b: 0x14e9, + 0xb3c: 0x1ce9, 0xb3d: 0x073e, 0xb3e: 0x075e, 0xb3f: 0x0040, + // Block 0x2d, offset 0xb40 + 0xb40: 0x000a, 0xb41: 0x000a, 0xb42: 0x000a, 0xb43: 0x000a, 0xb44: 0x000a, 0xb45: 0x000a, + 0xb46: 0x000a, 0xb47: 0x000a, 0xb48: 0x000a, 0xb49: 0x000a, 0xb4a: 0x000a, 0xb4b: 0x03c0, + 0xb4c: 0x0003, 0xb4d: 0x0003, 0xb4e: 0x0340, 0xb4f: 0x0340, 0xb50: 0x0018, 0xb51: 0xe00d, + 0xb52: 0x0018, 0xb53: 0x0018, 0xb54: 0x0018, 0xb55: 0x0018, 0xb56: 0x0018, 0xb57: 0x077e, + 0xb58: 0x0018, 0xb59: 0x0018, 0xb5a: 0x0018, 0xb5b: 0x0018, 0xb5c: 0x0018, 0xb5d: 0x0018, + 0xb5e: 0x0018, 0xb5f: 0x0018, 0xb60: 0x0018, 0xb61: 0x0018, 0xb62: 0x0018, 0xb63: 0x0018, + 0xb64: 0x0040, 0xb65: 0x0040, 0xb66: 0x0040, 0xb67: 0x0018, 0xb68: 0x0040, 0xb69: 0x0040, + 0xb6a: 0x0340, 0xb6b: 0x0340, 0xb6c: 0x0340, 0xb6d: 0x0340, 0xb6e: 0x0340, 0xb6f: 0x000a, + 0xb70: 0x0018, 0xb71: 0x0018, 0xb72: 0x0018, 0xb73: 0x1d69, 0xb74: 0x1da1, 0xb75: 0x0018, + 0xb76: 0x1df1, 0xb77: 0x1e29, 0xb78: 0x0018, 0xb79: 0x0018, 0xb7a: 0x0018, 0xb7b: 0x0018, + 0xb7c: 0x1e7a, 0xb7d: 0x0018, 0xb7e: 0x079e, 0xb7f: 0x0018, + // Block 0x2e, offset 0xb80 + 0xb80: 0x0018, 0xb81: 0x0018, 0xb82: 0x0018, 0xb83: 0x0018, 0xb84: 0x0018, 0xb85: 0x0018, + 0xb86: 0x0018, 0xb87: 0x1e92, 0xb88: 0x1eaa, 0xb89: 0x1ec2, 0xb8a: 0x0018, 0xb8b: 0x0018, + 0xb8c: 0x0018, 0xb8d: 0x0018, 0xb8e: 0x0018, 0xb8f: 0x0018, 0xb90: 0x0018, 0xb91: 0x0018, + 0xb92: 0x0018, 0xb93: 0x0018, 0xb94: 0x0018, 0xb95: 0x0018, 0xb96: 0x0018, 0xb97: 0x1ed9, + 0xb98: 0x0018, 0xb99: 0x0018, 0xb9a: 0x0018, 0xb9b: 0x0018, 0xb9c: 0x0018, 0xb9d: 0x0018, + 0xb9e: 0x0018, 0xb9f: 0x000a, 0xba0: 0x03c0, 0xba1: 0x0340, 0xba2: 0x0340, 0xba3: 0x0340, + 0xba4: 0x03c0, 0xba5: 0x0040, 0xba6: 0x0040, 0xba7: 0x0040, 0xba8: 0x0040, 0xba9: 0x0040, + 0xbaa: 0x0340, 0xbab: 0x0340, 0xbac: 0x0340, 0xbad: 0x0340, 0xbae: 0x0340, 0xbaf: 0x0340, + 0xbb0: 0x1f41, 0xbb1: 0x0f41, 0xbb2: 0x0040, 0xbb3: 0x0040, 0xbb4: 0x1f51, 0xbb5: 0x1f61, + 0xbb6: 0x1f71, 0xbb7: 0x1f81, 0xbb8: 0x1f91, 0xbb9: 0x1fa1, 0xbba: 0x1fb2, 0xbbb: 0x07bd, + 0xbbc: 0x1fc2, 0xbbd: 0x1fd2, 0xbbe: 0x1fe2, 0xbbf: 0x0f71, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x1f41, 0xbc1: 0x00c9, 0xbc2: 0x0069, 0xbc3: 0x0079, 0xbc4: 0x1f51, 0xbc5: 0x1f61, + 0xbc6: 0x1f71, 0xbc7: 0x1f81, 0xbc8: 0x1f91, 0xbc9: 0x1fa1, 0xbca: 0x1fb2, 0xbcb: 0x07d5, + 0xbcc: 0x1fc2, 0xbcd: 0x1fd2, 0xbce: 0x1fe2, 0xbcf: 0x0040, 0xbd0: 0x0039, 0xbd1: 0x0f09, + 0xbd2: 0x00d9, 0xbd3: 0x0369, 0xbd4: 0x0ff9, 0xbd5: 0x0249, 0xbd6: 0x0f51, 0xbd7: 0x0359, + 0xbd8: 0x0f61, 0xbd9: 0x0f71, 0xbda: 0x0f99, 0xbdb: 0x01d9, 0xbdc: 0x0fa9, 0xbdd: 0x0040, + 0xbde: 0x0040, 0xbdf: 0x0040, 0xbe0: 0x0018, 0xbe1: 0x0018, 0xbe2: 0x0018, 0xbe3: 0x0018, + 0xbe4: 0x0018, 0xbe5: 0x0018, 0xbe6: 0x0018, 0xbe7: 0x0018, 0xbe8: 0x1ff1, 0xbe9: 0x0018, + 0xbea: 0x0018, 0xbeb: 0x0018, 0xbec: 0x0018, 0xbed: 0x0018, 0xbee: 0x0018, 0xbef: 0x0018, + 0xbf0: 0x0018, 0xbf1: 0x0018, 0xbf2: 0x0018, 0xbf3: 0x0018, 0xbf4: 0x0018, 0xbf5: 0x0018, + 0xbf6: 0x0018, 0xbf7: 0x0018, 0xbf8: 0x0018, 0xbf9: 0x0018, 0xbfa: 0x0018, 0xbfb: 0x0018, + 0xbfc: 0x0018, 0xbfd: 0x0018, 0xbfe: 0x0018, 0xbff: 0x0040, + // Block 0x30, offset 0xc00 + 0xc00: 0x07ee, 0xc01: 0x080e, 0xc02: 0x1159, 0xc03: 0x082d, 0xc04: 0x0018, 0xc05: 0x084e, + 0xc06: 0x086e, 0xc07: 0x1011, 0xc08: 0x0018, 0xc09: 0x088d, 0xc0a: 0x0f31, 0xc0b: 0x0249, + 0xc0c: 0x0249, 0xc0d: 0x0249, 0xc0e: 0x0249, 0xc0f: 0x2009, 0xc10: 0x0f41, 0xc11: 0x0f41, + 0xc12: 0x0359, 0xc13: 0x0359, 0xc14: 0x0018, 0xc15: 0x0f71, 0xc16: 0x2021, 0xc17: 0x0018, + 0xc18: 0x0018, 0xc19: 0x0f99, 0xc1a: 0x2039, 0xc1b: 0x0269, 0xc1c: 0x0269, 0xc1d: 0x0269, + 0xc1e: 0x0018, 0xc1f: 0x0018, 0xc20: 0x2049, 0xc21: 0x08ad, 0xc22: 0x2061, 0xc23: 0x0018, + 0xc24: 0x13d1, 0xc25: 0x0018, 0xc26: 0x2079, 0xc27: 0x0018, 0xc28: 0x13d1, 0xc29: 0x0018, + 0xc2a: 0x0f51, 0xc2b: 0x2091, 0xc2c: 0x0ee9, 0xc2d: 0x1159, 0xc2e: 0x0018, 0xc2f: 0x0f09, + 0xc30: 0x0f09, 0xc31: 0x1199, 0xc32: 0x0040, 0xc33: 0x0f61, 0xc34: 0x00d9, 0xc35: 0x20a9, + 0xc36: 0x20c1, 0xc37: 0x20d9, 0xc38: 0x20f1, 0xc39: 0x0f41, 0xc3a: 0x0018, 0xc3b: 0x08cd, + 0xc3c: 0x2109, 0xc3d: 0x10b1, 0xc3e: 0x10b1, 0xc3f: 0x2109, + // Block 0x31, offset 0xc40 + 0xc40: 0x08ed, 0xc41: 0x0018, 0xc42: 0x0018, 0xc43: 0x0018, 0xc44: 0x0018, 0xc45: 0x0ef9, + 0xc46: 0x0ef9, 0xc47: 0x0f09, 0xc48: 0x0f41, 0xc49: 0x0259, 0xc4a: 0x0018, 0xc4b: 0x0018, + 0xc4c: 0x0018, 0xc4d: 0x0018, 0xc4e: 0x0008, 0xc4f: 0x0018, 0xc50: 0x2121, 0xc51: 0x2151, + 0xc52: 0x2181, 0xc53: 0x21b9, 0xc54: 0x21e9, 0xc55: 0x2219, 0xc56: 0x2249, 0xc57: 0x2279, + 0xc58: 0x22a9, 0xc59: 0x22d9, 0xc5a: 0x2309, 0xc5b: 0x2339, 0xc5c: 0x2369, 0xc5d: 0x2399, + 0xc5e: 0x23c9, 0xc5f: 0x23f9, 0xc60: 0x0f41, 0xc61: 0x2421, 0xc62: 0x0905, 0xc63: 0x2439, + 0xc64: 0x1089, 0xc65: 0x2451, 0xc66: 0x0925, 0xc67: 0x2469, 0xc68: 0x2491, 0xc69: 0x0369, + 0xc6a: 0x24a9, 0xc6b: 0x0945, 0xc6c: 0x0359, 0xc6d: 0x1159, 0xc6e: 0x0ef9, 0xc6f: 0x0f61, + 0xc70: 0x0f41, 0xc71: 0x2421, 0xc72: 0x0965, 0xc73: 0x2439, 0xc74: 0x1089, 0xc75: 0x2451, + 0xc76: 0x0985, 0xc77: 0x2469, 0xc78: 0x2491, 0xc79: 0x0369, 0xc7a: 0x24a9, 0xc7b: 0x09a5, + 0xc7c: 0x0359, 0xc7d: 0x1159, 0xc7e: 0x0ef9, 0xc7f: 0x0f61, + // Block 0x32, offset 0xc80 + 0xc80: 0x0018, 0xc81: 0x0018, 0xc82: 0x0018, 0xc83: 0x0018, 0xc84: 0x0018, 0xc85: 0x0018, + 0xc86: 0x0018, 0xc87: 0x0018, 0xc88: 0x0018, 0xc89: 0x0018, 0xc8a: 0x0018, 0xc8b: 0x0040, + 0xc8c: 0x0040, 0xc8d: 0x0040, 0xc8e: 0x0040, 0xc8f: 0x0040, 0xc90: 0x0040, 0xc91: 0x0040, + 0xc92: 0x0040, 0xc93: 0x0040, 0xc94: 0x0040, 0xc95: 0x0040, 0xc96: 0x0040, 0xc97: 0x0040, + 0xc98: 0x0040, 0xc99: 0x0040, 0xc9a: 0x0040, 0xc9b: 0x0040, 0xc9c: 0x0040, 0xc9d: 0x0040, + 0xc9e: 0x0040, 0xc9f: 0x0040, 0xca0: 0x00c9, 0xca1: 0x0069, 0xca2: 0x0079, 0xca3: 0x1f51, + 0xca4: 0x1f61, 0xca5: 0x1f71, 0xca6: 0x1f81, 0xca7: 0x1f91, 0xca8: 0x1fa1, 0xca9: 0x2601, + 0xcaa: 0x2619, 0xcab: 0x2631, 0xcac: 0x2649, 0xcad: 0x2661, 0xcae: 0x2679, 0xcaf: 0x2691, + 0xcb0: 0x26a9, 0xcb1: 0x26c1, 0xcb2: 0x26d9, 0xcb3: 0x26f1, 0xcb4: 0x0a06, 0xcb5: 0x0a26, + 0xcb6: 0x0a46, 0xcb7: 0x0a66, 0xcb8: 0x0a86, 0xcb9: 0x0aa6, 0xcba: 0x0ac6, 0xcbb: 0x0ae6, + 0xcbc: 0x0b06, 0xcbd: 0x270a, 0xcbe: 0x2732, 0xcbf: 0x275a, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x2782, 0xcc1: 0x27aa, 0xcc2: 0x27d2, 0xcc3: 0x27fa, 0xcc4: 0x2822, 0xcc5: 0x284a, + 0xcc6: 0x2872, 0xcc7: 0x289a, 0xcc8: 0x0040, 0xcc9: 0x0040, 0xcca: 0x0040, 0xccb: 0x0040, + 0xccc: 0x0040, 0xccd: 0x0040, 0xcce: 0x0040, 0xccf: 0x0040, 0xcd0: 0x0040, 0xcd1: 0x0040, + 0xcd2: 0x0040, 0xcd3: 0x0040, 0xcd4: 0x0040, 0xcd5: 0x0040, 0xcd6: 0x0040, 0xcd7: 0x0040, + 0xcd8: 0x0040, 0xcd9: 0x0040, 0xcda: 0x0040, 0xcdb: 0x0040, 0xcdc: 0x0b26, 0xcdd: 0x0b46, + 0xcde: 0x0b66, 0xcdf: 0x0b86, 0xce0: 0x0ba6, 0xce1: 0x0bc6, 0xce2: 0x0be6, 0xce3: 0x0c06, + 0xce4: 0x0c26, 0xce5: 0x0c46, 0xce6: 0x0c66, 0xce7: 0x0c86, 0xce8: 0x0ca6, 0xce9: 0x0cc6, + 0xcea: 0x0ce6, 0xceb: 0x0d06, 0xcec: 0x0d26, 0xced: 0x0d46, 0xcee: 0x0d66, 0xcef: 0x0d86, + 0xcf0: 0x0da6, 0xcf1: 0x0dc6, 0xcf2: 0x0de6, 0xcf3: 0x0e06, 0xcf4: 0x0e26, 0xcf5: 0x0e46, + 0xcf6: 0x0039, 0xcf7: 0x0ee9, 0xcf8: 0x1159, 0xcf9: 0x0ef9, 0xcfa: 0x0f09, 0xcfb: 0x1199, + 0xcfc: 0x0f31, 0xcfd: 0x0249, 0xcfe: 0x0f41, 0xcff: 0x0259, + // Block 0x34, offset 0xd00 + 0xd00: 0x0f51, 0xd01: 0x0359, 0xd02: 0x0f61, 0xd03: 0x0f71, 0xd04: 0x00d9, 0xd05: 0x0f99, + 0xd06: 0x2039, 0xd07: 0x0269, 0xd08: 0x01d9, 0xd09: 0x0fa9, 0xd0a: 0x0fb9, 0xd0b: 0x1089, + 0xd0c: 0x0279, 0xd0d: 0x0369, 0xd0e: 0x0289, 0xd0f: 0x13d1, 0xd10: 0x0039, 0xd11: 0x0ee9, + 0xd12: 0x1159, 0xd13: 0x0ef9, 0xd14: 0x0f09, 0xd15: 0x1199, 0xd16: 0x0f31, 0xd17: 0x0249, + 0xd18: 0x0f41, 0xd19: 0x0259, 0xd1a: 0x0f51, 0xd1b: 0x0359, 0xd1c: 0x0f61, 0xd1d: 0x0f71, + 0xd1e: 0x00d9, 0xd1f: 0x0f99, 0xd20: 0x2039, 0xd21: 0x0269, 0xd22: 0x01d9, 0xd23: 0x0fa9, + 0xd24: 0x0fb9, 0xd25: 0x1089, 0xd26: 0x0279, 0xd27: 0x0369, 0xd28: 0x0289, 0xd29: 0x13d1, + 0xd2a: 0x1f41, 0xd2b: 0x0018, 0xd2c: 0x0018, 0xd2d: 0x0018, 0xd2e: 0x0018, 0xd2f: 0x0018, + 0xd30: 0x0018, 0xd31: 0x0018, 0xd32: 0x0018, 0xd33: 0x0018, 0xd34: 0x0018, 0xd35: 0x0018, + 0xd36: 0x0018, 0xd37: 0x0018, 0xd38: 0x0018, 0xd39: 0x0018, 0xd3a: 0x0018, 0xd3b: 0x0018, + 0xd3c: 0x0018, 0xd3d: 0x0018, 0xd3e: 0x0018, 0xd3f: 0x0018, + // Block 0x35, offset 0xd40 + 0xd40: 0x0008, 0xd41: 0x0008, 0xd42: 0x0008, 0xd43: 0x0008, 0xd44: 0x0008, 0xd45: 0x0008, + 0xd46: 0x0008, 0xd47: 0x0008, 0xd48: 0x0008, 0xd49: 0x0008, 0xd4a: 0x0008, 0xd4b: 0x0008, + 0xd4c: 0x0008, 0xd4d: 0x0008, 0xd4e: 0x0008, 0xd4f: 0x0008, 0xd50: 0x0008, 0xd51: 0x0008, + 0xd52: 0x0008, 0xd53: 0x0008, 0xd54: 0x0008, 0xd55: 0x0008, 0xd56: 0x0008, 0xd57: 0x0008, + 0xd58: 0x0008, 0xd59: 0x0008, 0xd5a: 0x0008, 0xd5b: 0x0008, 0xd5c: 0x0008, 0xd5d: 0x0008, + 0xd5e: 0x0008, 0xd5f: 0x0040, 0xd60: 0xe00d, 0xd61: 0x0008, 0xd62: 0x2971, 0xd63: 0x0ebd, + 0xd64: 0x2989, 0xd65: 0x0008, 0xd66: 0x0008, 0xd67: 0xe07d, 0xd68: 0x0008, 0xd69: 0xe01d, + 0xd6a: 0x0008, 0xd6b: 0xe03d, 0xd6c: 0x0008, 0xd6d: 0x0fe1, 0xd6e: 0x1281, 0xd6f: 0x0fc9, + 0xd70: 0x1141, 0xd71: 0x0008, 0xd72: 0xe00d, 0xd73: 0x0008, 0xd74: 0x0008, 0xd75: 0xe01d, + 0xd76: 0x0008, 0xd77: 0x0008, 0xd78: 0x0008, 0xd79: 0x0008, 0xd7a: 0x0008, 0xd7b: 0x0008, + 0xd7c: 0x0259, 0xd7d: 0x1089, 0xd7e: 0x29a1, 0xd7f: 0x29b9, + // Block 0x36, offset 0xd80 + 0xd80: 0xe00d, 0xd81: 0x0008, 0xd82: 0xe00d, 0xd83: 0x0008, 0xd84: 0xe00d, 0xd85: 0x0008, + 0xd86: 0xe00d, 0xd87: 0x0008, 0xd88: 0xe00d, 0xd89: 0x0008, 0xd8a: 0xe00d, 0xd8b: 0x0008, + 0xd8c: 0xe00d, 0xd8d: 0x0008, 0xd8e: 0xe00d, 0xd8f: 0x0008, 0xd90: 0xe00d, 0xd91: 0x0008, + 0xd92: 0xe00d, 0xd93: 0x0008, 0xd94: 0xe00d, 0xd95: 0x0008, 0xd96: 0xe00d, 0xd97: 0x0008, + 0xd98: 0xe00d, 0xd99: 0x0008, 0xd9a: 0xe00d, 0xd9b: 0x0008, 0xd9c: 0xe00d, 0xd9d: 0x0008, + 0xd9e: 0xe00d, 0xd9f: 0x0008, 0xda0: 0xe00d, 0xda1: 0x0008, 0xda2: 0xe00d, 0xda3: 0x0008, + 0xda4: 0x0008, 0xda5: 0x0018, 0xda6: 0x0018, 0xda7: 0x0018, 0xda8: 0x0018, 0xda9: 0x0018, + 0xdaa: 0x0018, 0xdab: 0xe03d, 0xdac: 0x0008, 0xdad: 0xe01d, 0xdae: 0x0008, 0xdaf: 0x1308, + 0xdb0: 0x1308, 0xdb1: 0x1308, 0xdb2: 0xe00d, 0xdb3: 0x0008, 0xdb4: 0x0040, 0xdb5: 0x0040, + 0xdb6: 0x0040, 0xdb7: 0x0040, 0xdb8: 0x0040, 0xdb9: 0x0018, 0xdba: 0x0018, 0xdbb: 0x0018, + 0xdbc: 0x0018, 0xdbd: 0x0018, 0xdbe: 0x0018, 0xdbf: 0x0018, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x26fd, 0xdc1: 0x271d, 0xdc2: 0x273d, 0xdc3: 0x275d, 0xdc4: 0x277d, 0xdc5: 0x279d, + 0xdc6: 0x27bd, 0xdc7: 0x27dd, 0xdc8: 0x27fd, 0xdc9: 0x281d, 0xdca: 0x283d, 0xdcb: 0x285d, + 0xdcc: 0x287d, 0xdcd: 0x289d, 0xdce: 0x28bd, 0xdcf: 0x28dd, 0xdd0: 0x28fd, 0xdd1: 0x291d, + 0xdd2: 0x293d, 0xdd3: 0x295d, 0xdd4: 0x297d, 0xdd5: 0x299d, 0xdd6: 0x0040, 0xdd7: 0x0040, + 0xdd8: 0x0040, 0xdd9: 0x0040, 0xdda: 0x0040, 0xddb: 0x0040, 0xddc: 0x0040, 0xddd: 0x0040, + 0xdde: 0x0040, 0xddf: 0x0040, 0xde0: 0x0040, 0xde1: 0x0040, 0xde2: 0x0040, 0xde3: 0x0040, + 0xde4: 0x0040, 0xde5: 0x0040, 0xde6: 0x0040, 0xde7: 0x0040, 0xde8: 0x0040, 0xde9: 0x0040, + 0xdea: 0x0040, 0xdeb: 0x0040, 0xdec: 0x0040, 0xded: 0x0040, 0xdee: 0x0040, 0xdef: 0x0040, + 0xdf0: 0x0040, 0xdf1: 0x0040, 0xdf2: 0x0040, 0xdf3: 0x0040, 0xdf4: 0x0040, 0xdf5: 0x0040, + 0xdf6: 0x0040, 0xdf7: 0x0040, 0xdf8: 0x0040, 0xdf9: 0x0040, 0xdfa: 0x0040, 0xdfb: 0x0040, + 0xdfc: 0x0040, 0xdfd: 0x0040, 0xdfe: 0x0040, 0xdff: 0x0040, + // Block 0x38, offset 0xe00 + 0xe00: 0x000a, 0xe01: 0x0018, 0xe02: 0x29d1, 0xe03: 0x0018, 0xe04: 0x0018, 0xe05: 0x0008, + 0xe06: 0x0008, 0xe07: 0x0008, 0xe08: 0x0018, 0xe09: 0x0018, 0xe0a: 0x0018, 0xe0b: 0x0018, + 0xe0c: 0x0018, 0xe0d: 0x0018, 0xe0e: 0x0018, 0xe0f: 0x0018, 0xe10: 0x0018, 0xe11: 0x0018, + 0xe12: 0x0018, 0xe13: 0x0018, 0xe14: 0x0018, 0xe15: 0x0018, 0xe16: 0x0018, 0xe17: 0x0018, + 0xe18: 0x0018, 0xe19: 0x0018, 0xe1a: 0x0018, 0xe1b: 0x0018, 0xe1c: 0x0018, 0xe1d: 0x0018, + 0xe1e: 0x0018, 0xe1f: 0x0018, 0xe20: 0x0018, 0xe21: 0x0018, 0xe22: 0x0018, 0xe23: 0x0018, + 0xe24: 0x0018, 0xe25: 0x0018, 0xe26: 0x0018, 0xe27: 0x0018, 0xe28: 0x0018, 0xe29: 0x0018, + 0xe2a: 0x1308, 0xe2b: 0x1308, 0xe2c: 0x1308, 0xe2d: 0x1308, 0xe2e: 0x1018, 0xe2f: 0x1018, + 0xe30: 0x0018, 0xe31: 0x0018, 0xe32: 0x0018, 0xe33: 0x0018, 0xe34: 0x0018, 0xe35: 0x0018, + 0xe36: 0xe125, 0xe37: 0x0018, 0xe38: 0x29bd, 0xe39: 0x29dd, 0xe3a: 0x29fd, 0xe3b: 0x0018, + 0xe3c: 0x0008, 0xe3d: 0x0018, 0xe3e: 0x0018, 0xe3f: 0x0018, + // Block 0x39, offset 0xe40 + 0xe40: 0x2b3d, 0xe41: 0x2b5d, 0xe42: 0x2b7d, 0xe43: 0x2b9d, 0xe44: 0x2bbd, 0xe45: 0x2bdd, + 0xe46: 0x2bdd, 0xe47: 0x2bdd, 0xe48: 0x2bfd, 0xe49: 0x2bfd, 0xe4a: 0x2bfd, 0xe4b: 0x2bfd, + 0xe4c: 0x2c1d, 0xe4d: 0x2c1d, 0xe4e: 0x2c1d, 0xe4f: 0x2c3d, 0xe50: 0x2c5d, 0xe51: 0x2c5d, + 0xe52: 0x2a7d, 0xe53: 0x2a7d, 0xe54: 0x2c5d, 0xe55: 0x2c5d, 0xe56: 0x2c7d, 0xe57: 0x2c7d, + 0xe58: 0x2c5d, 0xe59: 0x2c5d, 0xe5a: 0x2a7d, 0xe5b: 0x2a7d, 0xe5c: 0x2c5d, 0xe5d: 0x2c5d, + 0xe5e: 0x2c3d, 0xe5f: 0x2c3d, 0xe60: 0x2c9d, 0xe61: 0x2c9d, 0xe62: 0x2cbd, 0xe63: 0x2cbd, + 0xe64: 0x0040, 0xe65: 0x2cdd, 0xe66: 0x2cfd, 0xe67: 0x2d1d, 0xe68: 0x2d1d, 0xe69: 0x2d3d, + 0xe6a: 0x2d5d, 0xe6b: 0x2d7d, 0xe6c: 0x2d9d, 0xe6d: 0x2dbd, 0xe6e: 0x2ddd, 0xe6f: 0x2dfd, + 0xe70: 0x2e1d, 0xe71: 0x2e3d, 0xe72: 0x2e3d, 0xe73: 0x2e5d, 0xe74: 0x2e7d, 0xe75: 0x2e7d, + 0xe76: 0x2e9d, 0xe77: 0x2ebd, 0xe78: 0x2e5d, 0xe79: 0x2edd, 0xe7a: 0x2efd, 0xe7b: 0x2edd, + 0xe7c: 0x2e5d, 0xe7d: 0x2f1d, 0xe7e: 0x2f3d, 0xe7f: 0x2f5d, + // Block 0x3a, offset 0xe80 + 0xe80: 0x2f7d, 0xe81: 0x2f9d, 0xe82: 0x2cfd, 0xe83: 0x2cdd, 0xe84: 0x2fbd, 0xe85: 0x2fdd, + 0xe86: 0x2ffd, 0xe87: 0x301d, 0xe88: 0x303d, 0xe89: 0x305d, 0xe8a: 0x307d, 0xe8b: 0x309d, + 0xe8c: 0x30bd, 0xe8d: 0x30dd, 0xe8e: 0x30fd, 0xe8f: 0x0040, 0xe90: 0x0018, 0xe91: 0x0018, + 0xe92: 0x311d, 0xe93: 0x313d, 0xe94: 0x315d, 0xe95: 0x317d, 0xe96: 0x319d, 0xe97: 0x31bd, + 0xe98: 0x31dd, 0xe99: 0x31fd, 0xe9a: 0x321d, 0xe9b: 0x323d, 0xe9c: 0x315d, 0xe9d: 0x325d, + 0xe9e: 0x327d, 0xe9f: 0x329d, 0xea0: 0x0008, 0xea1: 0x0008, 0xea2: 0x0008, 0xea3: 0x0008, + 0xea4: 0x0008, 0xea5: 0x0008, 0xea6: 0x0008, 0xea7: 0x0008, 0xea8: 0x0008, 0xea9: 0x0008, + 0xeaa: 0x0008, 0xeab: 0x0008, 0xeac: 0x0008, 0xead: 0x0008, 0xeae: 0x0008, 0xeaf: 0x0008, + 0xeb0: 0x0008, 0xeb1: 0x0008, 0xeb2: 0x0008, 0xeb3: 0x0008, 0xeb4: 0x0008, 0xeb5: 0x0008, + 0xeb6: 0x0008, 0xeb7: 0x0008, 0xeb8: 0x0008, 0xeb9: 0x0008, 0xeba: 0x0008, 0xebb: 0x0040, + 0xebc: 0x0040, 0xebd: 0x0040, 0xebe: 0x0040, 0xebf: 0x0040, + // Block 0x3b, offset 0xec0 + 0xec0: 0x36a2, 0xec1: 0x36d2, 0xec2: 0x3702, 0xec3: 0x3732, 0xec4: 0x32bd, 0xec5: 0x32dd, + 0xec6: 0x32fd, 0xec7: 0x331d, 0xec8: 0x0018, 0xec9: 0x0018, 0xeca: 0x0018, 0xecb: 0x0018, + 0xecc: 0x0018, 0xecd: 0x0018, 0xece: 0x0018, 0xecf: 0x0018, 0xed0: 0x333d, 0xed1: 0x3761, + 0xed2: 0x3779, 0xed3: 0x3791, 0xed4: 0x37a9, 0xed5: 0x37c1, 0xed6: 0x37d9, 0xed7: 0x37f1, + 0xed8: 0x3809, 0xed9: 0x3821, 0xeda: 0x3839, 0xedb: 0x3851, 0xedc: 0x3869, 0xedd: 0x3881, + 0xede: 0x3899, 0xedf: 0x38b1, 0xee0: 0x335d, 0xee1: 0x337d, 0xee2: 0x339d, 0xee3: 0x33bd, + 0xee4: 0x33dd, 0xee5: 0x33dd, 0xee6: 0x33fd, 0xee7: 0x341d, 0xee8: 0x343d, 0xee9: 0x345d, + 0xeea: 0x347d, 0xeeb: 0x349d, 0xeec: 0x34bd, 0xeed: 0x34dd, 0xeee: 0x34fd, 0xeef: 0x351d, + 0xef0: 0x353d, 0xef1: 0x355d, 0xef2: 0x357d, 0xef3: 0x359d, 0xef4: 0x35bd, 0xef5: 0x35dd, + 0xef6: 0x35fd, 0xef7: 0x361d, 0xef8: 0x363d, 0xef9: 0x365d, 0xefa: 0x367d, 0xefb: 0x369d, + 0xefc: 0x38c9, 0xefd: 0x3901, 0xefe: 0x36bd, 0xeff: 0x0018, + // Block 0x3c, offset 0xf00 + 0xf00: 0x36dd, 0xf01: 0x36fd, 0xf02: 0x371d, 0xf03: 0x373d, 0xf04: 0x375d, 0xf05: 0x377d, + 0xf06: 0x379d, 0xf07: 0x37bd, 0xf08: 0x37dd, 0xf09: 0x37fd, 0xf0a: 0x381d, 0xf0b: 0x383d, + 0xf0c: 0x385d, 0xf0d: 0x387d, 0xf0e: 0x389d, 0xf0f: 0x38bd, 0xf10: 0x38dd, 0xf11: 0x38fd, + 0xf12: 0x391d, 0xf13: 0x393d, 0xf14: 0x395d, 0xf15: 0x397d, 0xf16: 0x399d, 0xf17: 0x39bd, + 0xf18: 0x39dd, 0xf19: 0x39fd, 0xf1a: 0x3a1d, 0xf1b: 0x3a3d, 0xf1c: 0x3a5d, 0xf1d: 0x3a7d, + 0xf1e: 0x3a9d, 0xf1f: 0x3abd, 0xf20: 0x3add, 0xf21: 0x3afd, 0xf22: 0x3b1d, 0xf23: 0x3b3d, + 0xf24: 0x3b5d, 0xf25: 0x3b7d, 0xf26: 0x127d, 0xf27: 0x3b9d, 0xf28: 0x3bbd, 0xf29: 0x3bdd, + 0xf2a: 0x3bfd, 0xf2b: 0x3c1d, 0xf2c: 0x3c3d, 0xf2d: 0x3c5d, 0xf2e: 0x239d, 0xf2f: 0x3c7d, + 0xf30: 0x3c9d, 0xf31: 0x3939, 0xf32: 0x3951, 0xf33: 0x3969, 0xf34: 0x3981, 0xf35: 0x3999, + 0xf36: 0x39b1, 0xf37: 0x39c9, 0xf38: 0x39e1, 0xf39: 0x39f9, 0xf3a: 0x3a11, 0xf3b: 0x3a29, + 0xf3c: 0x3a41, 0xf3d: 0x3a59, 0xf3e: 0x3a71, 0xf3f: 0x3a89, + // Block 0x3d, offset 0xf40 + 0xf40: 0x3aa1, 0xf41: 0x3ac9, 0xf42: 0x3af1, 0xf43: 0x3b19, 0xf44: 0x3b41, 0xf45: 0x3b69, + 0xf46: 0x3b91, 0xf47: 0x3bb9, 0xf48: 0x3be1, 0xf49: 0x3c09, 0xf4a: 0x3c39, 0xf4b: 0x3c69, + 0xf4c: 0x3c99, 0xf4d: 0x3cbd, 0xf4e: 0x3cb1, 0xf4f: 0x3cdd, 0xf50: 0x3cfd, 0xf51: 0x3d15, + 0xf52: 0x3d2d, 0xf53: 0x3d45, 0xf54: 0x3d5d, 0xf55: 0x3d5d, 0xf56: 0x3d45, 0xf57: 0x3d75, + 0xf58: 0x07bd, 0xf59: 0x3d8d, 0xf5a: 0x3da5, 0xf5b: 0x3dbd, 0xf5c: 0x3dd5, 0xf5d: 0x3ded, + 0xf5e: 0x3e05, 0xf5f: 0x3e1d, 0xf60: 0x3e35, 0xf61: 0x3e4d, 0xf62: 0x3e65, 0xf63: 0x3e7d, + 0xf64: 0x3e95, 0xf65: 0x3e95, 0xf66: 0x3ead, 0xf67: 0x3ead, 0xf68: 0x3ec5, 0xf69: 0x3ec5, + 0xf6a: 0x3edd, 0xf6b: 0x3ef5, 0xf6c: 0x3f0d, 0xf6d: 0x3f25, 0xf6e: 0x3f3d, 0xf6f: 0x3f3d, + 0xf70: 0x3f55, 0xf71: 0x3f55, 0xf72: 0x3f55, 0xf73: 0x3f6d, 0xf74: 0x3f85, 0xf75: 0x3f9d, + 0xf76: 0x3fb5, 0xf77: 0x3f9d, 0xf78: 0x3fcd, 0xf79: 0x3fe5, 0xf7a: 0x3f6d, 0xf7b: 0x3ffd, + 0xf7c: 0x4015, 0xf7d: 0x4015, 0xf7e: 0x4015, 0xf7f: 0x0040, + // Block 0x3e, offset 0xf80 + 0xf80: 0x3cc9, 0xf81: 0x3d31, 0xf82: 0x3d99, 0xf83: 0x3e01, 0xf84: 0x3e51, 0xf85: 0x3eb9, + 0xf86: 0x3f09, 0xf87: 0x3f59, 0xf88: 0x3fd9, 0xf89: 0x4041, 0xf8a: 0x4091, 0xf8b: 0x40e1, + 0xf8c: 0x4131, 0xf8d: 0x4199, 0xf8e: 0x4201, 0xf8f: 0x4251, 0xf90: 0x42a1, 0xf91: 0x42d9, + 0xf92: 0x4329, 0xf93: 0x4391, 0xf94: 0x43f9, 0xf95: 0x4431, 0xf96: 0x44b1, 0xf97: 0x4549, + 0xf98: 0x45c9, 0xf99: 0x4619, 0xf9a: 0x4699, 0xf9b: 0x4719, 0xf9c: 0x4781, 0xf9d: 0x47d1, + 0xf9e: 0x4821, 0xf9f: 0x4871, 0xfa0: 0x48d9, 0xfa1: 0x4959, 0xfa2: 0x49c1, 0xfa3: 0x4a11, + 0xfa4: 0x4a61, 0xfa5: 0x4ab1, 0xfa6: 0x4ae9, 0xfa7: 0x4b21, 0xfa8: 0x4b59, 0xfa9: 0x4b91, + 0xfaa: 0x4be1, 0xfab: 0x4c31, 0xfac: 0x4cb1, 0xfad: 0x4d01, 0xfae: 0x4d69, 0xfaf: 0x4de9, + 0xfb0: 0x4e39, 0xfb1: 0x4e71, 0xfb2: 0x4ea9, 0xfb3: 0x4f29, 0xfb4: 0x4f91, 0xfb5: 0x5011, + 0xfb6: 0x5061, 0xfb7: 0x50e1, 0xfb8: 0x5119, 0xfb9: 0x5169, 0xfba: 0x51b9, 0xfbb: 0x5209, + 0xfbc: 0x5259, 0xfbd: 0x52a9, 0xfbe: 0x5311, 0xfbf: 0x5361, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x5399, 0xfc1: 0x53e9, 0xfc2: 0x5439, 0xfc3: 0x5489, 0xfc4: 0x54f1, 0xfc5: 0x5541, + 0xfc6: 0x5591, 0xfc7: 0x55e1, 0xfc8: 0x5661, 0xfc9: 0x56c9, 0xfca: 0x5701, 0xfcb: 0x5781, + 0xfcc: 0x57b9, 0xfcd: 0x5821, 0xfce: 0x5889, 0xfcf: 0x58d9, 0xfd0: 0x5929, 0xfd1: 0x5979, + 0xfd2: 0x59e1, 0xfd3: 0x5a19, 0xfd4: 0x5a69, 0xfd5: 0x5ad1, 0xfd6: 0x5b09, 0xfd7: 0x5b89, + 0xfd8: 0x5bd9, 0xfd9: 0x5c01, 0xfda: 0x5c29, 0xfdb: 0x5c51, 0xfdc: 0x5c79, 0xfdd: 0x5ca1, + 0xfde: 0x5cc9, 0xfdf: 0x5cf1, 0xfe0: 0x5d19, 0xfe1: 0x5d41, 0xfe2: 0x5d69, 0xfe3: 0x5d99, + 0xfe4: 0x5dc9, 0xfe5: 0x5df9, 0xfe6: 0x5e29, 0xfe7: 0x5e59, 0xfe8: 0x5e89, 0xfe9: 0x5eb9, + 0xfea: 0x5ee9, 0xfeb: 0x5f19, 0xfec: 0x5f49, 0xfed: 0x5f79, 0xfee: 0x5fa9, 0xfef: 0x5fd9, + 0xff0: 0x6009, 0xff1: 0x402d, 0xff2: 0x6039, 0xff3: 0x6051, 0xff4: 0x404d, 0xff5: 0x6069, + 0xff6: 0x6081, 0xff7: 0x6099, 0xff8: 0x406d, 0xff9: 0x406d, 0xffa: 0x60b1, 0xffb: 0x60c9, + 0xffc: 0x6101, 0xffd: 0x6139, 0xffe: 0x6171, 0xfff: 0x61a9, + // Block 0x40, offset 0x1000 + 0x1000: 0x6211, 0x1001: 0x6229, 0x1002: 0x408d, 0x1003: 0x6241, 0x1004: 0x6259, 0x1005: 0x6271, + 0x1006: 0x6289, 0x1007: 0x62a1, 0x1008: 0x40ad, 0x1009: 0x62b9, 0x100a: 0x62e1, 0x100b: 0x62f9, + 0x100c: 0x40cd, 0x100d: 0x40cd, 0x100e: 0x6311, 0x100f: 0x6329, 0x1010: 0x6341, 0x1011: 0x40ed, + 0x1012: 0x410d, 0x1013: 0x412d, 0x1014: 0x414d, 0x1015: 0x416d, 0x1016: 0x6359, 0x1017: 0x6371, + 0x1018: 0x6389, 0x1019: 0x63a1, 0x101a: 0x63b9, 0x101b: 0x418d, 0x101c: 0x63d1, 0x101d: 0x63e9, + 0x101e: 0x6401, 0x101f: 0x41ad, 0x1020: 0x41cd, 0x1021: 0x6419, 0x1022: 0x41ed, 0x1023: 0x420d, + 0x1024: 0x422d, 0x1025: 0x6431, 0x1026: 0x424d, 0x1027: 0x6449, 0x1028: 0x6479, 0x1029: 0x6211, + 0x102a: 0x426d, 0x102b: 0x428d, 0x102c: 0x42ad, 0x102d: 0x42cd, 0x102e: 0x64b1, 0x102f: 0x64f1, + 0x1030: 0x6539, 0x1031: 0x6551, 0x1032: 0x42ed, 0x1033: 0x6569, 0x1034: 0x6581, 0x1035: 0x6599, + 0x1036: 0x430d, 0x1037: 0x65b1, 0x1038: 0x65c9, 0x1039: 0x65b1, 0x103a: 0x65e1, 0x103b: 0x65f9, + 0x103c: 0x432d, 0x103d: 0x6611, 0x103e: 0x6629, 0x103f: 0x6611, + // Block 0x41, offset 0x1040 + 0x1040: 0x434d, 0x1041: 0x436d, 0x1042: 0x0040, 0x1043: 0x6641, 0x1044: 0x6659, 0x1045: 0x6671, + 0x1046: 0x6689, 0x1047: 0x0040, 0x1048: 0x66c1, 0x1049: 0x66d9, 0x104a: 0x66f1, 0x104b: 0x6709, + 0x104c: 0x6721, 0x104d: 0x6739, 0x104e: 0x6401, 0x104f: 0x6751, 0x1050: 0x6769, 0x1051: 0x6781, + 0x1052: 0x438d, 0x1053: 0x6799, 0x1054: 0x6289, 0x1055: 0x43ad, 0x1056: 0x43cd, 0x1057: 0x67b1, + 0x1058: 0x0040, 0x1059: 0x43ed, 0x105a: 0x67c9, 0x105b: 0x67e1, 0x105c: 0x67f9, 0x105d: 0x6811, + 0x105e: 0x6829, 0x105f: 0x6859, 0x1060: 0x6889, 0x1061: 0x68b1, 0x1062: 0x68d9, 0x1063: 0x6901, + 0x1064: 0x6929, 0x1065: 0x6951, 0x1066: 0x6979, 0x1067: 0x69a1, 0x1068: 0x69c9, 0x1069: 0x69f1, + 0x106a: 0x6a21, 0x106b: 0x6a51, 0x106c: 0x6a81, 0x106d: 0x6ab1, 0x106e: 0x6ae1, 0x106f: 0x6b11, + 0x1070: 0x6b41, 0x1071: 0x6b71, 0x1072: 0x6ba1, 0x1073: 0x6bd1, 0x1074: 0x6c01, 0x1075: 0x6c31, + 0x1076: 0x6c61, 0x1077: 0x6c91, 0x1078: 0x6cc1, 0x1079: 0x6cf1, 0x107a: 0x6d21, 0x107b: 0x6d51, + 0x107c: 0x6d81, 0x107d: 0x6db1, 0x107e: 0x6de1, 0x107f: 0x440d, + // Block 0x42, offset 0x1080 + 0x1080: 0xe00d, 0x1081: 0x0008, 0x1082: 0xe00d, 0x1083: 0x0008, 0x1084: 0xe00d, 0x1085: 0x0008, + 0x1086: 0xe00d, 0x1087: 0x0008, 0x1088: 0xe00d, 0x1089: 0x0008, 0x108a: 0xe00d, 0x108b: 0x0008, + 0x108c: 0xe00d, 0x108d: 0x0008, 0x108e: 0xe00d, 0x108f: 0x0008, 0x1090: 0xe00d, 0x1091: 0x0008, + 0x1092: 0xe00d, 0x1093: 0x0008, 0x1094: 0xe00d, 0x1095: 0x0008, 0x1096: 0xe00d, 0x1097: 0x0008, + 0x1098: 0xe00d, 0x1099: 0x0008, 0x109a: 0xe00d, 0x109b: 0x0008, 0x109c: 0xe00d, 0x109d: 0x0008, + 0x109e: 0xe00d, 0x109f: 0x0008, 0x10a0: 0xe00d, 0x10a1: 0x0008, 0x10a2: 0xe00d, 0x10a3: 0x0008, + 0x10a4: 0xe00d, 0x10a5: 0x0008, 0x10a6: 0xe00d, 0x10a7: 0x0008, 0x10a8: 0xe00d, 0x10a9: 0x0008, + 0x10aa: 0xe00d, 0x10ab: 0x0008, 0x10ac: 0xe00d, 0x10ad: 0x0008, 0x10ae: 0x0008, 0x10af: 0x1308, + 0x10b0: 0x1318, 0x10b1: 0x1318, 0x10b2: 0x1318, 0x10b3: 0x0018, 0x10b4: 0x1308, 0x10b5: 0x1308, + 0x10b6: 0x1308, 0x10b7: 0x1308, 0x10b8: 0x1308, 0x10b9: 0x1308, 0x10ba: 0x1308, 0x10bb: 0x1308, + 0x10bc: 0x1308, 0x10bd: 0x1308, 0x10be: 0x0018, 0x10bf: 0x0008, + // Block 0x43, offset 0x10c0 + 0x10c0: 0xe00d, 0x10c1: 0x0008, 0x10c2: 0xe00d, 0x10c3: 0x0008, 0x10c4: 0xe00d, 0x10c5: 0x0008, + 0x10c6: 0xe00d, 0x10c7: 0x0008, 0x10c8: 0xe00d, 0x10c9: 0x0008, 0x10ca: 0xe00d, 0x10cb: 0x0008, + 0x10cc: 0xe00d, 0x10cd: 0x0008, 0x10ce: 0xe00d, 0x10cf: 0x0008, 0x10d0: 0xe00d, 0x10d1: 0x0008, + 0x10d2: 0xe00d, 0x10d3: 0x0008, 0x10d4: 0xe00d, 0x10d5: 0x0008, 0x10d6: 0xe00d, 0x10d7: 0x0008, + 0x10d8: 0xe00d, 0x10d9: 0x0008, 0x10da: 0xe00d, 0x10db: 0x0008, 0x10dc: 0x0ea1, 0x10dd: 0x6e11, + 0x10de: 0x1308, 0x10df: 0x1308, 0x10e0: 0x0008, 0x10e1: 0x0008, 0x10e2: 0x0008, 0x10e3: 0x0008, + 0x10e4: 0x0008, 0x10e5: 0x0008, 0x10e6: 0x0008, 0x10e7: 0x0008, 0x10e8: 0x0008, 0x10e9: 0x0008, + 0x10ea: 0x0008, 0x10eb: 0x0008, 0x10ec: 0x0008, 0x10ed: 0x0008, 0x10ee: 0x0008, 0x10ef: 0x0008, + 0x10f0: 0x0008, 0x10f1: 0x0008, 0x10f2: 0x0008, 0x10f3: 0x0008, 0x10f4: 0x0008, 0x10f5: 0x0008, + 0x10f6: 0x0008, 0x10f7: 0x0008, 0x10f8: 0x0008, 0x10f9: 0x0008, 0x10fa: 0x0008, 0x10fb: 0x0008, + 0x10fc: 0x0008, 0x10fd: 0x0008, 0x10fe: 0x0008, 0x10ff: 0x0008, + // Block 0x44, offset 0x1100 + 0x1100: 0x0018, 0x1101: 0x0018, 0x1102: 0x0018, 0x1103: 0x0018, 0x1104: 0x0018, 0x1105: 0x0018, + 0x1106: 0x0018, 0x1107: 0x0018, 0x1108: 0x0018, 0x1109: 0x0018, 0x110a: 0x0018, 0x110b: 0x0018, + 0x110c: 0x0018, 0x110d: 0x0018, 0x110e: 0x0018, 0x110f: 0x0018, 0x1110: 0x0018, 0x1111: 0x0018, + 0x1112: 0x0018, 0x1113: 0x0018, 0x1114: 0x0018, 0x1115: 0x0018, 0x1116: 0x0018, 0x1117: 0x0008, + 0x1118: 0x0008, 0x1119: 0x0008, 0x111a: 0x0008, 0x111b: 0x0008, 0x111c: 0x0008, 0x111d: 0x0008, + 0x111e: 0x0008, 0x111f: 0x0008, 0x1120: 0x0018, 0x1121: 0x0018, 0x1122: 0xe00d, 0x1123: 0x0008, + 0x1124: 0xe00d, 0x1125: 0x0008, 0x1126: 0xe00d, 0x1127: 0x0008, 0x1128: 0xe00d, 0x1129: 0x0008, + 0x112a: 0xe00d, 0x112b: 0x0008, 0x112c: 0xe00d, 0x112d: 0x0008, 0x112e: 0xe00d, 0x112f: 0x0008, + 0x1130: 0x0008, 0x1131: 0x0008, 0x1132: 0xe00d, 0x1133: 0x0008, 0x1134: 0xe00d, 0x1135: 0x0008, + 0x1136: 0xe00d, 0x1137: 0x0008, 0x1138: 0xe00d, 0x1139: 0x0008, 0x113a: 0xe00d, 0x113b: 0x0008, + 0x113c: 0xe00d, 0x113d: 0x0008, 0x113e: 0xe00d, 0x113f: 0x0008, + // Block 0x45, offset 0x1140 + 0x1140: 0xe00d, 0x1141: 0x0008, 0x1142: 0xe00d, 0x1143: 0x0008, 0x1144: 0xe00d, 0x1145: 0x0008, + 0x1146: 0xe00d, 0x1147: 0x0008, 0x1148: 0xe00d, 0x1149: 0x0008, 0x114a: 0xe00d, 0x114b: 0x0008, + 0x114c: 0xe00d, 0x114d: 0x0008, 0x114e: 0xe00d, 0x114f: 0x0008, 0x1150: 0xe00d, 0x1151: 0x0008, + 0x1152: 0xe00d, 0x1153: 0x0008, 0x1154: 0xe00d, 0x1155: 0x0008, 0x1156: 0xe00d, 0x1157: 0x0008, + 0x1158: 0xe00d, 0x1159: 0x0008, 0x115a: 0xe00d, 0x115b: 0x0008, 0x115c: 0xe00d, 0x115d: 0x0008, + 0x115e: 0xe00d, 0x115f: 0x0008, 0x1160: 0xe00d, 0x1161: 0x0008, 0x1162: 0xe00d, 0x1163: 0x0008, + 0x1164: 0xe00d, 0x1165: 0x0008, 0x1166: 0xe00d, 0x1167: 0x0008, 0x1168: 0xe00d, 0x1169: 0x0008, + 0x116a: 0xe00d, 0x116b: 0x0008, 0x116c: 0xe00d, 0x116d: 0x0008, 0x116e: 0xe00d, 0x116f: 0x0008, + 0x1170: 0xe0fd, 0x1171: 0x0008, 0x1172: 0x0008, 0x1173: 0x0008, 0x1174: 0x0008, 0x1175: 0x0008, + 0x1176: 0x0008, 0x1177: 0x0008, 0x1178: 0x0008, 0x1179: 0xe01d, 0x117a: 0x0008, 0x117b: 0xe03d, + 0x117c: 0x0008, 0x117d: 0x442d, 0x117e: 0xe00d, 0x117f: 0x0008, + // Block 0x46, offset 0x1180 + 0x1180: 0xe00d, 0x1181: 0x0008, 0x1182: 0xe00d, 0x1183: 0x0008, 0x1184: 0xe00d, 0x1185: 0x0008, + 0x1186: 0xe00d, 0x1187: 0x0008, 0x1188: 0x0008, 0x1189: 0x0018, 0x118a: 0x0018, 0x118b: 0xe03d, + 0x118c: 0x0008, 0x118d: 0x11d9, 0x118e: 0x0008, 0x118f: 0x0008, 0x1190: 0xe00d, 0x1191: 0x0008, + 0x1192: 0xe00d, 0x1193: 0x0008, 0x1194: 0x0008, 0x1195: 0x0008, 0x1196: 0xe00d, 0x1197: 0x0008, + 0x1198: 0xe00d, 0x1199: 0x0008, 0x119a: 0xe00d, 0x119b: 0x0008, 0x119c: 0xe00d, 0x119d: 0x0008, + 0x119e: 0xe00d, 0x119f: 0x0008, 0x11a0: 0xe00d, 0x11a1: 0x0008, 0x11a2: 0xe00d, 0x11a3: 0x0008, + 0x11a4: 0xe00d, 0x11a5: 0x0008, 0x11a6: 0xe00d, 0x11a7: 0x0008, 0x11a8: 0xe00d, 0x11a9: 0x0008, + 0x11aa: 0x6e29, 0x11ab: 0x1029, 0x11ac: 0x11c1, 0x11ad: 0x6e41, 0x11ae: 0x1221, 0x11af: 0x0040, + 0x11b0: 0x6e59, 0x11b1: 0x6e71, 0x11b2: 0x1239, 0x11b3: 0x444d, 0x11b4: 0xe00d, 0x11b5: 0x0008, + 0x11b6: 0xe00d, 0x11b7: 0x0008, 0x11b8: 0x0040, 0x11b9: 0x0040, 0x11ba: 0x0040, 0x11bb: 0x0040, + 0x11bc: 0x0040, 0x11bd: 0x0040, 0x11be: 0x0040, 0x11bf: 0x0040, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x64d5, 0x11c1: 0x64f5, 0x11c2: 0x6515, 0x11c3: 0x6535, 0x11c4: 0x6555, 0x11c5: 0x6575, + 0x11c6: 0x6595, 0x11c7: 0x65b5, 0x11c8: 0x65d5, 0x11c9: 0x65f5, 0x11ca: 0x6615, 0x11cb: 0x6635, + 0x11cc: 0x6655, 0x11cd: 0x6675, 0x11ce: 0x0008, 0x11cf: 0x0008, 0x11d0: 0x6695, 0x11d1: 0x0008, + 0x11d2: 0x66b5, 0x11d3: 0x0008, 0x11d4: 0x0008, 0x11d5: 0x66d5, 0x11d6: 0x66f5, 0x11d7: 0x6715, + 0x11d8: 0x6735, 0x11d9: 0x6755, 0x11da: 0x6775, 0x11db: 0x6795, 0x11dc: 0x67b5, 0x11dd: 0x67d5, + 0x11de: 0x67f5, 0x11df: 0x0008, 0x11e0: 0x6815, 0x11e1: 0x0008, 0x11e2: 0x6835, 0x11e3: 0x0008, + 0x11e4: 0x0008, 0x11e5: 0x6855, 0x11e6: 0x6875, 0x11e7: 0x0008, 0x11e8: 0x0008, 0x11e9: 0x0008, + 0x11ea: 0x6895, 0x11eb: 0x68b5, 0x11ec: 0x68d5, 0x11ed: 0x68f5, 0x11ee: 0x6915, 0x11ef: 0x6935, + 0x11f0: 0x6955, 0x11f1: 0x6975, 0x11f2: 0x6995, 0x11f3: 0x69b5, 0x11f4: 0x69d5, 0x11f5: 0x69f5, + 0x11f6: 0x6a15, 0x11f7: 0x6a35, 0x11f8: 0x6a55, 0x11f9: 0x6a75, 0x11fa: 0x6a95, 0x11fb: 0x6ab5, + 0x11fc: 0x6ad5, 0x11fd: 0x6af5, 0x11fe: 0x6b15, 0x11ff: 0x6b35, + // Block 0x48, offset 0x1200 + 0x1200: 0x7a95, 0x1201: 0x7ab5, 0x1202: 0x7ad5, 0x1203: 0x7af5, 0x1204: 0x7b15, 0x1205: 0x7b35, + 0x1206: 0x7b55, 0x1207: 0x7b75, 0x1208: 0x7b95, 0x1209: 0x7bb5, 0x120a: 0x7bd5, 0x120b: 0x7bf5, + 0x120c: 0x7c15, 0x120d: 0x7c35, 0x120e: 0x7c55, 0x120f: 0x6ec9, 0x1210: 0x6ef1, 0x1211: 0x6f19, + 0x1212: 0x7c75, 0x1213: 0x7c95, 0x1214: 0x7cb5, 0x1215: 0x6f41, 0x1216: 0x6f69, 0x1217: 0x6f91, + 0x1218: 0x7cd5, 0x1219: 0x7cf5, 0x121a: 0x0040, 0x121b: 0x0040, 0x121c: 0x0040, 0x121d: 0x0040, + 0x121e: 0x0040, 0x121f: 0x0040, 0x1220: 0x0040, 0x1221: 0x0040, 0x1222: 0x0040, 0x1223: 0x0040, + 0x1224: 0x0040, 0x1225: 0x0040, 0x1226: 0x0040, 0x1227: 0x0040, 0x1228: 0x0040, 0x1229: 0x0040, + 0x122a: 0x0040, 0x122b: 0x0040, 0x122c: 0x0040, 0x122d: 0x0040, 0x122e: 0x0040, 0x122f: 0x0040, + 0x1230: 0x0040, 0x1231: 0x0040, 0x1232: 0x0040, 0x1233: 0x0040, 0x1234: 0x0040, 0x1235: 0x0040, + 0x1236: 0x0040, 0x1237: 0x0040, 0x1238: 0x0040, 0x1239: 0x0040, 0x123a: 0x0040, 0x123b: 0x0040, + 0x123c: 0x0040, 0x123d: 0x0040, 0x123e: 0x0040, 0x123f: 0x0040, + // Block 0x49, offset 0x1240 + 0x1240: 0x6fb9, 0x1241: 0x6fd1, 0x1242: 0x6fe9, 0x1243: 0x7d15, 0x1244: 0x7d35, 0x1245: 0x7001, + 0x1246: 0x7001, 0x1247: 0x0040, 0x1248: 0x0040, 0x1249: 0x0040, 0x124a: 0x0040, 0x124b: 0x0040, + 0x124c: 0x0040, 0x124d: 0x0040, 0x124e: 0x0040, 0x124f: 0x0040, 0x1250: 0x0040, 0x1251: 0x0040, + 0x1252: 0x0040, 0x1253: 0x7019, 0x1254: 0x7041, 0x1255: 0x7069, 0x1256: 0x7091, 0x1257: 0x70b9, + 0x1258: 0x0040, 0x1259: 0x0040, 0x125a: 0x0040, 0x125b: 0x0040, 0x125c: 0x0040, 0x125d: 0x70e1, + 0x125e: 0x1308, 0x125f: 0x7109, 0x1260: 0x7131, 0x1261: 0x20a9, 0x1262: 0x20f1, 0x1263: 0x7149, + 0x1264: 0x7161, 0x1265: 0x7179, 0x1266: 0x7191, 0x1267: 0x71a9, 0x1268: 0x71c1, 0x1269: 0x1fb2, + 0x126a: 0x71d9, 0x126b: 0x7201, 0x126c: 0x7229, 0x126d: 0x7261, 0x126e: 0x7299, 0x126f: 0x72c1, + 0x1270: 0x72e9, 0x1271: 0x7311, 0x1272: 0x7339, 0x1273: 0x7361, 0x1274: 0x7389, 0x1275: 0x73b1, + 0x1276: 0x73d9, 0x1277: 0x0040, 0x1278: 0x7401, 0x1279: 0x7429, 0x127a: 0x7451, 0x127b: 0x7479, + 0x127c: 0x74a1, 0x127d: 0x0040, 0x127e: 0x74c9, 0x127f: 0x0040, + // Block 0x4a, offset 0x1280 + 0x1280: 0x74f1, 0x1281: 0x7519, 0x1282: 0x0040, 0x1283: 0x7541, 0x1284: 0x7569, 0x1285: 0x0040, + 0x1286: 0x7591, 0x1287: 0x75b9, 0x1288: 0x75e1, 0x1289: 0x7609, 0x128a: 0x7631, 0x128b: 0x7659, + 0x128c: 0x7681, 0x128d: 0x76a9, 0x128e: 0x76d1, 0x128f: 0x76f9, 0x1290: 0x7721, 0x1291: 0x7721, + 0x1292: 0x7739, 0x1293: 0x7739, 0x1294: 0x7739, 0x1295: 0x7739, 0x1296: 0x7751, 0x1297: 0x7751, + 0x1298: 0x7751, 0x1299: 0x7751, 0x129a: 0x7769, 0x129b: 0x7769, 0x129c: 0x7769, 0x129d: 0x7769, + 0x129e: 0x7781, 0x129f: 0x7781, 0x12a0: 0x7781, 0x12a1: 0x7781, 0x12a2: 0x7799, 0x12a3: 0x7799, + 0x12a4: 0x7799, 0x12a5: 0x7799, 0x12a6: 0x77b1, 0x12a7: 0x77b1, 0x12a8: 0x77b1, 0x12a9: 0x77b1, + 0x12aa: 0x77c9, 0x12ab: 0x77c9, 0x12ac: 0x77c9, 0x12ad: 0x77c9, 0x12ae: 0x77e1, 0x12af: 0x77e1, + 0x12b0: 0x77e1, 0x12b1: 0x77e1, 0x12b2: 0x77f9, 0x12b3: 0x77f9, 0x12b4: 0x77f9, 0x12b5: 0x77f9, + 0x12b6: 0x7811, 0x12b7: 0x7811, 0x12b8: 0x7811, 0x12b9: 0x7811, 0x12ba: 0x7829, 0x12bb: 0x7829, + 0x12bc: 0x7829, 0x12bd: 0x7829, 0x12be: 0x7841, 0x12bf: 0x7841, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x7841, 0x12c1: 0x7841, 0x12c2: 0x7859, 0x12c3: 0x7859, 0x12c4: 0x7871, 0x12c5: 0x7871, + 0x12c6: 0x7889, 0x12c7: 0x7889, 0x12c8: 0x78a1, 0x12c9: 0x78a1, 0x12ca: 0x78b9, 0x12cb: 0x78b9, + 0x12cc: 0x78d1, 0x12cd: 0x78d1, 0x12ce: 0x78e9, 0x12cf: 0x78e9, 0x12d0: 0x78e9, 0x12d1: 0x78e9, + 0x12d2: 0x7901, 0x12d3: 0x7901, 0x12d4: 0x7901, 0x12d5: 0x7901, 0x12d6: 0x7919, 0x12d7: 0x7919, + 0x12d8: 0x7919, 0x12d9: 0x7919, 0x12da: 0x7931, 0x12db: 0x7931, 0x12dc: 0x7931, 0x12dd: 0x7931, + 0x12de: 0x7949, 0x12df: 0x7949, 0x12e0: 0x7961, 0x12e1: 0x7961, 0x12e2: 0x7961, 0x12e3: 0x7961, + 0x12e4: 0x7979, 0x12e5: 0x7979, 0x12e6: 0x7991, 0x12e7: 0x7991, 0x12e8: 0x7991, 0x12e9: 0x7991, + 0x12ea: 0x79a9, 0x12eb: 0x79a9, 0x12ec: 0x79a9, 0x12ed: 0x79a9, 0x12ee: 0x79c1, 0x12ef: 0x79c1, + 0x12f0: 0x79d9, 0x12f1: 0x79d9, 0x12f2: 0x0018, 0x12f3: 0x0018, 0x12f4: 0x0018, 0x12f5: 0x0018, + 0x12f6: 0x0018, 0x12f7: 0x0018, 0x12f8: 0x0018, 0x12f9: 0x0018, 0x12fa: 0x0018, 0x12fb: 0x0018, + 0x12fc: 0x0018, 0x12fd: 0x0018, 0x12fe: 0x0018, 0x12ff: 0x0018, + // Block 0x4c, offset 0x1300 + 0x1300: 0x0018, 0x1301: 0x0018, 0x1302: 0x0040, 0x1303: 0x0040, 0x1304: 0x0040, 0x1305: 0x0040, + 0x1306: 0x0040, 0x1307: 0x0040, 0x1308: 0x0040, 0x1309: 0x0040, 0x130a: 0x0040, 0x130b: 0x0040, + 0x130c: 0x0040, 0x130d: 0x0040, 0x130e: 0x0040, 0x130f: 0x0040, 0x1310: 0x0040, 0x1311: 0x0040, + 0x1312: 0x0040, 0x1313: 0x79f1, 0x1314: 0x79f1, 0x1315: 0x79f1, 0x1316: 0x79f1, 0x1317: 0x7a09, + 0x1318: 0x7a09, 0x1319: 0x7a21, 0x131a: 0x7a21, 0x131b: 0x7a39, 0x131c: 0x7a39, 0x131d: 0x0479, + 0x131e: 0x7a51, 0x131f: 0x7a51, 0x1320: 0x7a69, 0x1321: 0x7a69, 0x1322: 0x7a81, 0x1323: 0x7a81, + 0x1324: 0x7a99, 0x1325: 0x7a99, 0x1326: 0x7a99, 0x1327: 0x7a99, 0x1328: 0x7ab1, 0x1329: 0x7ab1, + 0x132a: 0x7ac9, 0x132b: 0x7ac9, 0x132c: 0x7af1, 0x132d: 0x7af1, 0x132e: 0x7b19, 0x132f: 0x7b19, + 0x1330: 0x7b41, 0x1331: 0x7b41, 0x1332: 0x7b69, 0x1333: 0x7b69, 0x1334: 0x7b91, 0x1335: 0x7b91, + 0x1336: 0x7bb9, 0x1337: 0x7bb9, 0x1338: 0x7bb9, 0x1339: 0x7be1, 0x133a: 0x7be1, 0x133b: 0x7be1, + 0x133c: 0x7c09, 0x133d: 0x7c09, 0x133e: 0x7c09, 0x133f: 0x7c09, + // Block 0x4d, offset 0x1340 + 0x1340: 0x85f9, 0x1341: 0x8621, 0x1342: 0x8649, 0x1343: 0x8671, 0x1344: 0x8699, 0x1345: 0x86c1, + 0x1346: 0x86e9, 0x1347: 0x8711, 0x1348: 0x8739, 0x1349: 0x8761, 0x134a: 0x8789, 0x134b: 0x87b1, + 0x134c: 0x87d9, 0x134d: 0x8801, 0x134e: 0x8829, 0x134f: 0x8851, 0x1350: 0x8879, 0x1351: 0x88a1, + 0x1352: 0x88c9, 0x1353: 0x88f1, 0x1354: 0x8919, 0x1355: 0x8941, 0x1356: 0x8969, 0x1357: 0x8991, + 0x1358: 0x89b9, 0x1359: 0x89e1, 0x135a: 0x8a09, 0x135b: 0x8a31, 0x135c: 0x8a59, 0x135d: 0x8a81, + 0x135e: 0x8aaa, 0x135f: 0x8ada, 0x1360: 0x8b0a, 0x1361: 0x8b3a, 0x1362: 0x8b6a, 0x1363: 0x8b9a, + 0x1364: 0x8bc9, 0x1365: 0x8bf1, 0x1366: 0x7c71, 0x1367: 0x8c19, 0x1368: 0x7be1, 0x1369: 0x7c99, + 0x136a: 0x8c41, 0x136b: 0x8c69, 0x136c: 0x7d39, 0x136d: 0x8c91, 0x136e: 0x7d61, 0x136f: 0x7d89, + 0x1370: 0x8cb9, 0x1371: 0x8ce1, 0x1372: 0x7e29, 0x1373: 0x8d09, 0x1374: 0x7e51, 0x1375: 0x7e79, + 0x1376: 0x8d31, 0x1377: 0x8d59, 0x1378: 0x7ec9, 0x1379: 0x8d81, 0x137a: 0x7ef1, 0x137b: 0x7f19, + 0x137c: 0x83a1, 0x137d: 0x83c9, 0x137e: 0x8441, 0x137f: 0x8469, + // Block 0x4e, offset 0x1380 + 0x1380: 0x8491, 0x1381: 0x8531, 0x1382: 0x8559, 0x1383: 0x8581, 0x1384: 0x85a9, 0x1385: 0x8649, + 0x1386: 0x8671, 0x1387: 0x8699, 0x1388: 0x8da9, 0x1389: 0x8739, 0x138a: 0x8dd1, 0x138b: 0x8df9, + 0x138c: 0x8829, 0x138d: 0x8e21, 0x138e: 0x8851, 0x138f: 0x8879, 0x1390: 0x8a81, 0x1391: 0x8e49, + 0x1392: 0x8e71, 0x1393: 0x89b9, 0x1394: 0x8e99, 0x1395: 0x89e1, 0x1396: 0x8a09, 0x1397: 0x7c21, + 0x1398: 0x7c49, 0x1399: 0x8ec1, 0x139a: 0x7c71, 0x139b: 0x8ee9, 0x139c: 0x7cc1, 0x139d: 0x7ce9, + 0x139e: 0x7d11, 0x139f: 0x7d39, 0x13a0: 0x8f11, 0x13a1: 0x7db1, 0x13a2: 0x7dd9, 0x13a3: 0x7e01, + 0x13a4: 0x7e29, 0x13a5: 0x8f39, 0x13a6: 0x7ec9, 0x13a7: 0x7f41, 0x13a8: 0x7f69, 0x13a9: 0x7f91, + 0x13aa: 0x7fb9, 0x13ab: 0x7fe1, 0x13ac: 0x8031, 0x13ad: 0x8059, 0x13ae: 0x8081, 0x13af: 0x80a9, + 0x13b0: 0x80d1, 0x13b1: 0x80f9, 0x13b2: 0x8f61, 0x13b3: 0x8121, 0x13b4: 0x8149, 0x13b5: 0x8171, + 0x13b6: 0x8199, 0x13b7: 0x81c1, 0x13b8: 0x81e9, 0x13b9: 0x8239, 0x13ba: 0x8261, 0x13bb: 0x8289, + 0x13bc: 0x82b1, 0x13bd: 0x82d9, 0x13be: 0x8301, 0x13bf: 0x8329, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x8351, 0x13c1: 0x8379, 0x13c2: 0x83f1, 0x13c3: 0x8419, 0x13c4: 0x84b9, 0x13c5: 0x84e1, + 0x13c6: 0x8509, 0x13c7: 0x8531, 0x13c8: 0x8559, 0x13c9: 0x85d1, 0x13ca: 0x85f9, 0x13cb: 0x8621, + 0x13cc: 0x8649, 0x13cd: 0x8f89, 0x13ce: 0x86c1, 0x13cf: 0x86e9, 0x13d0: 0x8711, 0x13d1: 0x8739, + 0x13d2: 0x87b1, 0x13d3: 0x87d9, 0x13d4: 0x8801, 0x13d5: 0x8829, 0x13d6: 0x8fb1, 0x13d7: 0x88a1, + 0x13d8: 0x88c9, 0x13d9: 0x8fd9, 0x13da: 0x8941, 0x13db: 0x8969, 0x13dc: 0x8991, 0x13dd: 0x89b9, + 0x13de: 0x9001, 0x13df: 0x7c71, 0x13e0: 0x8ee9, 0x13e1: 0x7d39, 0x13e2: 0x8f11, 0x13e3: 0x7e29, + 0x13e4: 0x8f39, 0x13e5: 0x7ec9, 0x13e6: 0x9029, 0x13e7: 0x80d1, 0x13e8: 0x9051, 0x13e9: 0x9079, + 0x13ea: 0x90a1, 0x13eb: 0x8531, 0x13ec: 0x8559, 0x13ed: 0x8649, 0x13ee: 0x8829, 0x13ef: 0x8fb1, + 0x13f0: 0x89b9, 0x13f1: 0x9001, 0x13f2: 0x90c9, 0x13f3: 0x9101, 0x13f4: 0x9139, 0x13f5: 0x9171, + 0x13f6: 0x9199, 0x13f7: 0x91c1, 0x13f8: 0x91e9, 0x13f9: 0x9211, 0x13fa: 0x9239, 0x13fb: 0x9261, + 0x13fc: 0x9289, 0x13fd: 0x92b1, 0x13fe: 0x92d9, 0x13ff: 0x9301, + // Block 0x50, offset 0x1400 + 0x1400: 0x9329, 0x1401: 0x9351, 0x1402: 0x9379, 0x1403: 0x93a1, 0x1404: 0x93c9, 0x1405: 0x93f1, + 0x1406: 0x9419, 0x1407: 0x9441, 0x1408: 0x9469, 0x1409: 0x9491, 0x140a: 0x94b9, 0x140b: 0x94e1, + 0x140c: 0x9079, 0x140d: 0x9509, 0x140e: 0x9531, 0x140f: 0x9559, 0x1410: 0x9581, 0x1411: 0x9171, + 0x1412: 0x9199, 0x1413: 0x91c1, 0x1414: 0x91e9, 0x1415: 0x9211, 0x1416: 0x9239, 0x1417: 0x9261, + 0x1418: 0x9289, 0x1419: 0x92b1, 0x141a: 0x92d9, 0x141b: 0x9301, 0x141c: 0x9329, 0x141d: 0x9351, + 0x141e: 0x9379, 0x141f: 0x93a1, 0x1420: 0x93c9, 0x1421: 0x93f1, 0x1422: 0x9419, 0x1423: 0x9441, + 0x1424: 0x9469, 0x1425: 0x9491, 0x1426: 0x94b9, 0x1427: 0x94e1, 0x1428: 0x9079, 0x1429: 0x9509, + 0x142a: 0x9531, 0x142b: 0x9559, 0x142c: 0x9581, 0x142d: 0x9491, 0x142e: 0x94b9, 0x142f: 0x94e1, + 0x1430: 0x9079, 0x1431: 0x9051, 0x1432: 0x90a1, 0x1433: 0x8211, 0x1434: 0x8059, 0x1435: 0x8081, + 0x1436: 0x80a9, 0x1437: 0x9491, 0x1438: 0x94b9, 0x1439: 0x94e1, 0x143a: 0x8211, 0x143b: 0x8239, + 0x143c: 0x95a9, 0x143d: 0x95a9, 0x143e: 0x0018, 0x143f: 0x0018, + // Block 0x51, offset 0x1440 + 0x1440: 0x0040, 0x1441: 0x0040, 0x1442: 0x0040, 0x1443: 0x0040, 0x1444: 0x0040, 0x1445: 0x0040, + 0x1446: 0x0040, 0x1447: 0x0040, 0x1448: 0x0040, 0x1449: 0x0040, 0x144a: 0x0040, 0x144b: 0x0040, + 0x144c: 0x0040, 0x144d: 0x0040, 0x144e: 0x0040, 0x144f: 0x0040, 0x1450: 0x95d1, 0x1451: 0x9609, + 0x1452: 0x9609, 0x1453: 0x9641, 0x1454: 0x9679, 0x1455: 0x96b1, 0x1456: 0x96e9, 0x1457: 0x9721, + 0x1458: 0x9759, 0x1459: 0x9759, 0x145a: 0x9791, 0x145b: 0x97c9, 0x145c: 0x9801, 0x145d: 0x9839, + 0x145e: 0x9871, 0x145f: 0x98a9, 0x1460: 0x98a9, 0x1461: 0x98e1, 0x1462: 0x9919, 0x1463: 0x9919, + 0x1464: 0x9951, 0x1465: 0x9951, 0x1466: 0x9989, 0x1467: 0x99c1, 0x1468: 0x99c1, 0x1469: 0x99f9, + 0x146a: 0x9a31, 0x146b: 0x9a31, 0x146c: 0x9a69, 0x146d: 0x9a69, 0x146e: 0x9aa1, 0x146f: 0x9ad9, + 0x1470: 0x9ad9, 0x1471: 0x9b11, 0x1472: 0x9b11, 0x1473: 0x9b49, 0x1474: 0x9b81, 0x1475: 0x9bb9, + 0x1476: 0x9bf1, 0x1477: 0x9bf1, 0x1478: 0x9c29, 0x1479: 0x9c61, 0x147a: 0x9c99, 0x147b: 0x9cd1, + 0x147c: 0x9d09, 0x147d: 0x9d09, 0x147e: 0x9d41, 0x147f: 0x9d79, + // Block 0x52, offset 0x1480 + 0x1480: 0xa949, 0x1481: 0xa981, 0x1482: 0xa9b9, 0x1483: 0xa8a1, 0x1484: 0x9bb9, 0x1485: 0x9989, + 0x1486: 0xa9f1, 0x1487: 0xaa29, 0x1488: 0x0040, 0x1489: 0x0040, 0x148a: 0x0040, 0x148b: 0x0040, + 0x148c: 0x0040, 0x148d: 0x0040, 0x148e: 0x0040, 0x148f: 0x0040, 0x1490: 0x0040, 0x1491: 0x0040, + 0x1492: 0x0040, 0x1493: 0x0040, 0x1494: 0x0040, 0x1495: 0x0040, 0x1496: 0x0040, 0x1497: 0x0040, + 0x1498: 0x0040, 0x1499: 0x0040, 0x149a: 0x0040, 0x149b: 0x0040, 0x149c: 0x0040, 0x149d: 0x0040, + 0x149e: 0x0040, 0x149f: 0x0040, 0x14a0: 0x0040, 0x14a1: 0x0040, 0x14a2: 0x0040, 0x14a3: 0x0040, + 0x14a4: 0x0040, 0x14a5: 0x0040, 0x14a6: 0x0040, 0x14a7: 0x0040, 0x14a8: 0x0040, 0x14a9: 0x0040, + 0x14aa: 0x0040, 0x14ab: 0x0040, 0x14ac: 0x0040, 0x14ad: 0x0040, 0x14ae: 0x0040, 0x14af: 0x0040, + 0x14b0: 0xaa61, 0x14b1: 0xaa99, 0x14b2: 0xaad1, 0x14b3: 0xab19, 0x14b4: 0xab61, 0x14b5: 0xaba9, + 0x14b6: 0xabf1, 0x14b7: 0xac39, 0x14b8: 0xac81, 0x14b9: 0xacc9, 0x14ba: 0xad02, 0x14bb: 0xae12, + 0x14bc: 0xae91, 0x14bd: 0x0018, 0x14be: 0x0040, 0x14bf: 0x0040, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x13c0, 0x14c1: 0x13c0, 0x14c2: 0x13c0, 0x14c3: 0x13c0, 0x14c4: 0x13c0, 0x14c5: 0x13c0, + 0x14c6: 0x13c0, 0x14c7: 0x13c0, 0x14c8: 0x13c0, 0x14c9: 0x13c0, 0x14ca: 0x13c0, 0x14cb: 0x13c0, + 0x14cc: 0x13c0, 0x14cd: 0x13c0, 0x14ce: 0x13c0, 0x14cf: 0x13c0, 0x14d0: 0xaeda, 0x14d1: 0x7d55, + 0x14d2: 0x0040, 0x14d3: 0xaeea, 0x14d4: 0x03c2, 0x14d5: 0xaefa, 0x14d6: 0xaf0a, 0x14d7: 0x7d75, + 0x14d8: 0x7d95, 0x14d9: 0x0040, 0x14da: 0x0040, 0x14db: 0x0040, 0x14dc: 0x0040, 0x14dd: 0x0040, + 0x14de: 0x0040, 0x14df: 0x0040, 0x14e0: 0x1308, 0x14e1: 0x1308, 0x14e2: 0x1308, 0x14e3: 0x1308, + 0x14e4: 0x1308, 0x14e5: 0x1308, 0x14e6: 0x1308, 0x14e7: 0x1308, 0x14e8: 0x1308, 0x14e9: 0x1308, + 0x14ea: 0x1308, 0x14eb: 0x1308, 0x14ec: 0x1308, 0x14ed: 0x1308, 0x14ee: 0x1308, 0x14ef: 0x1308, + 0x14f0: 0x0040, 0x14f1: 0x7db5, 0x14f2: 0x7dd5, 0x14f3: 0xaf1a, 0x14f4: 0xaf1a, 0x14f5: 0x1fd2, + 0x14f6: 0x1fe2, 0x14f7: 0xaf2a, 0x14f8: 0xaf3a, 0x14f9: 0x7df5, 0x14fa: 0x7e15, 0x14fb: 0x7e35, + 0x14fc: 0x7df5, 0x14fd: 0x7e55, 0x14fe: 0x7e75, 0x14ff: 0x7e55, + // Block 0x54, offset 0x1500 + 0x1500: 0x7e95, 0x1501: 0x7eb5, 0x1502: 0x7ed5, 0x1503: 0x7eb5, 0x1504: 0x7ef5, 0x1505: 0x0018, + 0x1506: 0x0018, 0x1507: 0xaf4a, 0x1508: 0xaf5a, 0x1509: 0x7f16, 0x150a: 0x7f36, 0x150b: 0x7f56, + 0x150c: 0x7f76, 0x150d: 0xaf1a, 0x150e: 0xaf1a, 0x150f: 0xaf1a, 0x1510: 0xaeda, 0x1511: 0x7f95, + 0x1512: 0x0040, 0x1513: 0x0040, 0x1514: 0x03c2, 0x1515: 0xaeea, 0x1516: 0xaf0a, 0x1517: 0xaefa, + 0x1518: 0x7fb5, 0x1519: 0x1fd2, 0x151a: 0x1fe2, 0x151b: 0xaf2a, 0x151c: 0xaf3a, 0x151d: 0x7e95, + 0x151e: 0x7ef5, 0x151f: 0xaf6a, 0x1520: 0xaf7a, 0x1521: 0xaf8a, 0x1522: 0x1fb2, 0x1523: 0xaf99, + 0x1524: 0xafaa, 0x1525: 0xafba, 0x1526: 0x1fc2, 0x1527: 0x0040, 0x1528: 0xafca, 0x1529: 0xafda, + 0x152a: 0xafea, 0x152b: 0xaffa, 0x152c: 0x0040, 0x152d: 0x0040, 0x152e: 0x0040, 0x152f: 0x0040, + 0x1530: 0x7fd6, 0x1531: 0xb009, 0x1532: 0x7ff6, 0x1533: 0x0008, 0x1534: 0x8016, 0x1535: 0x0040, + 0x1536: 0x8036, 0x1537: 0xb031, 0x1538: 0x8056, 0x1539: 0xb059, 0x153a: 0x8076, 0x153b: 0xb081, + 0x153c: 0x8096, 0x153d: 0xb0a9, 0x153e: 0x80b6, 0x153f: 0xb0d1, + // Block 0x55, offset 0x1540 + 0x1540: 0xb0f9, 0x1541: 0xb111, 0x1542: 0xb111, 0x1543: 0xb129, 0x1544: 0xb129, 0x1545: 0xb141, + 0x1546: 0xb141, 0x1547: 0xb159, 0x1548: 0xb159, 0x1549: 0xb171, 0x154a: 0xb171, 0x154b: 0xb171, + 0x154c: 0xb171, 0x154d: 0xb189, 0x154e: 0xb189, 0x154f: 0xb1a1, 0x1550: 0xb1a1, 0x1551: 0xb1a1, + 0x1552: 0xb1a1, 0x1553: 0xb1b9, 0x1554: 0xb1b9, 0x1555: 0xb1d1, 0x1556: 0xb1d1, 0x1557: 0xb1d1, + 0x1558: 0xb1d1, 0x1559: 0xb1e9, 0x155a: 0xb1e9, 0x155b: 0xb1e9, 0x155c: 0xb1e9, 0x155d: 0xb201, + 0x155e: 0xb201, 0x155f: 0xb201, 0x1560: 0xb201, 0x1561: 0xb219, 0x1562: 0xb219, 0x1563: 0xb219, + 0x1564: 0xb219, 0x1565: 0xb231, 0x1566: 0xb231, 0x1567: 0xb231, 0x1568: 0xb231, 0x1569: 0xb249, + 0x156a: 0xb249, 0x156b: 0xb261, 0x156c: 0xb261, 0x156d: 0xb279, 0x156e: 0xb279, 0x156f: 0xb291, + 0x1570: 0xb291, 0x1571: 0xb2a9, 0x1572: 0xb2a9, 0x1573: 0xb2a9, 0x1574: 0xb2a9, 0x1575: 0xb2c1, + 0x1576: 0xb2c1, 0x1577: 0xb2c1, 0x1578: 0xb2c1, 0x1579: 0xb2d9, 0x157a: 0xb2d9, 0x157b: 0xb2d9, + 0x157c: 0xb2d9, 0x157d: 0xb2f1, 0x157e: 0xb2f1, 0x157f: 0xb2f1, + // Block 0x56, offset 0x1580 + 0x1580: 0xb2f1, 0x1581: 0xb309, 0x1582: 0xb309, 0x1583: 0xb309, 0x1584: 0xb309, 0x1585: 0xb321, + 0x1586: 0xb321, 0x1587: 0xb321, 0x1588: 0xb321, 0x1589: 0xb339, 0x158a: 0xb339, 0x158b: 0xb339, + 0x158c: 0xb339, 0x158d: 0xb351, 0x158e: 0xb351, 0x158f: 0xb351, 0x1590: 0xb351, 0x1591: 0xb369, + 0x1592: 0xb369, 0x1593: 0xb369, 0x1594: 0xb369, 0x1595: 0xb381, 0x1596: 0xb381, 0x1597: 0xb381, + 0x1598: 0xb381, 0x1599: 0xb399, 0x159a: 0xb399, 0x159b: 0xb399, 0x159c: 0xb399, 0x159d: 0xb3b1, + 0x159e: 0xb3b1, 0x159f: 0xb3b1, 0x15a0: 0xb3b1, 0x15a1: 0xb3c9, 0x15a2: 0xb3c9, 0x15a3: 0xb3c9, + 0x15a4: 0xb3c9, 0x15a5: 0xb3e1, 0x15a6: 0xb3e1, 0x15a7: 0xb3e1, 0x15a8: 0xb3e1, 0x15a9: 0xb3f9, + 0x15aa: 0xb3f9, 0x15ab: 0xb3f9, 0x15ac: 0xb3f9, 0x15ad: 0xb411, 0x15ae: 0xb411, 0x15af: 0x7ab1, + 0x15b0: 0x7ab1, 0x15b1: 0xb429, 0x15b2: 0xb429, 0x15b3: 0xb429, 0x15b4: 0xb429, 0x15b5: 0xb441, + 0x15b6: 0xb441, 0x15b7: 0xb469, 0x15b8: 0xb469, 0x15b9: 0xb491, 0x15ba: 0xb491, 0x15bb: 0xb4b9, + 0x15bc: 0xb4b9, 0x15bd: 0x0040, 0x15be: 0x0040, 0x15bf: 0x03c0, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x0040, 0x15c1: 0xaefa, 0x15c2: 0xb4e2, 0x15c3: 0xaf6a, 0x15c4: 0xafda, 0x15c5: 0xafea, + 0x15c6: 0xaf7a, 0x15c7: 0xb4f2, 0x15c8: 0x1fd2, 0x15c9: 0x1fe2, 0x15ca: 0xaf8a, 0x15cb: 0x1fb2, + 0x15cc: 0xaeda, 0x15cd: 0xaf99, 0x15ce: 0x29d1, 0x15cf: 0xb502, 0x15d0: 0x1f41, 0x15d1: 0x00c9, + 0x15d2: 0x0069, 0x15d3: 0x0079, 0x15d4: 0x1f51, 0x15d5: 0x1f61, 0x15d6: 0x1f71, 0x15d7: 0x1f81, + 0x15d8: 0x1f91, 0x15d9: 0x1fa1, 0x15da: 0xaeea, 0x15db: 0x03c2, 0x15dc: 0xafaa, 0x15dd: 0x1fc2, + 0x15de: 0xafba, 0x15df: 0xaf0a, 0x15e0: 0xaffa, 0x15e1: 0x0039, 0x15e2: 0x0ee9, 0x15e3: 0x1159, + 0x15e4: 0x0ef9, 0x15e5: 0x0f09, 0x15e6: 0x1199, 0x15e7: 0x0f31, 0x15e8: 0x0249, 0x15e9: 0x0f41, + 0x15ea: 0x0259, 0x15eb: 0x0f51, 0x15ec: 0x0359, 0x15ed: 0x0f61, 0x15ee: 0x0f71, 0x15ef: 0x00d9, + 0x15f0: 0x0f99, 0x15f1: 0x2039, 0x15f2: 0x0269, 0x15f3: 0x01d9, 0x15f4: 0x0fa9, 0x15f5: 0x0fb9, + 0x15f6: 0x1089, 0x15f7: 0x0279, 0x15f8: 0x0369, 0x15f9: 0x0289, 0x15fa: 0x13d1, 0x15fb: 0xaf4a, + 0x15fc: 0xafca, 0x15fd: 0xaf5a, 0x15fe: 0xb512, 0x15ff: 0xaf1a, + // Block 0x58, offset 0x1600 + 0x1600: 0x1caa, 0x1601: 0x0039, 0x1602: 0x0ee9, 0x1603: 0x1159, 0x1604: 0x0ef9, 0x1605: 0x0f09, + 0x1606: 0x1199, 0x1607: 0x0f31, 0x1608: 0x0249, 0x1609: 0x0f41, 0x160a: 0x0259, 0x160b: 0x0f51, + 0x160c: 0x0359, 0x160d: 0x0f61, 0x160e: 0x0f71, 0x160f: 0x00d9, 0x1610: 0x0f99, 0x1611: 0x2039, + 0x1612: 0x0269, 0x1613: 0x01d9, 0x1614: 0x0fa9, 0x1615: 0x0fb9, 0x1616: 0x1089, 0x1617: 0x0279, + 0x1618: 0x0369, 0x1619: 0x0289, 0x161a: 0x13d1, 0x161b: 0xaf2a, 0x161c: 0xb522, 0x161d: 0xaf3a, + 0x161e: 0xb532, 0x161f: 0x80d5, 0x1620: 0x80f5, 0x1621: 0x29d1, 0x1622: 0x8115, 0x1623: 0x8115, + 0x1624: 0x8135, 0x1625: 0x8155, 0x1626: 0x8175, 0x1627: 0x8195, 0x1628: 0x81b5, 0x1629: 0x81d5, + 0x162a: 0x81f5, 0x162b: 0x8215, 0x162c: 0x8235, 0x162d: 0x8255, 0x162e: 0x8275, 0x162f: 0x8295, + 0x1630: 0x82b5, 0x1631: 0x82d5, 0x1632: 0x82f5, 0x1633: 0x8315, 0x1634: 0x8335, 0x1635: 0x8355, + 0x1636: 0x8375, 0x1637: 0x8395, 0x1638: 0x83b5, 0x1639: 0x83d5, 0x163a: 0x83f5, 0x163b: 0x8415, + 0x163c: 0x81b5, 0x163d: 0x8435, 0x163e: 0x8455, 0x163f: 0x8215, + // Block 0x59, offset 0x1640 + 0x1640: 0x8475, 0x1641: 0x8495, 0x1642: 0x84b5, 0x1643: 0x84d5, 0x1644: 0x84f5, 0x1645: 0x8515, + 0x1646: 0x8535, 0x1647: 0x8555, 0x1648: 0x84d5, 0x1649: 0x8575, 0x164a: 0x84d5, 0x164b: 0x8595, + 0x164c: 0x8595, 0x164d: 0x85b5, 0x164e: 0x85b5, 0x164f: 0x85d5, 0x1650: 0x8515, 0x1651: 0x85f5, + 0x1652: 0x8615, 0x1653: 0x85f5, 0x1654: 0x8635, 0x1655: 0x8615, 0x1656: 0x8655, 0x1657: 0x8655, + 0x1658: 0x8675, 0x1659: 0x8675, 0x165a: 0x8695, 0x165b: 0x8695, 0x165c: 0x8615, 0x165d: 0x8115, + 0x165e: 0x86b5, 0x165f: 0x86d5, 0x1660: 0x0040, 0x1661: 0x86f5, 0x1662: 0x8715, 0x1663: 0x8735, + 0x1664: 0x8755, 0x1665: 0x8735, 0x1666: 0x8775, 0x1667: 0x8795, 0x1668: 0x87b5, 0x1669: 0x87b5, + 0x166a: 0x87d5, 0x166b: 0x87d5, 0x166c: 0x87f5, 0x166d: 0x87f5, 0x166e: 0x87d5, 0x166f: 0x87d5, + 0x1670: 0x8815, 0x1671: 0x8835, 0x1672: 0x8855, 0x1673: 0x8875, 0x1674: 0x8895, 0x1675: 0x88b5, + 0x1676: 0x88b5, 0x1677: 0x88b5, 0x1678: 0x88d5, 0x1679: 0x88d5, 0x167a: 0x88d5, 0x167b: 0x88d5, + 0x167c: 0x87b5, 0x167d: 0x87b5, 0x167e: 0x87b5, 0x167f: 0x0040, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0040, 0x1681: 0x0040, 0x1682: 0x8715, 0x1683: 0x86f5, 0x1684: 0x88f5, 0x1685: 0x86f5, + 0x1686: 0x8715, 0x1687: 0x86f5, 0x1688: 0x0040, 0x1689: 0x0040, 0x168a: 0x8915, 0x168b: 0x8715, + 0x168c: 0x8935, 0x168d: 0x88f5, 0x168e: 0x8935, 0x168f: 0x8715, 0x1690: 0x0040, 0x1691: 0x0040, + 0x1692: 0x8955, 0x1693: 0x8975, 0x1694: 0x8875, 0x1695: 0x8935, 0x1696: 0x88f5, 0x1697: 0x8935, + 0x1698: 0x0040, 0x1699: 0x0040, 0x169a: 0x8995, 0x169b: 0x89b5, 0x169c: 0x8995, 0x169d: 0x0040, + 0x169e: 0x0040, 0x169f: 0x0040, 0x16a0: 0xb541, 0x16a1: 0xb559, 0x16a2: 0xb571, 0x16a3: 0x89d6, + 0x16a4: 0xb589, 0x16a5: 0xb5a1, 0x16a6: 0x89f5, 0x16a7: 0x0040, 0x16a8: 0x8a15, 0x16a9: 0x8a35, + 0x16aa: 0x8a55, 0x16ab: 0x8a35, 0x16ac: 0x8a75, 0x16ad: 0x8a95, 0x16ae: 0x8ab5, 0x16af: 0x0040, + 0x16b0: 0x0040, 0x16b1: 0x0040, 0x16b2: 0x0040, 0x16b3: 0x0040, 0x16b4: 0x0040, 0x16b5: 0x0040, + 0x16b6: 0x0040, 0x16b7: 0x0040, 0x16b8: 0x0040, 0x16b9: 0x0340, 0x16ba: 0x0340, 0x16bb: 0x0340, + 0x16bc: 0x0040, 0x16bd: 0x0040, 0x16be: 0x0040, 0x16bf: 0x0040, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x0208, 0x16c1: 0x0208, 0x16c2: 0x0208, 0x16c3: 0x0208, 0x16c4: 0x0208, 0x16c5: 0x0408, + 0x16c6: 0x0008, 0x16c7: 0x0408, 0x16c8: 0x0018, 0x16c9: 0x0408, 0x16ca: 0x0408, 0x16cb: 0x0008, + 0x16cc: 0x0008, 0x16cd: 0x0108, 0x16ce: 0x0408, 0x16cf: 0x0408, 0x16d0: 0x0408, 0x16d1: 0x0408, + 0x16d2: 0x0408, 0x16d3: 0x0208, 0x16d4: 0x0208, 0x16d5: 0x0208, 0x16d6: 0x0208, 0x16d7: 0x0108, + 0x16d8: 0x0208, 0x16d9: 0x0208, 0x16da: 0x0208, 0x16db: 0x0208, 0x16dc: 0x0208, 0x16dd: 0x0408, + 0x16de: 0x0208, 0x16df: 0x0208, 0x16e0: 0x0208, 0x16e1: 0x0408, 0x16e2: 0x0008, 0x16e3: 0x0008, + 0x16e4: 0x0408, 0x16e5: 0x1308, 0x16e6: 0x1308, 0x16e7: 0x0040, 0x16e8: 0x0040, 0x16e9: 0x0040, + 0x16ea: 0x0040, 0x16eb: 0x0218, 0x16ec: 0x0218, 0x16ed: 0x0218, 0x16ee: 0x0218, 0x16ef: 0x0418, + 0x16f0: 0x0018, 0x16f1: 0x0018, 0x16f2: 0x0018, 0x16f3: 0x0018, 0x16f4: 0x0018, 0x16f5: 0x0018, + 0x16f6: 0x0018, 0x16f7: 0x0040, 0x16f8: 0x0040, 0x16f9: 0x0040, 0x16fa: 0x0040, 0x16fb: 0x0040, + 0x16fc: 0x0040, 0x16fd: 0x0040, 0x16fe: 0x0040, 0x16ff: 0x0040, + // Block 0x5c, offset 0x1700 + 0x1700: 0x0208, 0x1701: 0x0408, 0x1702: 0x0208, 0x1703: 0x0408, 0x1704: 0x0408, 0x1705: 0x0408, + 0x1706: 0x0208, 0x1707: 0x0208, 0x1708: 0x0208, 0x1709: 0x0408, 0x170a: 0x0208, 0x170b: 0x0208, + 0x170c: 0x0408, 0x170d: 0x0208, 0x170e: 0x0408, 0x170f: 0x0408, 0x1710: 0x0208, 0x1711: 0x0408, + 0x1712: 0x0040, 0x1713: 0x0040, 0x1714: 0x0040, 0x1715: 0x0040, 0x1716: 0x0040, 0x1717: 0x0040, + 0x1718: 0x0040, 0x1719: 0x0018, 0x171a: 0x0018, 0x171b: 0x0018, 0x171c: 0x0018, 0x171d: 0x0040, + 0x171e: 0x0040, 0x171f: 0x0040, 0x1720: 0x0040, 0x1721: 0x0040, 0x1722: 0x0040, 0x1723: 0x0040, + 0x1724: 0x0040, 0x1725: 0x0040, 0x1726: 0x0040, 0x1727: 0x0040, 0x1728: 0x0040, 0x1729: 0x0418, + 0x172a: 0x0418, 0x172b: 0x0418, 0x172c: 0x0418, 0x172d: 0x0218, 0x172e: 0x0218, 0x172f: 0x0018, + 0x1730: 0x0040, 0x1731: 0x0040, 0x1732: 0x0040, 0x1733: 0x0040, 0x1734: 0x0040, 0x1735: 0x0040, + 0x1736: 0x0040, 0x1737: 0x0040, 0x1738: 0x0040, 0x1739: 0x0040, 0x173a: 0x0040, 0x173b: 0x0040, + 0x173c: 0x0040, 0x173d: 0x0040, 0x173e: 0x0040, 0x173f: 0x0040, + // Block 0x5d, offset 0x1740 + 0x1740: 0x1308, 0x1741: 0x1308, 0x1742: 0x1008, 0x1743: 0x1008, 0x1744: 0x0040, 0x1745: 0x0008, + 0x1746: 0x0008, 0x1747: 0x0008, 0x1748: 0x0008, 0x1749: 0x0008, 0x174a: 0x0008, 0x174b: 0x0008, + 0x174c: 0x0008, 0x174d: 0x0040, 0x174e: 0x0040, 0x174f: 0x0008, 0x1750: 0x0008, 0x1751: 0x0040, + 0x1752: 0x0040, 0x1753: 0x0008, 0x1754: 0x0008, 0x1755: 0x0008, 0x1756: 0x0008, 0x1757: 0x0008, + 0x1758: 0x0008, 0x1759: 0x0008, 0x175a: 0x0008, 0x175b: 0x0008, 0x175c: 0x0008, 0x175d: 0x0008, + 0x175e: 0x0008, 0x175f: 0x0008, 0x1760: 0x0008, 0x1761: 0x0008, 0x1762: 0x0008, 0x1763: 0x0008, + 0x1764: 0x0008, 0x1765: 0x0008, 0x1766: 0x0008, 0x1767: 0x0008, 0x1768: 0x0008, 0x1769: 0x0040, + 0x176a: 0x0008, 0x176b: 0x0008, 0x176c: 0x0008, 0x176d: 0x0008, 0x176e: 0x0008, 0x176f: 0x0008, + 0x1770: 0x0008, 0x1771: 0x0040, 0x1772: 0x0008, 0x1773: 0x0008, 0x1774: 0x0040, 0x1775: 0x0008, + 0x1776: 0x0008, 0x1777: 0x0008, 0x1778: 0x0008, 0x1779: 0x0008, 0x177a: 0x0040, 0x177b: 0x0040, + 0x177c: 0x1308, 0x177d: 0x0008, 0x177e: 0x1008, 0x177f: 0x1008, + // Block 0x5e, offset 0x1780 + 0x1780: 0x1308, 0x1781: 0x1008, 0x1782: 0x1008, 0x1783: 0x1008, 0x1784: 0x1008, 0x1785: 0x0040, + 0x1786: 0x0040, 0x1787: 0x1008, 0x1788: 0x1008, 0x1789: 0x0040, 0x178a: 0x0040, 0x178b: 0x1008, + 0x178c: 0x1008, 0x178d: 0x1808, 0x178e: 0x0040, 0x178f: 0x0040, 0x1790: 0x0008, 0x1791: 0x0040, + 0x1792: 0x0040, 0x1793: 0x0040, 0x1794: 0x0040, 0x1795: 0x0040, 0x1796: 0x0040, 0x1797: 0x1008, + 0x1798: 0x0040, 0x1799: 0x0040, 0x179a: 0x0040, 0x179b: 0x0040, 0x179c: 0x0040, 0x179d: 0x0008, + 0x179e: 0x0008, 0x179f: 0x0008, 0x17a0: 0x0008, 0x17a1: 0x0008, 0x17a2: 0x1008, 0x17a3: 0x1008, + 0x17a4: 0x0040, 0x17a5: 0x0040, 0x17a6: 0x1308, 0x17a7: 0x1308, 0x17a8: 0x1308, 0x17a9: 0x1308, + 0x17aa: 0x1308, 0x17ab: 0x1308, 0x17ac: 0x1308, 0x17ad: 0x0040, 0x17ae: 0x0040, 0x17af: 0x0040, + 0x17b0: 0x1308, 0x17b1: 0x1308, 0x17b2: 0x1308, 0x17b3: 0x1308, 0x17b4: 0x1308, 0x17b5: 0x0040, + 0x17b6: 0x0040, 0x17b7: 0x0040, 0x17b8: 0x0040, 0x17b9: 0x0040, 0x17ba: 0x0040, 0x17bb: 0x0040, + 0x17bc: 0x0040, 0x17bd: 0x0040, 0x17be: 0x0040, 0x17bf: 0x0040, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x0039, 0x17c1: 0x0ee9, 0x17c2: 0x1159, 0x17c3: 0x0ef9, 0x17c4: 0x0f09, 0x17c5: 0x1199, + 0x17c6: 0x0f31, 0x17c7: 0x0249, 0x17c8: 0x0f41, 0x17c9: 0x0259, 0x17ca: 0x0f51, 0x17cb: 0x0359, + 0x17cc: 0x0f61, 0x17cd: 0x0f71, 0x17ce: 0x00d9, 0x17cf: 0x0f99, 0x17d0: 0x2039, 0x17d1: 0x0269, + 0x17d2: 0x01d9, 0x17d3: 0x0fa9, 0x17d4: 0x0fb9, 0x17d5: 0x1089, 0x17d6: 0x0279, 0x17d7: 0x0369, + 0x17d8: 0x0289, 0x17d9: 0x13d1, 0x17da: 0x0039, 0x17db: 0x0ee9, 0x17dc: 0x1159, 0x17dd: 0x0ef9, + 0x17de: 0x0f09, 0x17df: 0x1199, 0x17e0: 0x0f31, 0x17e1: 0x0249, 0x17e2: 0x0f41, 0x17e3: 0x0259, + 0x17e4: 0x0f51, 0x17e5: 0x0359, 0x17e6: 0x0f61, 0x17e7: 0x0f71, 0x17e8: 0x00d9, 0x17e9: 0x0f99, + 0x17ea: 0x2039, 0x17eb: 0x0269, 0x17ec: 0x01d9, 0x17ed: 0x0fa9, 0x17ee: 0x0fb9, 0x17ef: 0x1089, + 0x17f0: 0x0279, 0x17f1: 0x0369, 0x17f2: 0x0289, 0x17f3: 0x13d1, 0x17f4: 0x0039, 0x17f5: 0x0ee9, + 0x17f6: 0x1159, 0x17f7: 0x0ef9, 0x17f8: 0x0f09, 0x17f9: 0x1199, 0x17fa: 0x0f31, 0x17fb: 0x0249, + 0x17fc: 0x0f41, 0x17fd: 0x0259, 0x17fe: 0x0f51, 0x17ff: 0x0359, + // Block 0x60, offset 0x1800 + 0x1800: 0x0f61, 0x1801: 0x0f71, 0x1802: 0x00d9, 0x1803: 0x0f99, 0x1804: 0x2039, 0x1805: 0x0269, + 0x1806: 0x01d9, 0x1807: 0x0fa9, 0x1808: 0x0fb9, 0x1809: 0x1089, 0x180a: 0x0279, 0x180b: 0x0369, + 0x180c: 0x0289, 0x180d: 0x13d1, 0x180e: 0x0039, 0x180f: 0x0ee9, 0x1810: 0x1159, 0x1811: 0x0ef9, + 0x1812: 0x0f09, 0x1813: 0x1199, 0x1814: 0x0f31, 0x1815: 0x0040, 0x1816: 0x0f41, 0x1817: 0x0259, + 0x1818: 0x0f51, 0x1819: 0x0359, 0x181a: 0x0f61, 0x181b: 0x0f71, 0x181c: 0x00d9, 0x181d: 0x0f99, + 0x181e: 0x2039, 0x181f: 0x0269, 0x1820: 0x01d9, 0x1821: 0x0fa9, 0x1822: 0x0fb9, 0x1823: 0x1089, + 0x1824: 0x0279, 0x1825: 0x0369, 0x1826: 0x0289, 0x1827: 0x13d1, 0x1828: 0x0039, 0x1829: 0x0ee9, + 0x182a: 0x1159, 0x182b: 0x0ef9, 0x182c: 0x0f09, 0x182d: 0x1199, 0x182e: 0x0f31, 0x182f: 0x0249, + 0x1830: 0x0f41, 0x1831: 0x0259, 0x1832: 0x0f51, 0x1833: 0x0359, 0x1834: 0x0f61, 0x1835: 0x0f71, + 0x1836: 0x00d9, 0x1837: 0x0f99, 0x1838: 0x2039, 0x1839: 0x0269, 0x183a: 0x01d9, 0x183b: 0x0fa9, + 0x183c: 0x0fb9, 0x183d: 0x1089, 0x183e: 0x0279, 0x183f: 0x0369, + // Block 0x61, offset 0x1840 + 0x1840: 0x0289, 0x1841: 0x13d1, 0x1842: 0x0039, 0x1843: 0x0ee9, 0x1844: 0x1159, 0x1845: 0x0ef9, + 0x1846: 0x0f09, 0x1847: 0x1199, 0x1848: 0x0f31, 0x1849: 0x0249, 0x184a: 0x0f41, 0x184b: 0x0259, + 0x184c: 0x0f51, 0x184d: 0x0359, 0x184e: 0x0f61, 0x184f: 0x0f71, 0x1850: 0x00d9, 0x1851: 0x0f99, + 0x1852: 0x2039, 0x1853: 0x0269, 0x1854: 0x01d9, 0x1855: 0x0fa9, 0x1856: 0x0fb9, 0x1857: 0x1089, + 0x1858: 0x0279, 0x1859: 0x0369, 0x185a: 0x0289, 0x185b: 0x13d1, 0x185c: 0x0039, 0x185d: 0x0040, + 0x185e: 0x1159, 0x185f: 0x0ef9, 0x1860: 0x0040, 0x1861: 0x0040, 0x1862: 0x0f31, 0x1863: 0x0040, + 0x1864: 0x0040, 0x1865: 0x0259, 0x1866: 0x0f51, 0x1867: 0x0040, 0x1868: 0x0040, 0x1869: 0x0f71, + 0x186a: 0x00d9, 0x186b: 0x0f99, 0x186c: 0x2039, 0x186d: 0x0040, 0x186e: 0x01d9, 0x186f: 0x0fa9, + 0x1870: 0x0fb9, 0x1871: 0x1089, 0x1872: 0x0279, 0x1873: 0x0369, 0x1874: 0x0289, 0x1875: 0x13d1, + 0x1876: 0x0039, 0x1877: 0x0ee9, 0x1878: 0x1159, 0x1879: 0x0ef9, 0x187a: 0x0040, 0x187b: 0x1199, + 0x187c: 0x0040, 0x187d: 0x0249, 0x187e: 0x0f41, 0x187f: 0x0259, + // Block 0x62, offset 0x1880 + 0x1880: 0x0f51, 0x1881: 0x0359, 0x1882: 0x0f61, 0x1883: 0x0f71, 0x1884: 0x0040, 0x1885: 0x0f99, + 0x1886: 0x2039, 0x1887: 0x0269, 0x1888: 0x01d9, 0x1889: 0x0fa9, 0x188a: 0x0fb9, 0x188b: 0x1089, + 0x188c: 0x0279, 0x188d: 0x0369, 0x188e: 0x0289, 0x188f: 0x13d1, 0x1890: 0x0039, 0x1891: 0x0ee9, + 0x1892: 0x1159, 0x1893: 0x0ef9, 0x1894: 0x0f09, 0x1895: 0x1199, 0x1896: 0x0f31, 0x1897: 0x0249, + 0x1898: 0x0f41, 0x1899: 0x0259, 0x189a: 0x0f51, 0x189b: 0x0359, 0x189c: 0x0f61, 0x189d: 0x0f71, + 0x189e: 0x00d9, 0x189f: 0x0f99, 0x18a0: 0x2039, 0x18a1: 0x0269, 0x18a2: 0x01d9, 0x18a3: 0x0fa9, + 0x18a4: 0x0fb9, 0x18a5: 0x1089, 0x18a6: 0x0279, 0x18a7: 0x0369, 0x18a8: 0x0289, 0x18a9: 0x13d1, + 0x18aa: 0x0039, 0x18ab: 0x0ee9, 0x18ac: 0x1159, 0x18ad: 0x0ef9, 0x18ae: 0x0f09, 0x18af: 0x1199, + 0x18b0: 0x0f31, 0x18b1: 0x0249, 0x18b2: 0x0f41, 0x18b3: 0x0259, 0x18b4: 0x0f51, 0x18b5: 0x0359, + 0x18b6: 0x0f61, 0x18b7: 0x0f71, 0x18b8: 0x00d9, 0x18b9: 0x0f99, 0x18ba: 0x2039, 0x18bb: 0x0269, + 0x18bc: 0x01d9, 0x18bd: 0x0fa9, 0x18be: 0x0fb9, 0x18bf: 0x1089, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x0279, 0x18c1: 0x0369, 0x18c2: 0x0289, 0x18c3: 0x13d1, 0x18c4: 0x0039, 0x18c5: 0x0ee9, + 0x18c6: 0x0040, 0x18c7: 0x0ef9, 0x18c8: 0x0f09, 0x18c9: 0x1199, 0x18ca: 0x0f31, 0x18cb: 0x0040, + 0x18cc: 0x0040, 0x18cd: 0x0259, 0x18ce: 0x0f51, 0x18cf: 0x0359, 0x18d0: 0x0f61, 0x18d1: 0x0f71, + 0x18d2: 0x00d9, 0x18d3: 0x0f99, 0x18d4: 0x2039, 0x18d5: 0x0040, 0x18d6: 0x01d9, 0x18d7: 0x0fa9, + 0x18d8: 0x0fb9, 0x18d9: 0x1089, 0x18da: 0x0279, 0x18db: 0x0369, 0x18dc: 0x0289, 0x18dd: 0x0040, + 0x18de: 0x0039, 0x18df: 0x0ee9, 0x18e0: 0x1159, 0x18e1: 0x0ef9, 0x18e2: 0x0f09, 0x18e3: 0x1199, + 0x18e4: 0x0f31, 0x18e5: 0x0249, 0x18e6: 0x0f41, 0x18e7: 0x0259, 0x18e8: 0x0f51, 0x18e9: 0x0359, + 0x18ea: 0x0f61, 0x18eb: 0x0f71, 0x18ec: 0x00d9, 0x18ed: 0x0f99, 0x18ee: 0x2039, 0x18ef: 0x0269, + 0x18f0: 0x01d9, 0x18f1: 0x0fa9, 0x18f2: 0x0fb9, 0x18f3: 0x1089, 0x18f4: 0x0279, 0x18f5: 0x0369, + 0x18f6: 0x0289, 0x18f7: 0x13d1, 0x18f8: 0x0039, 0x18f9: 0x0ee9, 0x18fa: 0x0040, 0x18fb: 0x0ef9, + 0x18fc: 0x0f09, 0x18fd: 0x1199, 0x18fe: 0x0f31, 0x18ff: 0x0040, + // Block 0x64, offset 0x1900 + 0x1900: 0x0f41, 0x1901: 0x0259, 0x1902: 0x0f51, 0x1903: 0x0359, 0x1904: 0x0f61, 0x1905: 0x0040, + 0x1906: 0x00d9, 0x1907: 0x0040, 0x1908: 0x0040, 0x1909: 0x0040, 0x190a: 0x01d9, 0x190b: 0x0fa9, + 0x190c: 0x0fb9, 0x190d: 0x1089, 0x190e: 0x0279, 0x190f: 0x0369, 0x1910: 0x0289, 0x1911: 0x0040, + 0x1912: 0x0039, 0x1913: 0x0ee9, 0x1914: 0x1159, 0x1915: 0x0ef9, 0x1916: 0x0f09, 0x1917: 0x1199, + 0x1918: 0x0f31, 0x1919: 0x0249, 0x191a: 0x0f41, 0x191b: 0x0259, 0x191c: 0x0f51, 0x191d: 0x0359, + 0x191e: 0x0f61, 0x191f: 0x0f71, 0x1920: 0x00d9, 0x1921: 0x0f99, 0x1922: 0x2039, 0x1923: 0x0269, + 0x1924: 0x01d9, 0x1925: 0x0fa9, 0x1926: 0x0fb9, 0x1927: 0x1089, 0x1928: 0x0279, 0x1929: 0x0369, + 0x192a: 0x0289, 0x192b: 0x13d1, 0x192c: 0x0039, 0x192d: 0x0ee9, 0x192e: 0x1159, 0x192f: 0x0ef9, + 0x1930: 0x0f09, 0x1931: 0x1199, 0x1932: 0x0f31, 0x1933: 0x0249, 0x1934: 0x0f41, 0x1935: 0x0259, + 0x1936: 0x0f51, 0x1937: 0x0359, 0x1938: 0x0f61, 0x1939: 0x0f71, 0x193a: 0x00d9, 0x193b: 0x0f99, + 0x193c: 0x2039, 0x193d: 0x0269, 0x193e: 0x01d9, 0x193f: 0x0fa9, + // Block 0x65, offset 0x1940 + 0x1940: 0x0fb9, 0x1941: 0x1089, 0x1942: 0x0279, 0x1943: 0x0369, 0x1944: 0x0289, 0x1945: 0x13d1, + 0x1946: 0x0039, 0x1947: 0x0ee9, 0x1948: 0x1159, 0x1949: 0x0ef9, 0x194a: 0x0f09, 0x194b: 0x1199, + 0x194c: 0x0f31, 0x194d: 0x0249, 0x194e: 0x0f41, 0x194f: 0x0259, 0x1950: 0x0f51, 0x1951: 0x0359, + 0x1952: 0x0f61, 0x1953: 0x0f71, 0x1954: 0x00d9, 0x1955: 0x0f99, 0x1956: 0x2039, 0x1957: 0x0269, + 0x1958: 0x01d9, 0x1959: 0x0fa9, 0x195a: 0x0fb9, 0x195b: 0x1089, 0x195c: 0x0279, 0x195d: 0x0369, + 0x195e: 0x0289, 0x195f: 0x13d1, 0x1960: 0x0039, 0x1961: 0x0ee9, 0x1962: 0x1159, 0x1963: 0x0ef9, + 0x1964: 0x0f09, 0x1965: 0x1199, 0x1966: 0x0f31, 0x1967: 0x0249, 0x1968: 0x0f41, 0x1969: 0x0259, + 0x196a: 0x0f51, 0x196b: 0x0359, 0x196c: 0x0f61, 0x196d: 0x0f71, 0x196e: 0x00d9, 0x196f: 0x0f99, + 0x1970: 0x2039, 0x1971: 0x0269, 0x1972: 0x01d9, 0x1973: 0x0fa9, 0x1974: 0x0fb9, 0x1975: 0x1089, + 0x1976: 0x0279, 0x1977: 0x0369, 0x1978: 0x0289, 0x1979: 0x13d1, 0x197a: 0x0039, 0x197b: 0x0ee9, + 0x197c: 0x1159, 0x197d: 0x0ef9, 0x197e: 0x0f09, 0x197f: 0x1199, + // Block 0x66, offset 0x1980 + 0x1980: 0x0f31, 0x1981: 0x0249, 0x1982: 0x0f41, 0x1983: 0x0259, 0x1984: 0x0f51, 0x1985: 0x0359, + 0x1986: 0x0f61, 0x1987: 0x0f71, 0x1988: 0x00d9, 0x1989: 0x0f99, 0x198a: 0x2039, 0x198b: 0x0269, + 0x198c: 0x01d9, 0x198d: 0x0fa9, 0x198e: 0x0fb9, 0x198f: 0x1089, 0x1990: 0x0279, 0x1991: 0x0369, + 0x1992: 0x0289, 0x1993: 0x13d1, 0x1994: 0x0039, 0x1995: 0x0ee9, 0x1996: 0x1159, 0x1997: 0x0ef9, + 0x1998: 0x0f09, 0x1999: 0x1199, 0x199a: 0x0f31, 0x199b: 0x0249, 0x199c: 0x0f41, 0x199d: 0x0259, + 0x199e: 0x0f51, 0x199f: 0x0359, 0x19a0: 0x0f61, 0x19a1: 0x0f71, 0x19a2: 0x00d9, 0x19a3: 0x0f99, + 0x19a4: 0x2039, 0x19a5: 0x0269, 0x19a6: 0x01d9, 0x19a7: 0x0fa9, 0x19a8: 0x0fb9, 0x19a9: 0x1089, + 0x19aa: 0x0279, 0x19ab: 0x0369, 0x19ac: 0x0289, 0x19ad: 0x13d1, 0x19ae: 0x0039, 0x19af: 0x0ee9, + 0x19b0: 0x1159, 0x19b1: 0x0ef9, 0x19b2: 0x0f09, 0x19b3: 0x1199, 0x19b4: 0x0f31, 0x19b5: 0x0249, + 0x19b6: 0x0f41, 0x19b7: 0x0259, 0x19b8: 0x0f51, 0x19b9: 0x0359, 0x19ba: 0x0f61, 0x19bb: 0x0f71, + 0x19bc: 0x00d9, 0x19bd: 0x0f99, 0x19be: 0x2039, 0x19bf: 0x0269, + // Block 0x67, offset 0x19c0 + 0x19c0: 0x01d9, 0x19c1: 0x0fa9, 0x19c2: 0x0fb9, 0x19c3: 0x1089, 0x19c4: 0x0279, 0x19c5: 0x0369, + 0x19c6: 0x0289, 0x19c7: 0x13d1, 0x19c8: 0x0039, 0x19c9: 0x0ee9, 0x19ca: 0x1159, 0x19cb: 0x0ef9, + 0x19cc: 0x0f09, 0x19cd: 0x1199, 0x19ce: 0x0f31, 0x19cf: 0x0249, 0x19d0: 0x0f41, 0x19d1: 0x0259, + 0x19d2: 0x0f51, 0x19d3: 0x0359, 0x19d4: 0x0f61, 0x19d5: 0x0f71, 0x19d6: 0x00d9, 0x19d7: 0x0f99, + 0x19d8: 0x2039, 0x19d9: 0x0269, 0x19da: 0x01d9, 0x19db: 0x0fa9, 0x19dc: 0x0fb9, 0x19dd: 0x1089, + 0x19de: 0x0279, 0x19df: 0x0369, 0x19e0: 0x0289, 0x19e1: 0x13d1, 0x19e2: 0x0039, 0x19e3: 0x0ee9, + 0x19e4: 0x1159, 0x19e5: 0x0ef9, 0x19e6: 0x0f09, 0x19e7: 0x1199, 0x19e8: 0x0f31, 0x19e9: 0x0249, + 0x19ea: 0x0f41, 0x19eb: 0x0259, 0x19ec: 0x0f51, 0x19ed: 0x0359, 0x19ee: 0x0f61, 0x19ef: 0x0f71, + 0x19f0: 0x00d9, 0x19f1: 0x0f99, 0x19f2: 0x2039, 0x19f3: 0x0269, 0x19f4: 0x01d9, 0x19f5: 0x0fa9, + 0x19f6: 0x0fb9, 0x19f7: 0x1089, 0x19f8: 0x0279, 0x19f9: 0x0369, 0x19fa: 0x0289, 0x19fb: 0x13d1, + 0x19fc: 0x0039, 0x19fd: 0x0ee9, 0x19fe: 0x1159, 0x19ff: 0x0ef9, + // Block 0x68, offset 0x1a00 + 0x1a00: 0x0f09, 0x1a01: 0x1199, 0x1a02: 0x0f31, 0x1a03: 0x0249, 0x1a04: 0x0f41, 0x1a05: 0x0259, + 0x1a06: 0x0f51, 0x1a07: 0x0359, 0x1a08: 0x0f61, 0x1a09: 0x0f71, 0x1a0a: 0x00d9, 0x1a0b: 0x0f99, + 0x1a0c: 0x2039, 0x1a0d: 0x0269, 0x1a0e: 0x01d9, 0x1a0f: 0x0fa9, 0x1a10: 0x0fb9, 0x1a11: 0x1089, + 0x1a12: 0x0279, 0x1a13: 0x0369, 0x1a14: 0x0289, 0x1a15: 0x13d1, 0x1a16: 0x0039, 0x1a17: 0x0ee9, + 0x1a18: 0x1159, 0x1a19: 0x0ef9, 0x1a1a: 0x0f09, 0x1a1b: 0x1199, 0x1a1c: 0x0f31, 0x1a1d: 0x0249, + 0x1a1e: 0x0f41, 0x1a1f: 0x0259, 0x1a20: 0x0f51, 0x1a21: 0x0359, 0x1a22: 0x0f61, 0x1a23: 0x0f71, + 0x1a24: 0x00d9, 0x1a25: 0x0f99, 0x1a26: 0x2039, 0x1a27: 0x0269, 0x1a28: 0x01d9, 0x1a29: 0x0fa9, + 0x1a2a: 0x0fb9, 0x1a2b: 0x1089, 0x1a2c: 0x0279, 0x1a2d: 0x0369, 0x1a2e: 0x0289, 0x1a2f: 0x13d1, + 0x1a30: 0x0039, 0x1a31: 0x0ee9, 0x1a32: 0x1159, 0x1a33: 0x0ef9, 0x1a34: 0x0f09, 0x1a35: 0x1199, + 0x1a36: 0x0f31, 0x1a37: 0x0249, 0x1a38: 0x0f41, 0x1a39: 0x0259, 0x1a3a: 0x0f51, 0x1a3b: 0x0359, + 0x1a3c: 0x0f61, 0x1a3d: 0x0f71, 0x1a3e: 0x00d9, 0x1a3f: 0x0f99, + // Block 0x69, offset 0x1a40 + 0x1a40: 0x2039, 0x1a41: 0x0269, 0x1a42: 0x01d9, 0x1a43: 0x0fa9, 0x1a44: 0x0fb9, 0x1a45: 0x1089, + 0x1a46: 0x0279, 0x1a47: 0x0369, 0x1a48: 0x0289, 0x1a49: 0x13d1, 0x1a4a: 0x0039, 0x1a4b: 0x0ee9, + 0x1a4c: 0x1159, 0x1a4d: 0x0ef9, 0x1a4e: 0x0f09, 0x1a4f: 0x1199, 0x1a50: 0x0f31, 0x1a51: 0x0249, + 0x1a52: 0x0f41, 0x1a53: 0x0259, 0x1a54: 0x0f51, 0x1a55: 0x0359, 0x1a56: 0x0f61, 0x1a57: 0x0f71, + 0x1a58: 0x00d9, 0x1a59: 0x0f99, 0x1a5a: 0x2039, 0x1a5b: 0x0269, 0x1a5c: 0x01d9, 0x1a5d: 0x0fa9, + 0x1a5e: 0x0fb9, 0x1a5f: 0x1089, 0x1a60: 0x0279, 0x1a61: 0x0369, 0x1a62: 0x0289, 0x1a63: 0x13d1, + 0x1a64: 0xba81, 0x1a65: 0xba99, 0x1a66: 0x0040, 0x1a67: 0x0040, 0x1a68: 0xbab1, 0x1a69: 0x1099, + 0x1a6a: 0x10b1, 0x1a6b: 0x10c9, 0x1a6c: 0xbac9, 0x1a6d: 0xbae1, 0x1a6e: 0xbaf9, 0x1a6f: 0x1429, + 0x1a70: 0x1a31, 0x1a71: 0xbb11, 0x1a72: 0xbb29, 0x1a73: 0xbb41, 0x1a74: 0xbb59, 0x1a75: 0xbb71, + 0x1a76: 0xbb89, 0x1a77: 0x2109, 0x1a78: 0x1111, 0x1a79: 0x1429, 0x1a7a: 0xbba1, 0x1a7b: 0xbbb9, + 0x1a7c: 0xbbd1, 0x1a7d: 0x10e1, 0x1a7e: 0x10f9, 0x1a7f: 0xbbe9, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x2079, 0x1a81: 0xbc01, 0x1a82: 0xbab1, 0x1a83: 0x1099, 0x1a84: 0x10b1, 0x1a85: 0x10c9, + 0x1a86: 0xbac9, 0x1a87: 0xbae1, 0x1a88: 0xbaf9, 0x1a89: 0x1429, 0x1a8a: 0x1a31, 0x1a8b: 0xbb11, + 0x1a8c: 0xbb29, 0x1a8d: 0xbb41, 0x1a8e: 0xbb59, 0x1a8f: 0xbb71, 0x1a90: 0xbb89, 0x1a91: 0x2109, + 0x1a92: 0x1111, 0x1a93: 0xbba1, 0x1a94: 0xbba1, 0x1a95: 0xbbb9, 0x1a96: 0xbbd1, 0x1a97: 0x10e1, + 0x1a98: 0x10f9, 0x1a99: 0xbbe9, 0x1a9a: 0x2079, 0x1a9b: 0xbc21, 0x1a9c: 0xbac9, 0x1a9d: 0x1429, + 0x1a9e: 0xbb11, 0x1a9f: 0x10e1, 0x1aa0: 0x1111, 0x1aa1: 0x2109, 0x1aa2: 0xbab1, 0x1aa3: 0x1099, + 0x1aa4: 0x10b1, 0x1aa5: 0x10c9, 0x1aa6: 0xbac9, 0x1aa7: 0xbae1, 0x1aa8: 0xbaf9, 0x1aa9: 0x1429, + 0x1aaa: 0x1a31, 0x1aab: 0xbb11, 0x1aac: 0xbb29, 0x1aad: 0xbb41, 0x1aae: 0xbb59, 0x1aaf: 0xbb71, + 0x1ab0: 0xbb89, 0x1ab1: 0x2109, 0x1ab2: 0x1111, 0x1ab3: 0x1429, 0x1ab4: 0xbba1, 0x1ab5: 0xbbb9, + 0x1ab6: 0xbbd1, 0x1ab7: 0x10e1, 0x1ab8: 0x10f9, 0x1ab9: 0xbbe9, 0x1aba: 0x2079, 0x1abb: 0xbc01, + 0x1abc: 0xbab1, 0x1abd: 0x1099, 0x1abe: 0x10b1, 0x1abf: 0x10c9, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0xbac9, 0x1ac1: 0xbae1, 0x1ac2: 0xbaf9, 0x1ac3: 0x1429, 0x1ac4: 0x1a31, 0x1ac5: 0xbb11, + 0x1ac6: 0xbb29, 0x1ac7: 0xbb41, 0x1ac8: 0xbb59, 0x1ac9: 0xbb71, 0x1aca: 0xbb89, 0x1acb: 0x2109, + 0x1acc: 0x1111, 0x1acd: 0xbba1, 0x1ace: 0xbba1, 0x1acf: 0xbbb9, 0x1ad0: 0xbbd1, 0x1ad1: 0x10e1, + 0x1ad2: 0x10f9, 0x1ad3: 0xbbe9, 0x1ad4: 0x2079, 0x1ad5: 0xbc21, 0x1ad6: 0xbac9, 0x1ad7: 0x1429, + 0x1ad8: 0xbb11, 0x1ad9: 0x10e1, 0x1ada: 0x1111, 0x1adb: 0x2109, 0x1adc: 0xbab1, 0x1add: 0x1099, + 0x1ade: 0x10b1, 0x1adf: 0x10c9, 0x1ae0: 0xbac9, 0x1ae1: 0xbae1, 0x1ae2: 0xbaf9, 0x1ae3: 0x1429, + 0x1ae4: 0x1a31, 0x1ae5: 0xbb11, 0x1ae6: 0xbb29, 0x1ae7: 0xbb41, 0x1ae8: 0xbb59, 0x1ae9: 0xbb71, + 0x1aea: 0xbb89, 0x1aeb: 0x2109, 0x1aec: 0x1111, 0x1aed: 0x1429, 0x1aee: 0xbba1, 0x1aef: 0xbbb9, + 0x1af0: 0xbbd1, 0x1af1: 0x10e1, 0x1af2: 0x10f9, 0x1af3: 0xbbe9, 0x1af4: 0x2079, 0x1af5: 0xbc01, + 0x1af6: 0xbab1, 0x1af7: 0x1099, 0x1af8: 0x10b1, 0x1af9: 0x10c9, 0x1afa: 0xbac9, 0x1afb: 0xbae1, + 0x1afc: 0xbaf9, 0x1afd: 0x1429, 0x1afe: 0x1a31, 0x1aff: 0xbb11, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0xbb29, 0x1b01: 0xbb41, 0x1b02: 0xbb59, 0x1b03: 0xbb71, 0x1b04: 0xbb89, 0x1b05: 0x2109, + 0x1b06: 0x1111, 0x1b07: 0xbba1, 0x1b08: 0xbba1, 0x1b09: 0xbbb9, 0x1b0a: 0xbbd1, 0x1b0b: 0x10e1, + 0x1b0c: 0x10f9, 0x1b0d: 0xbbe9, 0x1b0e: 0x2079, 0x1b0f: 0xbc21, 0x1b10: 0xbac9, 0x1b11: 0x1429, + 0x1b12: 0xbb11, 0x1b13: 0x10e1, 0x1b14: 0x1111, 0x1b15: 0x2109, 0x1b16: 0xbab1, 0x1b17: 0x1099, + 0x1b18: 0x10b1, 0x1b19: 0x10c9, 0x1b1a: 0xbac9, 0x1b1b: 0xbae1, 0x1b1c: 0xbaf9, 0x1b1d: 0x1429, + 0x1b1e: 0x1a31, 0x1b1f: 0xbb11, 0x1b20: 0xbb29, 0x1b21: 0xbb41, 0x1b22: 0xbb59, 0x1b23: 0xbb71, + 0x1b24: 0xbb89, 0x1b25: 0x2109, 0x1b26: 0x1111, 0x1b27: 0x1429, 0x1b28: 0xbba1, 0x1b29: 0xbbb9, + 0x1b2a: 0xbbd1, 0x1b2b: 0x10e1, 0x1b2c: 0x10f9, 0x1b2d: 0xbbe9, 0x1b2e: 0x2079, 0x1b2f: 0xbc01, + 0x1b30: 0xbab1, 0x1b31: 0x1099, 0x1b32: 0x10b1, 0x1b33: 0x10c9, 0x1b34: 0xbac9, 0x1b35: 0xbae1, + 0x1b36: 0xbaf9, 0x1b37: 0x1429, 0x1b38: 0x1a31, 0x1b39: 0xbb11, 0x1b3a: 0xbb29, 0x1b3b: 0xbb41, + 0x1b3c: 0xbb59, 0x1b3d: 0xbb71, 0x1b3e: 0xbb89, 0x1b3f: 0x2109, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x1111, 0x1b41: 0xbba1, 0x1b42: 0xbba1, 0x1b43: 0xbbb9, 0x1b44: 0xbbd1, 0x1b45: 0x10e1, + 0x1b46: 0x10f9, 0x1b47: 0xbbe9, 0x1b48: 0x2079, 0x1b49: 0xbc21, 0x1b4a: 0xbac9, 0x1b4b: 0x1429, + 0x1b4c: 0xbb11, 0x1b4d: 0x10e1, 0x1b4e: 0x1111, 0x1b4f: 0x2109, 0x1b50: 0xbab1, 0x1b51: 0x1099, + 0x1b52: 0x10b1, 0x1b53: 0x10c9, 0x1b54: 0xbac9, 0x1b55: 0xbae1, 0x1b56: 0xbaf9, 0x1b57: 0x1429, + 0x1b58: 0x1a31, 0x1b59: 0xbb11, 0x1b5a: 0xbb29, 0x1b5b: 0xbb41, 0x1b5c: 0xbb59, 0x1b5d: 0xbb71, + 0x1b5e: 0xbb89, 0x1b5f: 0x2109, 0x1b60: 0x1111, 0x1b61: 0x1429, 0x1b62: 0xbba1, 0x1b63: 0xbbb9, + 0x1b64: 0xbbd1, 0x1b65: 0x10e1, 0x1b66: 0x10f9, 0x1b67: 0xbbe9, 0x1b68: 0x2079, 0x1b69: 0xbc01, + 0x1b6a: 0xbab1, 0x1b6b: 0x1099, 0x1b6c: 0x10b1, 0x1b6d: 0x10c9, 0x1b6e: 0xbac9, 0x1b6f: 0xbae1, + 0x1b70: 0xbaf9, 0x1b71: 0x1429, 0x1b72: 0x1a31, 0x1b73: 0xbb11, 0x1b74: 0xbb29, 0x1b75: 0xbb41, + 0x1b76: 0xbb59, 0x1b77: 0xbb71, 0x1b78: 0xbb89, 0x1b79: 0x2109, 0x1b7a: 0x1111, 0x1b7b: 0xbba1, + 0x1b7c: 0xbba1, 0x1b7d: 0xbbb9, 0x1b7e: 0xbbd1, 0x1b7f: 0x10e1, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x10f9, 0x1b81: 0xbbe9, 0x1b82: 0x2079, 0x1b83: 0xbc21, 0x1b84: 0xbac9, 0x1b85: 0x1429, + 0x1b86: 0xbb11, 0x1b87: 0x10e1, 0x1b88: 0x1111, 0x1b89: 0x2109, 0x1b8a: 0xbc41, 0x1b8b: 0xbc41, + 0x1b8c: 0x0040, 0x1b8d: 0x0040, 0x1b8e: 0x1f41, 0x1b8f: 0x00c9, 0x1b90: 0x0069, 0x1b91: 0x0079, + 0x1b92: 0x1f51, 0x1b93: 0x1f61, 0x1b94: 0x1f71, 0x1b95: 0x1f81, 0x1b96: 0x1f91, 0x1b97: 0x1fa1, + 0x1b98: 0x1f41, 0x1b99: 0x00c9, 0x1b9a: 0x0069, 0x1b9b: 0x0079, 0x1b9c: 0x1f51, 0x1b9d: 0x1f61, + 0x1b9e: 0x1f71, 0x1b9f: 0x1f81, 0x1ba0: 0x1f91, 0x1ba1: 0x1fa1, 0x1ba2: 0x1f41, 0x1ba3: 0x00c9, + 0x1ba4: 0x0069, 0x1ba5: 0x0079, 0x1ba6: 0x1f51, 0x1ba7: 0x1f61, 0x1ba8: 0x1f71, 0x1ba9: 0x1f81, + 0x1baa: 0x1f91, 0x1bab: 0x1fa1, 0x1bac: 0x1f41, 0x1bad: 0x00c9, 0x1bae: 0x0069, 0x1baf: 0x0079, + 0x1bb0: 0x1f51, 0x1bb1: 0x1f61, 0x1bb2: 0x1f71, 0x1bb3: 0x1f81, 0x1bb4: 0x1f91, 0x1bb5: 0x1fa1, + 0x1bb6: 0x1f41, 0x1bb7: 0x00c9, 0x1bb8: 0x0069, 0x1bb9: 0x0079, 0x1bba: 0x1f51, 0x1bbb: 0x1f61, + 0x1bbc: 0x1f71, 0x1bbd: 0x1f81, 0x1bbe: 0x1f91, 0x1bbf: 0x1fa1, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0xe115, 0x1bc1: 0xe115, 0x1bc2: 0xe135, 0x1bc3: 0xe135, 0x1bc4: 0xe115, 0x1bc5: 0xe115, + 0x1bc6: 0xe175, 0x1bc7: 0xe175, 0x1bc8: 0xe115, 0x1bc9: 0xe115, 0x1bca: 0xe135, 0x1bcb: 0xe135, + 0x1bcc: 0xe115, 0x1bcd: 0xe115, 0x1bce: 0xe1f5, 0x1bcf: 0xe1f5, 0x1bd0: 0xe115, 0x1bd1: 0xe115, + 0x1bd2: 0xe135, 0x1bd3: 0xe135, 0x1bd4: 0xe115, 0x1bd5: 0xe115, 0x1bd6: 0xe175, 0x1bd7: 0xe175, + 0x1bd8: 0xe115, 0x1bd9: 0xe115, 0x1bda: 0xe135, 0x1bdb: 0xe135, 0x1bdc: 0xe115, 0x1bdd: 0xe115, + 0x1bde: 0x8b05, 0x1bdf: 0x8b05, 0x1be0: 0x04b5, 0x1be1: 0x04b5, 0x1be2: 0x0208, 0x1be3: 0x0208, + 0x1be4: 0x0208, 0x1be5: 0x0208, 0x1be6: 0x0208, 0x1be7: 0x0208, 0x1be8: 0x0208, 0x1be9: 0x0208, + 0x1bea: 0x0208, 0x1beb: 0x0208, 0x1bec: 0x0208, 0x1bed: 0x0208, 0x1bee: 0x0208, 0x1bef: 0x0208, + 0x1bf0: 0x0208, 0x1bf1: 0x0208, 0x1bf2: 0x0208, 0x1bf3: 0x0208, 0x1bf4: 0x0208, 0x1bf5: 0x0208, + 0x1bf6: 0x0208, 0x1bf7: 0x0208, 0x1bf8: 0x0208, 0x1bf9: 0x0208, 0x1bfa: 0x0208, 0x1bfb: 0x0208, + 0x1bfc: 0x0208, 0x1bfd: 0x0208, 0x1bfe: 0x0208, 0x1bff: 0x0208, + // Block 0x70, offset 0x1c00 + 0x1c00: 0xb189, 0x1c01: 0xb1a1, 0x1c02: 0xb201, 0x1c03: 0xb249, 0x1c04: 0x0040, 0x1c05: 0xb411, + 0x1c06: 0xb291, 0x1c07: 0xb219, 0x1c08: 0xb309, 0x1c09: 0xb429, 0x1c0a: 0xb399, 0x1c0b: 0xb3b1, + 0x1c0c: 0xb3c9, 0x1c0d: 0xb3e1, 0x1c0e: 0xb2a9, 0x1c0f: 0xb339, 0x1c10: 0xb369, 0x1c11: 0xb2d9, + 0x1c12: 0xb381, 0x1c13: 0xb279, 0x1c14: 0xb2c1, 0x1c15: 0xb1d1, 0x1c16: 0xb1e9, 0x1c17: 0xb231, + 0x1c18: 0xb261, 0x1c19: 0xb2f1, 0x1c1a: 0xb321, 0x1c1b: 0xb351, 0x1c1c: 0xbc59, 0x1c1d: 0x7949, + 0x1c1e: 0xbc71, 0x1c1f: 0xbc89, 0x1c20: 0x0040, 0x1c21: 0xb1a1, 0x1c22: 0xb201, 0x1c23: 0x0040, + 0x1c24: 0xb3f9, 0x1c25: 0x0040, 0x1c26: 0x0040, 0x1c27: 0xb219, 0x1c28: 0x0040, 0x1c29: 0xb429, + 0x1c2a: 0xb399, 0x1c2b: 0xb3b1, 0x1c2c: 0xb3c9, 0x1c2d: 0xb3e1, 0x1c2e: 0xb2a9, 0x1c2f: 0xb339, + 0x1c30: 0xb369, 0x1c31: 0xb2d9, 0x1c32: 0xb381, 0x1c33: 0x0040, 0x1c34: 0xb2c1, 0x1c35: 0xb1d1, + 0x1c36: 0xb1e9, 0x1c37: 0xb231, 0x1c38: 0x0040, 0x1c39: 0xb2f1, 0x1c3a: 0x0040, 0x1c3b: 0xb351, + 0x1c3c: 0x0040, 0x1c3d: 0x0040, 0x1c3e: 0x0040, 0x1c3f: 0x0040, + // Block 0x71, offset 0x1c40 + 0x1c40: 0x0040, 0x1c41: 0x0040, 0x1c42: 0xb201, 0x1c43: 0x0040, 0x1c44: 0x0040, 0x1c45: 0x0040, + 0x1c46: 0x0040, 0x1c47: 0xb219, 0x1c48: 0x0040, 0x1c49: 0xb429, 0x1c4a: 0x0040, 0x1c4b: 0xb3b1, + 0x1c4c: 0x0040, 0x1c4d: 0xb3e1, 0x1c4e: 0xb2a9, 0x1c4f: 0xb339, 0x1c50: 0x0040, 0x1c51: 0xb2d9, + 0x1c52: 0xb381, 0x1c53: 0x0040, 0x1c54: 0xb2c1, 0x1c55: 0x0040, 0x1c56: 0x0040, 0x1c57: 0xb231, + 0x1c58: 0x0040, 0x1c59: 0xb2f1, 0x1c5a: 0x0040, 0x1c5b: 0xb351, 0x1c5c: 0x0040, 0x1c5d: 0x7949, + 0x1c5e: 0x0040, 0x1c5f: 0xbc89, 0x1c60: 0x0040, 0x1c61: 0xb1a1, 0x1c62: 0xb201, 0x1c63: 0x0040, + 0x1c64: 0xb3f9, 0x1c65: 0x0040, 0x1c66: 0x0040, 0x1c67: 0xb219, 0x1c68: 0xb309, 0x1c69: 0xb429, + 0x1c6a: 0xb399, 0x1c6b: 0x0040, 0x1c6c: 0xb3c9, 0x1c6d: 0xb3e1, 0x1c6e: 0xb2a9, 0x1c6f: 0xb339, + 0x1c70: 0xb369, 0x1c71: 0xb2d9, 0x1c72: 0xb381, 0x1c73: 0x0040, 0x1c74: 0xb2c1, 0x1c75: 0xb1d1, + 0x1c76: 0xb1e9, 0x1c77: 0xb231, 0x1c78: 0x0040, 0x1c79: 0xb2f1, 0x1c7a: 0xb321, 0x1c7b: 0xb351, + 0x1c7c: 0xbc59, 0x1c7d: 0x0040, 0x1c7e: 0xbc71, 0x1c7f: 0x0040, + // Block 0x72, offset 0x1c80 + 0x1c80: 0xb189, 0x1c81: 0xb1a1, 0x1c82: 0xb201, 0x1c83: 0xb249, 0x1c84: 0xb3f9, 0x1c85: 0xb411, + 0x1c86: 0xb291, 0x1c87: 0xb219, 0x1c88: 0xb309, 0x1c89: 0xb429, 0x1c8a: 0x0040, 0x1c8b: 0xb3b1, + 0x1c8c: 0xb3c9, 0x1c8d: 0xb3e1, 0x1c8e: 0xb2a9, 0x1c8f: 0xb339, 0x1c90: 0xb369, 0x1c91: 0xb2d9, + 0x1c92: 0xb381, 0x1c93: 0xb279, 0x1c94: 0xb2c1, 0x1c95: 0xb1d1, 0x1c96: 0xb1e9, 0x1c97: 0xb231, + 0x1c98: 0xb261, 0x1c99: 0xb2f1, 0x1c9a: 0xb321, 0x1c9b: 0xb351, 0x1c9c: 0x0040, 0x1c9d: 0x0040, + 0x1c9e: 0x0040, 0x1c9f: 0x0040, 0x1ca0: 0x0040, 0x1ca1: 0xb1a1, 0x1ca2: 0xb201, 0x1ca3: 0xb249, + 0x1ca4: 0x0040, 0x1ca5: 0xb411, 0x1ca6: 0xb291, 0x1ca7: 0xb219, 0x1ca8: 0xb309, 0x1ca9: 0xb429, + 0x1caa: 0x0040, 0x1cab: 0xb3b1, 0x1cac: 0xb3c9, 0x1cad: 0xb3e1, 0x1cae: 0xb2a9, 0x1caf: 0xb339, + 0x1cb0: 0xb369, 0x1cb1: 0xb2d9, 0x1cb2: 0xb381, 0x1cb3: 0xb279, 0x1cb4: 0xb2c1, 0x1cb5: 0xb1d1, + 0x1cb6: 0xb1e9, 0x1cb7: 0xb231, 0x1cb8: 0xb261, 0x1cb9: 0xb2f1, 0x1cba: 0xb321, 0x1cbb: 0xb351, + 0x1cbc: 0x0040, 0x1cbd: 0x0040, 0x1cbe: 0x0040, 0x1cbf: 0x0040, + // Block 0x73, offset 0x1cc0 + 0x1cc0: 0x0040, 0x1cc1: 0xbca2, 0x1cc2: 0xbcba, 0x1cc3: 0xbcd2, 0x1cc4: 0xbcea, 0x1cc5: 0xbd02, + 0x1cc6: 0xbd1a, 0x1cc7: 0xbd32, 0x1cc8: 0xbd4a, 0x1cc9: 0xbd62, 0x1cca: 0xbd7a, 0x1ccb: 0x0018, + 0x1ccc: 0x0018, 0x1ccd: 0x0040, 0x1cce: 0x0040, 0x1ccf: 0x0040, 0x1cd0: 0xbd92, 0x1cd1: 0xbdb2, + 0x1cd2: 0xbdd2, 0x1cd3: 0xbdf2, 0x1cd4: 0xbe12, 0x1cd5: 0xbe32, 0x1cd6: 0xbe52, 0x1cd7: 0xbe72, + 0x1cd8: 0xbe92, 0x1cd9: 0xbeb2, 0x1cda: 0xbed2, 0x1cdb: 0xbef2, 0x1cdc: 0xbf12, 0x1cdd: 0xbf32, + 0x1cde: 0xbf52, 0x1cdf: 0xbf72, 0x1ce0: 0xbf92, 0x1ce1: 0xbfb2, 0x1ce2: 0xbfd2, 0x1ce3: 0xbff2, + 0x1ce4: 0xc012, 0x1ce5: 0xc032, 0x1ce6: 0xc052, 0x1ce7: 0xc072, 0x1ce8: 0xc092, 0x1ce9: 0xc0b2, + 0x1cea: 0xc0d1, 0x1ceb: 0x1159, 0x1cec: 0x0269, 0x1ced: 0x6671, 0x1cee: 0xc111, 0x1cef: 0x0040, + 0x1cf0: 0x0039, 0x1cf1: 0x0ee9, 0x1cf2: 0x1159, 0x1cf3: 0x0ef9, 0x1cf4: 0x0f09, 0x1cf5: 0x1199, + 0x1cf6: 0x0f31, 0x1cf7: 0x0249, 0x1cf8: 0x0f41, 0x1cf9: 0x0259, 0x1cfa: 0x0f51, 0x1cfb: 0x0359, + 0x1cfc: 0x0f61, 0x1cfd: 0x0f71, 0x1cfe: 0x00d9, 0x1cff: 0x0f99, + // Block 0x74, offset 0x1d00 + 0x1d00: 0x2039, 0x1d01: 0x0269, 0x1d02: 0x01d9, 0x1d03: 0x0fa9, 0x1d04: 0x0fb9, 0x1d05: 0x1089, + 0x1d06: 0x0279, 0x1d07: 0x0369, 0x1d08: 0x0289, 0x1d09: 0x13d1, 0x1d0a: 0xc129, 0x1d0b: 0x65b1, + 0x1d0c: 0xc141, 0x1d0d: 0x1441, 0x1d0e: 0xc159, 0x1d0f: 0xc179, 0x1d10: 0x0018, 0x1d11: 0x0018, + 0x1d12: 0x0018, 0x1d13: 0x0018, 0x1d14: 0x0018, 0x1d15: 0x0018, 0x1d16: 0x0018, 0x1d17: 0x0018, + 0x1d18: 0x0018, 0x1d19: 0x0018, 0x1d1a: 0x0018, 0x1d1b: 0x0018, 0x1d1c: 0x0018, 0x1d1d: 0x0018, + 0x1d1e: 0x0018, 0x1d1f: 0x0018, 0x1d20: 0x0018, 0x1d21: 0x0018, 0x1d22: 0x0018, 0x1d23: 0x0018, + 0x1d24: 0x0018, 0x1d25: 0x0018, 0x1d26: 0x0018, 0x1d27: 0x0018, 0x1d28: 0x0018, 0x1d29: 0x0018, + 0x1d2a: 0xc191, 0x1d2b: 0xc1a9, 0x1d2c: 0x0040, 0x1d2d: 0x0040, 0x1d2e: 0x0040, 0x1d2f: 0x0040, + 0x1d30: 0x0018, 0x1d31: 0x0018, 0x1d32: 0x0018, 0x1d33: 0x0018, 0x1d34: 0x0018, 0x1d35: 0x0018, + 0x1d36: 0x0018, 0x1d37: 0x0018, 0x1d38: 0x0018, 0x1d39: 0x0018, 0x1d3a: 0x0018, 0x1d3b: 0x0018, + 0x1d3c: 0x0018, 0x1d3d: 0x0018, 0x1d3e: 0x0018, 0x1d3f: 0x0018, + // Block 0x75, offset 0x1d40 + 0x1d40: 0xc1d9, 0x1d41: 0xc211, 0x1d42: 0xc249, 0x1d43: 0x0040, 0x1d44: 0x0040, 0x1d45: 0x0040, + 0x1d46: 0x0040, 0x1d47: 0x0040, 0x1d48: 0x0040, 0x1d49: 0x0040, 0x1d4a: 0x0040, 0x1d4b: 0x0040, + 0x1d4c: 0x0040, 0x1d4d: 0x0040, 0x1d4e: 0x0040, 0x1d4f: 0x0040, 0x1d50: 0xc269, 0x1d51: 0xc289, + 0x1d52: 0xc2a9, 0x1d53: 0xc2c9, 0x1d54: 0xc2e9, 0x1d55: 0xc309, 0x1d56: 0xc329, 0x1d57: 0xc349, + 0x1d58: 0xc369, 0x1d59: 0xc389, 0x1d5a: 0xc3a9, 0x1d5b: 0xc3c9, 0x1d5c: 0xc3e9, 0x1d5d: 0xc409, + 0x1d5e: 0xc429, 0x1d5f: 0xc449, 0x1d60: 0xc469, 0x1d61: 0xc489, 0x1d62: 0xc4a9, 0x1d63: 0xc4c9, + 0x1d64: 0xc4e9, 0x1d65: 0xc509, 0x1d66: 0xc529, 0x1d67: 0xc549, 0x1d68: 0xc569, 0x1d69: 0xc589, + 0x1d6a: 0xc5a9, 0x1d6b: 0xc5c9, 0x1d6c: 0xc5e9, 0x1d6d: 0xc609, 0x1d6e: 0xc629, 0x1d6f: 0xc649, + 0x1d70: 0xc669, 0x1d71: 0xc689, 0x1d72: 0xc6a9, 0x1d73: 0xc6c9, 0x1d74: 0xc6e9, 0x1d75: 0xc709, + 0x1d76: 0xc729, 0x1d77: 0xc749, 0x1d78: 0xc769, 0x1d79: 0xc789, 0x1d7a: 0xc7a9, 0x1d7b: 0xc7c9, + 0x1d7c: 0x0040, 0x1d7d: 0x0040, 0x1d7e: 0x0040, 0x1d7f: 0x0040, + // Block 0x76, offset 0x1d80 + 0x1d80: 0xcaf9, 0x1d81: 0xcb19, 0x1d82: 0xcb39, 0x1d83: 0x8b1d, 0x1d84: 0xcb59, 0x1d85: 0xcb79, + 0x1d86: 0xcb99, 0x1d87: 0xcbb9, 0x1d88: 0xcbd9, 0x1d89: 0xcbf9, 0x1d8a: 0xcc19, 0x1d8b: 0xcc39, + 0x1d8c: 0xcc59, 0x1d8d: 0x8b3d, 0x1d8e: 0xcc79, 0x1d8f: 0xcc99, 0x1d90: 0xccb9, 0x1d91: 0xccd9, + 0x1d92: 0x8b5d, 0x1d93: 0xccf9, 0x1d94: 0xcd19, 0x1d95: 0xc429, 0x1d96: 0x8b7d, 0x1d97: 0xcd39, + 0x1d98: 0xcd59, 0x1d99: 0xcd79, 0x1d9a: 0xcd99, 0x1d9b: 0xcdb9, 0x1d9c: 0x8b9d, 0x1d9d: 0xcdd9, + 0x1d9e: 0xcdf9, 0x1d9f: 0xce19, 0x1da0: 0xce39, 0x1da1: 0xce59, 0x1da2: 0xc789, 0x1da3: 0xce79, + 0x1da4: 0xce99, 0x1da5: 0xceb9, 0x1da6: 0xced9, 0x1da7: 0xcef9, 0x1da8: 0xcf19, 0x1da9: 0xcf39, + 0x1daa: 0xcf59, 0x1dab: 0xcf79, 0x1dac: 0xcf99, 0x1dad: 0xcfb9, 0x1dae: 0xcfd9, 0x1daf: 0xcff9, + 0x1db0: 0xd019, 0x1db1: 0xd039, 0x1db2: 0xd039, 0x1db3: 0xd039, 0x1db4: 0x8bbd, 0x1db5: 0xd059, + 0x1db6: 0xd079, 0x1db7: 0xd099, 0x1db8: 0x8bdd, 0x1db9: 0xd0b9, 0x1dba: 0xd0d9, 0x1dbb: 0xd0f9, + 0x1dbc: 0xd119, 0x1dbd: 0xd139, 0x1dbe: 0xd159, 0x1dbf: 0xd179, + // Block 0x77, offset 0x1dc0 + 0x1dc0: 0xd199, 0x1dc1: 0xd1b9, 0x1dc2: 0xd1d9, 0x1dc3: 0xd1f9, 0x1dc4: 0xd219, 0x1dc5: 0xd239, + 0x1dc6: 0xd239, 0x1dc7: 0xd259, 0x1dc8: 0xd279, 0x1dc9: 0xd299, 0x1dca: 0xd2b9, 0x1dcb: 0xd2d9, + 0x1dcc: 0xd2f9, 0x1dcd: 0xd319, 0x1dce: 0xd339, 0x1dcf: 0xd359, 0x1dd0: 0xd379, 0x1dd1: 0xd399, + 0x1dd2: 0xd3b9, 0x1dd3: 0xd3d9, 0x1dd4: 0xd3f9, 0x1dd5: 0xd419, 0x1dd6: 0xd439, 0x1dd7: 0xd459, + 0x1dd8: 0xd479, 0x1dd9: 0x8bfd, 0x1dda: 0xd499, 0x1ddb: 0xd4b9, 0x1ddc: 0xd4d9, 0x1ddd: 0xc309, + 0x1dde: 0xd4f9, 0x1ddf: 0xd519, 0x1de0: 0x8c1d, 0x1de1: 0x8c3d, 0x1de2: 0xd539, 0x1de3: 0xd559, + 0x1de4: 0xd579, 0x1de5: 0xd599, 0x1de6: 0xd5b9, 0x1de7: 0xd5d9, 0x1de8: 0x0040, 0x1de9: 0xd5f9, + 0x1dea: 0xd619, 0x1deb: 0xd619, 0x1dec: 0x8c5d, 0x1ded: 0xd639, 0x1dee: 0xd659, 0x1def: 0xd679, + 0x1df0: 0xd699, 0x1df1: 0x8c7d, 0x1df2: 0xd6b9, 0x1df3: 0xd6d9, 0x1df4: 0x0040, 0x1df5: 0xd6f9, + 0x1df6: 0xd719, 0x1df7: 0xd739, 0x1df8: 0xd759, 0x1df9: 0xd779, 0x1dfa: 0xd799, 0x1dfb: 0x8c9d, + 0x1dfc: 0xd7b9, 0x1dfd: 0x8cbd, 0x1dfe: 0xd7d9, 0x1dff: 0xd7f9, + // Block 0x78, offset 0x1e00 + 0x1e00: 0xd819, 0x1e01: 0xd839, 0x1e02: 0xd859, 0x1e03: 0xd879, 0x1e04: 0xd899, 0x1e05: 0xd8b9, + 0x1e06: 0xd8d9, 0x1e07: 0xd8f9, 0x1e08: 0xd919, 0x1e09: 0x8cdd, 0x1e0a: 0xd939, 0x1e0b: 0xd959, + 0x1e0c: 0xd979, 0x1e0d: 0xd999, 0x1e0e: 0xd9b9, 0x1e0f: 0x8cfd, 0x1e10: 0xd9d9, 0x1e11: 0x8d1d, + 0x1e12: 0x8d3d, 0x1e13: 0xd9f9, 0x1e14: 0xda19, 0x1e15: 0xda19, 0x1e16: 0xda39, 0x1e17: 0x8d5d, + 0x1e18: 0x8d7d, 0x1e19: 0xda59, 0x1e1a: 0xda79, 0x1e1b: 0xda99, 0x1e1c: 0xdab9, 0x1e1d: 0xdad9, + 0x1e1e: 0xdaf9, 0x1e1f: 0xdb19, 0x1e20: 0xdb39, 0x1e21: 0xdb59, 0x1e22: 0xdb79, 0x1e23: 0xdb99, + 0x1e24: 0x8d9d, 0x1e25: 0xdbb9, 0x1e26: 0xdbd9, 0x1e27: 0xdbf9, 0x1e28: 0xdc19, 0x1e29: 0xdbf9, + 0x1e2a: 0xdc39, 0x1e2b: 0xdc59, 0x1e2c: 0xdc79, 0x1e2d: 0xdc99, 0x1e2e: 0xdcb9, 0x1e2f: 0xdcd9, + 0x1e30: 0xdcf9, 0x1e31: 0xdd19, 0x1e32: 0xdd39, 0x1e33: 0xdd59, 0x1e34: 0xdd79, 0x1e35: 0xdd99, + 0x1e36: 0xddb9, 0x1e37: 0xddd9, 0x1e38: 0x8dbd, 0x1e39: 0xddf9, 0x1e3a: 0xde19, 0x1e3b: 0xde39, + 0x1e3c: 0xde59, 0x1e3d: 0xde79, 0x1e3e: 0x8ddd, 0x1e3f: 0xde99, + // Block 0x79, offset 0x1e40 + 0x1e40: 0xe599, 0x1e41: 0xe5b9, 0x1e42: 0xe5d9, 0x1e43: 0xe5f9, 0x1e44: 0xe619, 0x1e45: 0xe639, + 0x1e46: 0x8efd, 0x1e47: 0xe659, 0x1e48: 0xe679, 0x1e49: 0xe699, 0x1e4a: 0xe6b9, 0x1e4b: 0xe6d9, + 0x1e4c: 0xe6f9, 0x1e4d: 0x8f1d, 0x1e4e: 0xe719, 0x1e4f: 0xe739, 0x1e50: 0x8f3d, 0x1e51: 0x8f5d, + 0x1e52: 0xe759, 0x1e53: 0xe779, 0x1e54: 0xe799, 0x1e55: 0xe7b9, 0x1e56: 0xe7d9, 0x1e57: 0xe7f9, + 0x1e58: 0xe819, 0x1e59: 0xe839, 0x1e5a: 0xe859, 0x1e5b: 0x8f7d, 0x1e5c: 0xe879, 0x1e5d: 0x8f9d, + 0x1e5e: 0xe899, 0x1e5f: 0x0040, 0x1e60: 0xe8b9, 0x1e61: 0xe8d9, 0x1e62: 0xe8f9, 0x1e63: 0x8fbd, + 0x1e64: 0xe919, 0x1e65: 0xe939, 0x1e66: 0x8fdd, 0x1e67: 0x8ffd, 0x1e68: 0xe959, 0x1e69: 0xe979, + 0x1e6a: 0xe999, 0x1e6b: 0xe9b9, 0x1e6c: 0xe9d9, 0x1e6d: 0xe9d9, 0x1e6e: 0xe9f9, 0x1e6f: 0xea19, + 0x1e70: 0xea39, 0x1e71: 0xea59, 0x1e72: 0xea79, 0x1e73: 0xea99, 0x1e74: 0xeab9, 0x1e75: 0x901d, + 0x1e76: 0xead9, 0x1e77: 0x903d, 0x1e78: 0xeaf9, 0x1e79: 0x905d, 0x1e7a: 0xeb19, 0x1e7b: 0x907d, + 0x1e7c: 0x909d, 0x1e7d: 0x90bd, 0x1e7e: 0xeb39, 0x1e7f: 0xeb59, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0xeb79, 0x1e81: 0x90dd, 0x1e82: 0x90fd, 0x1e83: 0x911d, 0x1e84: 0x913d, 0x1e85: 0xeb99, + 0x1e86: 0xebb9, 0x1e87: 0xebb9, 0x1e88: 0xebd9, 0x1e89: 0xebf9, 0x1e8a: 0xec19, 0x1e8b: 0xec39, + 0x1e8c: 0xec59, 0x1e8d: 0x915d, 0x1e8e: 0xec79, 0x1e8f: 0xec99, 0x1e90: 0xecb9, 0x1e91: 0xecd9, + 0x1e92: 0x917d, 0x1e93: 0xecf9, 0x1e94: 0x919d, 0x1e95: 0x91bd, 0x1e96: 0xed19, 0x1e97: 0xed39, + 0x1e98: 0xed59, 0x1e99: 0xed79, 0x1e9a: 0xed99, 0x1e9b: 0xedb9, 0x1e9c: 0x91dd, 0x1e9d: 0x91fd, + 0x1e9e: 0x921d, 0x1e9f: 0x0040, 0x1ea0: 0xedd9, 0x1ea1: 0x923d, 0x1ea2: 0xedf9, 0x1ea3: 0xee19, + 0x1ea4: 0xee39, 0x1ea5: 0x925d, 0x1ea6: 0xee59, 0x1ea7: 0xee79, 0x1ea8: 0xee99, 0x1ea9: 0xeeb9, + 0x1eaa: 0xeed9, 0x1eab: 0x927d, 0x1eac: 0xeef9, 0x1ead: 0xef19, 0x1eae: 0xef39, 0x1eaf: 0xef59, + 0x1eb0: 0xef79, 0x1eb1: 0xef99, 0x1eb2: 0x929d, 0x1eb3: 0x92bd, 0x1eb4: 0xefb9, 0x1eb5: 0x92dd, + 0x1eb6: 0xefd9, 0x1eb7: 0x92fd, 0x1eb8: 0xeff9, 0x1eb9: 0xf019, 0x1eba: 0xf039, 0x1ebb: 0x931d, + 0x1ebc: 0x933d, 0x1ebd: 0xf059, 0x1ebe: 0x935d, 0x1ebf: 0xf079, + // Block 0x7b, offset 0x1ec0 + 0x1ec0: 0xf6b9, 0x1ec1: 0xf6d9, 0x1ec2: 0xf6f9, 0x1ec3: 0xf719, 0x1ec4: 0xf739, 0x1ec5: 0x951d, + 0x1ec6: 0xf759, 0x1ec7: 0xf779, 0x1ec8: 0xf799, 0x1ec9: 0xf7b9, 0x1eca: 0xf7d9, 0x1ecb: 0x953d, + 0x1ecc: 0x955d, 0x1ecd: 0xf7f9, 0x1ece: 0xf819, 0x1ecf: 0xf839, 0x1ed0: 0xf859, 0x1ed1: 0xf879, + 0x1ed2: 0xf899, 0x1ed3: 0x957d, 0x1ed4: 0xf8b9, 0x1ed5: 0xf8d9, 0x1ed6: 0xf8f9, 0x1ed7: 0xf919, + 0x1ed8: 0x959d, 0x1ed9: 0x95bd, 0x1eda: 0xf939, 0x1edb: 0xf959, 0x1edc: 0xf979, 0x1edd: 0x95dd, + 0x1ede: 0xf999, 0x1edf: 0xf9b9, 0x1ee0: 0x6815, 0x1ee1: 0x95fd, 0x1ee2: 0xf9d9, 0x1ee3: 0xf9f9, + 0x1ee4: 0xfa19, 0x1ee5: 0x961d, 0x1ee6: 0xfa39, 0x1ee7: 0xfa59, 0x1ee8: 0xfa79, 0x1ee9: 0xfa99, + 0x1eea: 0xfab9, 0x1eeb: 0xfad9, 0x1eec: 0xfaf9, 0x1eed: 0x963d, 0x1eee: 0xfb19, 0x1eef: 0xfb39, + 0x1ef0: 0xfb59, 0x1ef1: 0x965d, 0x1ef2: 0xfb79, 0x1ef3: 0xfb99, 0x1ef4: 0xfbb9, 0x1ef5: 0xfbd9, + 0x1ef6: 0x7b35, 0x1ef7: 0x967d, 0x1ef8: 0xfbf9, 0x1ef9: 0xfc19, 0x1efa: 0xfc39, 0x1efb: 0x969d, + 0x1efc: 0xfc59, 0x1efd: 0x96bd, 0x1efe: 0xfc79, 0x1eff: 0xfc79, + // Block 0x7c, offset 0x1f00 + 0x1f00: 0xfc99, 0x1f01: 0x96dd, 0x1f02: 0xfcb9, 0x1f03: 0xfcd9, 0x1f04: 0xfcf9, 0x1f05: 0xfd19, + 0x1f06: 0xfd39, 0x1f07: 0xfd59, 0x1f08: 0xfd79, 0x1f09: 0x96fd, 0x1f0a: 0xfd99, 0x1f0b: 0xfdb9, + 0x1f0c: 0xfdd9, 0x1f0d: 0xfdf9, 0x1f0e: 0xfe19, 0x1f0f: 0xfe39, 0x1f10: 0x971d, 0x1f11: 0xfe59, + 0x1f12: 0x973d, 0x1f13: 0x975d, 0x1f14: 0x977d, 0x1f15: 0xfe79, 0x1f16: 0xfe99, 0x1f17: 0xfeb9, + 0x1f18: 0xfed9, 0x1f19: 0xfef9, 0x1f1a: 0xff19, 0x1f1b: 0xff39, 0x1f1c: 0xff59, 0x1f1d: 0x979d, + 0x1f1e: 0x0040, 0x1f1f: 0x0040, 0x1f20: 0x0040, 0x1f21: 0x0040, 0x1f22: 0x0040, 0x1f23: 0x0040, + 0x1f24: 0x0040, 0x1f25: 0x0040, 0x1f26: 0x0040, 0x1f27: 0x0040, 0x1f28: 0x0040, 0x1f29: 0x0040, + 0x1f2a: 0x0040, 0x1f2b: 0x0040, 0x1f2c: 0x0040, 0x1f2d: 0x0040, 0x1f2e: 0x0040, 0x1f2f: 0x0040, + 0x1f30: 0x0040, 0x1f31: 0x0040, 0x1f32: 0x0040, 0x1f33: 0x0040, 0x1f34: 0x0040, 0x1f35: 0x0040, + 0x1f36: 0x0040, 0x1f37: 0x0040, 0x1f38: 0x0040, 0x1f39: 0x0040, 0x1f3a: 0x0040, 0x1f3b: 0x0040, + 0x1f3c: 0x0040, 0x1f3d: 0x0040, 0x1f3e: 0x0040, 0x1f3f: 0x0040, +} + +// idnaIndex: 35 blocks, 2240 entries, 4480 bytes +// Block 0 is the zero block. +var idnaIndex = [2240]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x7b, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x04, 0xc7: 0x05, + 0xc8: 0x06, 0xc9: 0x7c, 0xca: 0x7d, 0xcb: 0x07, 0xcc: 0x7e, 0xcd: 0x08, 0xce: 0x09, 0xcf: 0x0a, + 0xd0: 0x7f, 0xd1: 0x0b, 0xd2: 0x0c, 0xd3: 0x0d, 0xd4: 0x0e, 0xd5: 0x80, 0xd6: 0x81, 0xd7: 0x82, + 0xd8: 0x0f, 0xd9: 0x83, 0xda: 0x84, 0xdb: 0x10, 0xdc: 0x11, 0xdd: 0x85, 0xde: 0x86, 0xdf: 0x87, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, 0xe5: 0x07, 0xe6: 0x07, 0xe7: 0x07, + 0xe8: 0x07, 0xe9: 0x08, 0xea: 0x09, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x0a, 0xee: 0x0b, 0xef: 0x0c, + 0xf0: 0x1c, 0xf1: 0x1d, 0xf2: 0x1d, 0xf3: 0x1f, 0xf4: 0x20, + // Block 0x4, offset 0x100 + 0x120: 0x88, 0x121: 0x89, 0x122: 0x8a, 0x123: 0x8b, 0x124: 0x8c, 0x125: 0x12, 0x126: 0x13, 0x127: 0x14, + 0x128: 0x15, 0x129: 0x16, 0x12a: 0x17, 0x12b: 0x18, 0x12c: 0x19, 0x12d: 0x1a, 0x12e: 0x1b, 0x12f: 0x8d, + 0x130: 0x8e, 0x131: 0x1c, 0x132: 0x1d, 0x133: 0x1e, 0x134: 0x8f, 0x135: 0x1f, 0x136: 0x90, 0x137: 0x91, + 0x138: 0x92, 0x139: 0x93, 0x13a: 0x20, 0x13b: 0x94, 0x13c: 0x95, 0x13d: 0x21, 0x13e: 0x22, 0x13f: 0x96, + // Block 0x5, offset 0x140 + 0x140: 0x97, 0x141: 0x98, 0x142: 0x99, 0x143: 0x9a, 0x144: 0x9b, 0x145: 0x9c, 0x146: 0x9b, 0x147: 0x9b, + 0x148: 0x9d, 0x149: 0x9e, 0x14a: 0x9f, 0x14b: 0xa0, 0x14c: 0xa1, 0x14d: 0xa2, 0x14e: 0xa3, 0x14f: 0xa4, + 0x150: 0xa5, 0x151: 0x9d, 0x152: 0x9d, 0x153: 0x9d, 0x154: 0x9d, 0x155: 0x9d, 0x156: 0x9d, 0x157: 0x9d, + 0x158: 0x9d, 0x159: 0xa6, 0x15a: 0xa7, 0x15b: 0xa8, 0x15c: 0xa9, 0x15d: 0xaa, 0x15e: 0xab, 0x15f: 0xac, + 0x160: 0xad, 0x161: 0xae, 0x162: 0xaf, 0x163: 0xb0, 0x164: 0xb1, 0x165: 0xb2, 0x166: 0xb3, 0x167: 0xb4, + 0x168: 0xb5, 0x169: 0xb6, 0x16a: 0xb7, 0x16b: 0xb8, 0x16c: 0xb9, 0x16d: 0xba, 0x16e: 0xbb, 0x16f: 0xbc, + 0x170: 0xbd, 0x171: 0xbe, 0x172: 0xbf, 0x173: 0xc0, 0x174: 0x23, 0x175: 0x24, 0x176: 0x25, 0x177: 0xc1, + 0x178: 0x26, 0x179: 0x26, 0x17a: 0x27, 0x17b: 0x26, 0x17c: 0xc2, 0x17d: 0x28, 0x17e: 0x29, 0x17f: 0x2a, + // Block 0x6, offset 0x180 + 0x180: 0x2b, 0x181: 0x2c, 0x182: 0x2d, 0x183: 0xc3, 0x184: 0x2e, 0x185: 0x2f, 0x186: 0xc4, 0x187: 0x9b, + 0x188: 0xc5, 0x189: 0xc6, 0x18a: 0x9b, 0x18b: 0x9b, 0x18c: 0xc7, 0x18d: 0x9b, 0x18e: 0x9b, 0x18f: 0xc8, + 0x190: 0xc9, 0x191: 0x30, 0x192: 0x31, 0x193: 0x32, 0x194: 0x9b, 0x195: 0x9b, 0x196: 0x9b, 0x197: 0x9b, + 0x198: 0x9b, 0x199: 0x9b, 0x19a: 0x9b, 0x19b: 0x9b, 0x19c: 0x9b, 0x19d: 0x9b, 0x19e: 0x9b, 0x19f: 0x9b, + 0x1a0: 0x9b, 0x1a1: 0x9b, 0x1a2: 0x9b, 0x1a3: 0x9b, 0x1a4: 0x9b, 0x1a5: 0x9b, 0x1a6: 0x9b, 0x1a7: 0x9b, + 0x1a8: 0xca, 0x1a9: 0xcb, 0x1aa: 0x9b, 0x1ab: 0xcc, 0x1ac: 0x9b, 0x1ad: 0xcd, 0x1ae: 0xce, 0x1af: 0xcf, + 0x1b0: 0xd0, 0x1b1: 0x33, 0x1b2: 0x26, 0x1b3: 0x34, 0x1b4: 0xd1, 0x1b5: 0xd2, 0x1b6: 0xd3, 0x1b7: 0xd4, + 0x1b8: 0xd5, 0x1b9: 0xd6, 0x1ba: 0xd7, 0x1bb: 0xd8, 0x1bc: 0xd9, 0x1bd: 0xda, 0x1be: 0xdb, 0x1bf: 0x35, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x36, 0x1c1: 0xdc, 0x1c2: 0xdd, 0x1c3: 0xde, 0x1c4: 0xdf, 0x1c5: 0x37, 0x1c6: 0x38, 0x1c7: 0xe0, + 0x1c8: 0xe1, 0x1c9: 0x39, 0x1ca: 0x3a, 0x1cb: 0x3b, 0x1cc: 0x3c, 0x1cd: 0x3d, 0x1ce: 0x3e, 0x1cf: 0x3f, + 0x1d0: 0x9d, 0x1d1: 0x9d, 0x1d2: 0x9d, 0x1d3: 0x9d, 0x1d4: 0x9d, 0x1d5: 0x9d, 0x1d6: 0x9d, 0x1d7: 0x9d, + 0x1d8: 0x9d, 0x1d9: 0x9d, 0x1da: 0x9d, 0x1db: 0x9d, 0x1dc: 0x9d, 0x1dd: 0x9d, 0x1de: 0x9d, 0x1df: 0x9d, + 0x1e0: 0x9d, 0x1e1: 0x9d, 0x1e2: 0x9d, 0x1e3: 0x9d, 0x1e4: 0x9d, 0x1e5: 0x9d, 0x1e6: 0x9d, 0x1e7: 0x9d, + 0x1e8: 0x9d, 0x1e9: 0x9d, 0x1ea: 0x9d, 0x1eb: 0x9d, 0x1ec: 0x9d, 0x1ed: 0x9d, 0x1ee: 0x9d, 0x1ef: 0x9d, + 0x1f0: 0x9d, 0x1f1: 0x9d, 0x1f2: 0x9d, 0x1f3: 0x9d, 0x1f4: 0x9d, 0x1f5: 0x9d, 0x1f6: 0x9d, 0x1f7: 0x9d, + 0x1f8: 0x9d, 0x1f9: 0x9d, 0x1fa: 0x9d, 0x1fb: 0x9d, 0x1fc: 0x9d, 0x1fd: 0x9d, 0x1fe: 0x9d, 0x1ff: 0x9d, + // Block 0x8, offset 0x200 + 0x200: 0x9d, 0x201: 0x9d, 0x202: 0x9d, 0x203: 0x9d, 0x204: 0x9d, 0x205: 0x9d, 0x206: 0x9d, 0x207: 0x9d, + 0x208: 0x9d, 0x209: 0x9d, 0x20a: 0x9d, 0x20b: 0x9d, 0x20c: 0x9d, 0x20d: 0x9d, 0x20e: 0x9d, 0x20f: 0x9d, + 0x210: 0x9d, 0x211: 0x9d, 0x212: 0x9d, 0x213: 0x9d, 0x214: 0x9d, 0x215: 0x9d, 0x216: 0x9d, 0x217: 0x9d, + 0x218: 0x9d, 0x219: 0x9d, 0x21a: 0x9d, 0x21b: 0x9d, 0x21c: 0x9d, 0x21d: 0x9d, 0x21e: 0x9d, 0x21f: 0x9d, + 0x220: 0x9d, 0x221: 0x9d, 0x222: 0x9d, 0x223: 0x9d, 0x224: 0x9d, 0x225: 0x9d, 0x226: 0x9d, 0x227: 0x9d, + 0x228: 0x9d, 0x229: 0x9d, 0x22a: 0x9d, 0x22b: 0x9d, 0x22c: 0x9d, 0x22d: 0x9d, 0x22e: 0x9d, 0x22f: 0x9d, + 0x230: 0x9d, 0x231: 0x9d, 0x232: 0x9d, 0x233: 0x9d, 0x234: 0x9d, 0x235: 0x9d, 0x236: 0xb0, 0x237: 0x9b, + 0x238: 0x9d, 0x239: 0x9d, 0x23a: 0x9d, 0x23b: 0x9d, 0x23c: 0x9d, 0x23d: 0x9d, 0x23e: 0x9d, 0x23f: 0x9d, + // Block 0x9, offset 0x240 + 0x240: 0x9d, 0x241: 0x9d, 0x242: 0x9d, 0x243: 0x9d, 0x244: 0x9d, 0x245: 0x9d, 0x246: 0x9d, 0x247: 0x9d, + 0x248: 0x9d, 0x249: 0x9d, 0x24a: 0x9d, 0x24b: 0x9d, 0x24c: 0x9d, 0x24d: 0x9d, 0x24e: 0x9d, 0x24f: 0x9d, + 0x250: 0x9d, 0x251: 0x9d, 0x252: 0x9d, 0x253: 0x9d, 0x254: 0x9d, 0x255: 0x9d, 0x256: 0x9d, 0x257: 0x9d, + 0x258: 0x9d, 0x259: 0x9d, 0x25a: 0x9d, 0x25b: 0x9d, 0x25c: 0x9d, 0x25d: 0x9d, 0x25e: 0x9d, 0x25f: 0x9d, + 0x260: 0x9d, 0x261: 0x9d, 0x262: 0x9d, 0x263: 0x9d, 0x264: 0x9d, 0x265: 0x9d, 0x266: 0x9d, 0x267: 0x9d, + 0x268: 0x9d, 0x269: 0x9d, 0x26a: 0x9d, 0x26b: 0x9d, 0x26c: 0x9d, 0x26d: 0x9d, 0x26e: 0x9d, 0x26f: 0x9d, + 0x270: 0x9d, 0x271: 0x9d, 0x272: 0x9d, 0x273: 0x9d, 0x274: 0x9d, 0x275: 0x9d, 0x276: 0x9d, 0x277: 0x9d, + 0x278: 0x9d, 0x279: 0x9d, 0x27a: 0x9d, 0x27b: 0x9d, 0x27c: 0x9d, 0x27d: 0x9d, 0x27e: 0x9d, 0x27f: 0x9d, + // Block 0xa, offset 0x280 + 0x280: 0x9d, 0x281: 0x9d, 0x282: 0x9d, 0x283: 0x9d, 0x284: 0x9d, 0x285: 0x9d, 0x286: 0x9d, 0x287: 0x9d, + 0x288: 0x9d, 0x289: 0x9d, 0x28a: 0x9d, 0x28b: 0x9d, 0x28c: 0x9d, 0x28d: 0x9d, 0x28e: 0x9d, 0x28f: 0x9d, + 0x290: 0x9d, 0x291: 0x9d, 0x292: 0x9d, 0x293: 0x9d, 0x294: 0x9d, 0x295: 0x9d, 0x296: 0x9d, 0x297: 0x9d, + 0x298: 0x9d, 0x299: 0x9d, 0x29a: 0x9d, 0x29b: 0x9d, 0x29c: 0x9d, 0x29d: 0x9d, 0x29e: 0x9d, 0x29f: 0x9d, + 0x2a0: 0x9d, 0x2a1: 0x9d, 0x2a2: 0x9d, 0x2a3: 0x9d, 0x2a4: 0x9d, 0x2a5: 0x9d, 0x2a6: 0x9d, 0x2a7: 0x9d, + 0x2a8: 0x9d, 0x2a9: 0x9d, 0x2aa: 0x9d, 0x2ab: 0x9d, 0x2ac: 0x9d, 0x2ad: 0x9d, 0x2ae: 0x9d, 0x2af: 0x9d, + 0x2b0: 0x9d, 0x2b1: 0x9d, 0x2b2: 0x9d, 0x2b3: 0x9d, 0x2b4: 0x9d, 0x2b5: 0x9d, 0x2b6: 0x9d, 0x2b7: 0x9d, + 0x2b8: 0x9d, 0x2b9: 0x9d, 0x2ba: 0x9d, 0x2bb: 0x9d, 0x2bc: 0x9d, 0x2bd: 0x9d, 0x2be: 0x9d, 0x2bf: 0xe2, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x9d, 0x2c1: 0x9d, 0x2c2: 0x9d, 0x2c3: 0x9d, 0x2c4: 0x9d, 0x2c5: 0x9d, 0x2c6: 0x9d, 0x2c7: 0x9d, + 0x2c8: 0x9d, 0x2c9: 0x9d, 0x2ca: 0x9d, 0x2cb: 0x9d, 0x2cc: 0x9d, 0x2cd: 0x9d, 0x2ce: 0x9d, 0x2cf: 0x9d, + 0x2d0: 0x9d, 0x2d1: 0x9d, 0x2d2: 0xe3, 0x2d3: 0xe4, 0x2d4: 0x9d, 0x2d5: 0x9d, 0x2d6: 0x9d, 0x2d7: 0x9d, + 0x2d8: 0xe5, 0x2d9: 0x40, 0x2da: 0x41, 0x2db: 0xe6, 0x2dc: 0x42, 0x2dd: 0x43, 0x2de: 0x44, 0x2df: 0xe7, + 0x2e0: 0xe8, 0x2e1: 0xe9, 0x2e2: 0xea, 0x2e3: 0xeb, 0x2e4: 0xec, 0x2e5: 0xed, 0x2e6: 0xee, 0x2e7: 0xef, + 0x2e8: 0xf0, 0x2e9: 0xf1, 0x2ea: 0xf2, 0x2eb: 0xf3, 0x2ec: 0xf4, 0x2ed: 0xf5, 0x2ee: 0xf6, 0x2ef: 0xf7, + 0x2f0: 0x9d, 0x2f1: 0x9d, 0x2f2: 0x9d, 0x2f3: 0x9d, 0x2f4: 0x9d, 0x2f5: 0x9d, 0x2f6: 0x9d, 0x2f7: 0x9d, + 0x2f8: 0x9d, 0x2f9: 0x9d, 0x2fa: 0x9d, 0x2fb: 0x9d, 0x2fc: 0x9d, 0x2fd: 0x9d, 0x2fe: 0x9d, 0x2ff: 0x9d, + // Block 0xc, offset 0x300 + 0x300: 0x9d, 0x301: 0x9d, 0x302: 0x9d, 0x303: 0x9d, 0x304: 0x9d, 0x305: 0x9d, 0x306: 0x9d, 0x307: 0x9d, + 0x308: 0x9d, 0x309: 0x9d, 0x30a: 0x9d, 0x30b: 0x9d, 0x30c: 0x9d, 0x30d: 0x9d, 0x30e: 0x9d, 0x30f: 0x9d, + 0x310: 0x9d, 0x311: 0x9d, 0x312: 0x9d, 0x313: 0x9d, 0x314: 0x9d, 0x315: 0x9d, 0x316: 0x9d, 0x317: 0x9d, + 0x318: 0x9d, 0x319: 0x9d, 0x31a: 0x9d, 0x31b: 0x9d, 0x31c: 0x9d, 0x31d: 0x9d, 0x31e: 0xf8, 0x31f: 0xf9, + // Block 0xd, offset 0x340 + 0x340: 0xb8, 0x341: 0xb8, 0x342: 0xb8, 0x343: 0xb8, 0x344: 0xb8, 0x345: 0xb8, 0x346: 0xb8, 0x347: 0xb8, + 0x348: 0xb8, 0x349: 0xb8, 0x34a: 0xb8, 0x34b: 0xb8, 0x34c: 0xb8, 0x34d: 0xb8, 0x34e: 0xb8, 0x34f: 0xb8, + 0x350: 0xb8, 0x351: 0xb8, 0x352: 0xb8, 0x353: 0xb8, 0x354: 0xb8, 0x355: 0xb8, 0x356: 0xb8, 0x357: 0xb8, + 0x358: 0xb8, 0x359: 0xb8, 0x35a: 0xb8, 0x35b: 0xb8, 0x35c: 0xb8, 0x35d: 0xb8, 0x35e: 0xb8, 0x35f: 0xb8, + 0x360: 0xb8, 0x361: 0xb8, 0x362: 0xb8, 0x363: 0xb8, 0x364: 0xb8, 0x365: 0xb8, 0x366: 0xb8, 0x367: 0xb8, + 0x368: 0xb8, 0x369: 0xb8, 0x36a: 0xb8, 0x36b: 0xb8, 0x36c: 0xb8, 0x36d: 0xb8, 0x36e: 0xb8, 0x36f: 0xb8, + 0x370: 0xb8, 0x371: 0xb8, 0x372: 0xb8, 0x373: 0xb8, 0x374: 0xb8, 0x375: 0xb8, 0x376: 0xb8, 0x377: 0xb8, + 0x378: 0xb8, 0x379: 0xb8, 0x37a: 0xb8, 0x37b: 0xb8, 0x37c: 0xb8, 0x37d: 0xb8, 0x37e: 0xb8, 0x37f: 0xb8, + // Block 0xe, offset 0x380 + 0x380: 0xb8, 0x381: 0xb8, 0x382: 0xb8, 0x383: 0xb8, 0x384: 0xb8, 0x385: 0xb8, 0x386: 0xb8, 0x387: 0xb8, + 0x388: 0xb8, 0x389: 0xb8, 0x38a: 0xb8, 0x38b: 0xb8, 0x38c: 0xb8, 0x38d: 0xb8, 0x38e: 0xb8, 0x38f: 0xb8, + 0x390: 0xb8, 0x391: 0xb8, 0x392: 0xb8, 0x393: 0xb8, 0x394: 0xb8, 0x395: 0xb8, 0x396: 0xb8, 0x397: 0xb8, + 0x398: 0xb8, 0x399: 0xb8, 0x39a: 0xb8, 0x39b: 0xb8, 0x39c: 0xb8, 0x39d: 0xb8, 0x39e: 0xb8, 0x39f: 0xb8, + 0x3a0: 0xb8, 0x3a1: 0xb8, 0x3a2: 0xb8, 0x3a3: 0xb8, 0x3a4: 0xfa, 0x3a5: 0xfb, 0x3a6: 0xfc, 0x3a7: 0xfd, + 0x3a8: 0x45, 0x3a9: 0xfe, 0x3aa: 0xff, 0x3ab: 0x46, 0x3ac: 0x47, 0x3ad: 0x48, 0x3ae: 0x49, 0x3af: 0x4a, + 0x3b0: 0x100, 0x3b1: 0x4b, 0x3b2: 0x4c, 0x3b3: 0x4d, 0x3b4: 0x4e, 0x3b5: 0x4f, 0x3b6: 0x101, 0x3b7: 0x50, + 0x3b8: 0x51, 0x3b9: 0x52, 0x3ba: 0x53, 0x3bb: 0x54, 0x3bc: 0x55, 0x3bd: 0x56, 0x3be: 0x57, 0x3bf: 0x58, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x102, 0x3c1: 0x103, 0x3c2: 0x9d, 0x3c3: 0x104, 0x3c4: 0x105, 0x3c5: 0x9b, 0x3c6: 0x106, 0x3c7: 0x107, + 0x3c8: 0xb8, 0x3c9: 0xb8, 0x3ca: 0x108, 0x3cb: 0x109, 0x3cc: 0x10a, 0x3cd: 0x10b, 0x3ce: 0x10c, 0x3cf: 0x10d, + 0x3d0: 0x10e, 0x3d1: 0x9d, 0x3d2: 0x10f, 0x3d3: 0x110, 0x3d4: 0x111, 0x3d5: 0x112, 0x3d6: 0xb8, 0x3d7: 0xb8, + 0x3d8: 0x9d, 0x3d9: 0x9d, 0x3da: 0x9d, 0x3db: 0x9d, 0x3dc: 0x113, 0x3dd: 0x114, 0x3de: 0xb8, 0x3df: 0xb8, + 0x3e0: 0x115, 0x3e1: 0x116, 0x3e2: 0x117, 0x3e3: 0x118, 0x3e4: 0x119, 0x3e5: 0xb8, 0x3e6: 0x11a, 0x3e7: 0x11b, + 0x3e8: 0x11c, 0x3e9: 0x11d, 0x3ea: 0x11e, 0x3eb: 0x59, 0x3ec: 0x11f, 0x3ed: 0x120, 0x3ee: 0x5a, 0x3ef: 0xb8, + 0x3f0: 0x9d, 0x3f1: 0x121, 0x3f2: 0x122, 0x3f3: 0x123, 0x3f4: 0xb8, 0x3f5: 0xb8, 0x3f6: 0xb8, 0x3f7: 0xb8, + 0x3f8: 0xb8, 0x3f9: 0x124, 0x3fa: 0xb8, 0x3fb: 0xb8, 0x3fc: 0xb8, 0x3fd: 0xb8, 0x3fe: 0xb8, 0x3ff: 0xb8, + // Block 0x10, offset 0x400 + 0x400: 0x125, 0x401: 0x126, 0x402: 0x127, 0x403: 0x128, 0x404: 0x129, 0x405: 0x12a, 0x406: 0x12b, 0x407: 0x12c, + 0x408: 0x12d, 0x409: 0xb8, 0x40a: 0x12e, 0x40b: 0x12f, 0x40c: 0x5b, 0x40d: 0x5c, 0x40e: 0xb8, 0x40f: 0xb8, + 0x410: 0x130, 0x411: 0x131, 0x412: 0x132, 0x413: 0x133, 0x414: 0xb8, 0x415: 0xb8, 0x416: 0x134, 0x417: 0x135, + 0x418: 0x136, 0x419: 0x137, 0x41a: 0x138, 0x41b: 0x139, 0x41c: 0x13a, 0x41d: 0xb8, 0x41e: 0xb8, 0x41f: 0xb8, + 0x420: 0xb8, 0x421: 0xb8, 0x422: 0x13b, 0x423: 0x13c, 0x424: 0xb8, 0x425: 0xb8, 0x426: 0xb8, 0x427: 0xb8, + 0x428: 0xb8, 0x429: 0xb8, 0x42a: 0xb8, 0x42b: 0x13d, 0x42c: 0xb8, 0x42d: 0xb8, 0x42e: 0xb8, 0x42f: 0xb8, + 0x430: 0x13e, 0x431: 0x13f, 0x432: 0x140, 0x433: 0xb8, 0x434: 0xb8, 0x435: 0xb8, 0x436: 0xb8, 0x437: 0xb8, + 0x438: 0xb8, 0x439: 0xb8, 0x43a: 0xb8, 0x43b: 0xb8, 0x43c: 0xb8, 0x43d: 0xb8, 0x43e: 0xb8, 0x43f: 0xb8, + // Block 0x11, offset 0x440 + 0x440: 0x9d, 0x441: 0x9d, 0x442: 0x9d, 0x443: 0x9d, 0x444: 0x9d, 0x445: 0x9d, 0x446: 0x9d, 0x447: 0x9d, + 0x448: 0x9d, 0x449: 0x9d, 0x44a: 0x9d, 0x44b: 0x9d, 0x44c: 0x9d, 0x44d: 0x9d, 0x44e: 0x141, 0x44f: 0xb8, + 0x450: 0x9b, 0x451: 0x142, 0x452: 0x9d, 0x453: 0x9d, 0x454: 0x9d, 0x455: 0x143, 0x456: 0xb8, 0x457: 0xb8, + 0x458: 0xb8, 0x459: 0xb8, 0x45a: 0xb8, 0x45b: 0xb8, 0x45c: 0xb8, 0x45d: 0xb8, 0x45e: 0xb8, 0x45f: 0xb8, + 0x460: 0xb8, 0x461: 0xb8, 0x462: 0xb8, 0x463: 0xb8, 0x464: 0xb8, 0x465: 0xb8, 0x466: 0xb8, 0x467: 0xb8, + 0x468: 0xb8, 0x469: 0xb8, 0x46a: 0xb8, 0x46b: 0xb8, 0x46c: 0xb8, 0x46d: 0xb8, 0x46e: 0xb8, 0x46f: 0xb8, + 0x470: 0xb8, 0x471: 0xb8, 0x472: 0xb8, 0x473: 0xb8, 0x474: 0xb8, 0x475: 0xb8, 0x476: 0xb8, 0x477: 0xb8, + 0x478: 0xb8, 0x479: 0xb8, 0x47a: 0xb8, 0x47b: 0xb8, 0x47c: 0xb8, 0x47d: 0xb8, 0x47e: 0xb8, 0x47f: 0xb8, + // Block 0x12, offset 0x480 + 0x480: 0x9d, 0x481: 0x9d, 0x482: 0x9d, 0x483: 0x9d, 0x484: 0x9d, 0x485: 0x9d, 0x486: 0x9d, 0x487: 0x9d, + 0x488: 0x9d, 0x489: 0x9d, 0x48a: 0x9d, 0x48b: 0x9d, 0x48c: 0x9d, 0x48d: 0x9d, 0x48e: 0x9d, 0x48f: 0x9d, + 0x490: 0x144, 0x491: 0xb8, 0x492: 0xb8, 0x493: 0xb8, 0x494: 0xb8, 0x495: 0xb8, 0x496: 0xb8, 0x497: 0xb8, + 0x498: 0xb8, 0x499: 0xb8, 0x49a: 0xb8, 0x49b: 0xb8, 0x49c: 0xb8, 0x49d: 0xb8, 0x49e: 0xb8, 0x49f: 0xb8, + 0x4a0: 0xb8, 0x4a1: 0xb8, 0x4a2: 0xb8, 0x4a3: 0xb8, 0x4a4: 0xb8, 0x4a5: 0xb8, 0x4a6: 0xb8, 0x4a7: 0xb8, + 0x4a8: 0xb8, 0x4a9: 0xb8, 0x4aa: 0xb8, 0x4ab: 0xb8, 0x4ac: 0xb8, 0x4ad: 0xb8, 0x4ae: 0xb8, 0x4af: 0xb8, + 0x4b0: 0xb8, 0x4b1: 0xb8, 0x4b2: 0xb8, 0x4b3: 0xb8, 0x4b4: 0xb8, 0x4b5: 0xb8, 0x4b6: 0xb8, 0x4b7: 0xb8, + 0x4b8: 0xb8, 0x4b9: 0xb8, 0x4ba: 0xb8, 0x4bb: 0xb8, 0x4bc: 0xb8, 0x4bd: 0xb8, 0x4be: 0xb8, 0x4bf: 0xb8, + // Block 0x13, offset 0x4c0 + 0x4c0: 0xb8, 0x4c1: 0xb8, 0x4c2: 0xb8, 0x4c3: 0xb8, 0x4c4: 0xb8, 0x4c5: 0xb8, 0x4c6: 0xb8, 0x4c7: 0xb8, + 0x4c8: 0xb8, 0x4c9: 0xb8, 0x4ca: 0xb8, 0x4cb: 0xb8, 0x4cc: 0xb8, 0x4cd: 0xb8, 0x4ce: 0xb8, 0x4cf: 0xb8, + 0x4d0: 0x9d, 0x4d1: 0x9d, 0x4d2: 0x9d, 0x4d3: 0x9d, 0x4d4: 0x9d, 0x4d5: 0x9d, 0x4d6: 0x9d, 0x4d7: 0x9d, + 0x4d8: 0x9d, 0x4d9: 0x145, 0x4da: 0xb8, 0x4db: 0xb8, 0x4dc: 0xb8, 0x4dd: 0xb8, 0x4de: 0xb8, 0x4df: 0xb8, + 0x4e0: 0xb8, 0x4e1: 0xb8, 0x4e2: 0xb8, 0x4e3: 0xb8, 0x4e4: 0xb8, 0x4e5: 0xb8, 0x4e6: 0xb8, 0x4e7: 0xb8, + 0x4e8: 0xb8, 0x4e9: 0xb8, 0x4ea: 0xb8, 0x4eb: 0xb8, 0x4ec: 0xb8, 0x4ed: 0xb8, 0x4ee: 0xb8, 0x4ef: 0xb8, + 0x4f0: 0xb8, 0x4f1: 0xb8, 0x4f2: 0xb8, 0x4f3: 0xb8, 0x4f4: 0xb8, 0x4f5: 0xb8, 0x4f6: 0xb8, 0x4f7: 0xb8, + 0x4f8: 0xb8, 0x4f9: 0xb8, 0x4fa: 0xb8, 0x4fb: 0xb8, 0x4fc: 0xb8, 0x4fd: 0xb8, 0x4fe: 0xb8, 0x4ff: 0xb8, + // Block 0x14, offset 0x500 + 0x500: 0xb8, 0x501: 0xb8, 0x502: 0xb8, 0x503: 0xb8, 0x504: 0xb8, 0x505: 0xb8, 0x506: 0xb8, 0x507: 0xb8, + 0x508: 0xb8, 0x509: 0xb8, 0x50a: 0xb8, 0x50b: 0xb8, 0x50c: 0xb8, 0x50d: 0xb8, 0x50e: 0xb8, 0x50f: 0xb8, + 0x510: 0xb8, 0x511: 0xb8, 0x512: 0xb8, 0x513: 0xb8, 0x514: 0xb8, 0x515: 0xb8, 0x516: 0xb8, 0x517: 0xb8, + 0x518: 0xb8, 0x519: 0xb8, 0x51a: 0xb8, 0x51b: 0xb8, 0x51c: 0xb8, 0x51d: 0xb8, 0x51e: 0xb8, 0x51f: 0xb8, + 0x520: 0x9d, 0x521: 0x9d, 0x522: 0x9d, 0x523: 0x9d, 0x524: 0x9d, 0x525: 0x9d, 0x526: 0x9d, 0x527: 0x9d, + 0x528: 0x13d, 0x529: 0x146, 0x52a: 0xb8, 0x52b: 0x147, 0x52c: 0x148, 0x52d: 0x149, 0x52e: 0x14a, 0x52f: 0xb8, + 0x530: 0xb8, 0x531: 0xb8, 0x532: 0xb8, 0x533: 0xb8, 0x534: 0xb8, 0x535: 0xb8, 0x536: 0xb8, 0x537: 0xb8, + 0x538: 0xb8, 0x539: 0xb8, 0x53a: 0xb8, 0x53b: 0xb8, 0x53c: 0x9d, 0x53d: 0x14b, 0x53e: 0x14c, 0x53f: 0x14d, + // Block 0x15, offset 0x540 + 0x540: 0x9d, 0x541: 0x9d, 0x542: 0x9d, 0x543: 0x9d, 0x544: 0x9d, 0x545: 0x9d, 0x546: 0x9d, 0x547: 0x9d, + 0x548: 0x9d, 0x549: 0x9d, 0x54a: 0x9d, 0x54b: 0x9d, 0x54c: 0x9d, 0x54d: 0x9d, 0x54e: 0x9d, 0x54f: 0x9d, + 0x550: 0x9d, 0x551: 0x9d, 0x552: 0x9d, 0x553: 0x9d, 0x554: 0x9d, 0x555: 0x9d, 0x556: 0x9d, 0x557: 0x9d, + 0x558: 0x9d, 0x559: 0x9d, 0x55a: 0x9d, 0x55b: 0x9d, 0x55c: 0x9d, 0x55d: 0x9d, 0x55e: 0x9d, 0x55f: 0x14e, + 0x560: 0x9d, 0x561: 0x9d, 0x562: 0x9d, 0x563: 0x9d, 0x564: 0x9d, 0x565: 0x9d, 0x566: 0x9d, 0x567: 0x9d, + 0x568: 0x9d, 0x569: 0x9d, 0x56a: 0x9d, 0x56b: 0x14f, 0x56c: 0xb8, 0x56d: 0xb8, 0x56e: 0xb8, 0x56f: 0xb8, + 0x570: 0xb8, 0x571: 0xb8, 0x572: 0xb8, 0x573: 0xb8, 0x574: 0xb8, 0x575: 0xb8, 0x576: 0xb8, 0x577: 0xb8, + 0x578: 0xb8, 0x579: 0xb8, 0x57a: 0xb8, 0x57b: 0xb8, 0x57c: 0xb8, 0x57d: 0xb8, 0x57e: 0xb8, 0x57f: 0xb8, + // Block 0x16, offset 0x580 + 0x580: 0x150, 0x581: 0xb8, 0x582: 0xb8, 0x583: 0xb8, 0x584: 0xb8, 0x585: 0xb8, 0x586: 0xb8, 0x587: 0xb8, + 0x588: 0xb8, 0x589: 0xb8, 0x58a: 0xb8, 0x58b: 0xb8, 0x58c: 0xb8, 0x58d: 0xb8, 0x58e: 0xb8, 0x58f: 0xb8, + 0x590: 0xb8, 0x591: 0xb8, 0x592: 0xb8, 0x593: 0xb8, 0x594: 0xb8, 0x595: 0xb8, 0x596: 0xb8, 0x597: 0xb8, + 0x598: 0xb8, 0x599: 0xb8, 0x59a: 0xb8, 0x59b: 0xb8, 0x59c: 0xb8, 0x59d: 0xb8, 0x59e: 0xb8, 0x59f: 0xb8, + 0x5a0: 0xb8, 0x5a1: 0xb8, 0x5a2: 0xb8, 0x5a3: 0xb8, 0x5a4: 0xb8, 0x5a5: 0xb8, 0x5a6: 0xb8, 0x5a7: 0xb8, + 0x5a8: 0xb8, 0x5a9: 0xb8, 0x5aa: 0xb8, 0x5ab: 0xb8, 0x5ac: 0xb8, 0x5ad: 0xb8, 0x5ae: 0xb8, 0x5af: 0xb8, + 0x5b0: 0x9d, 0x5b1: 0x151, 0x5b2: 0x152, 0x5b3: 0xb8, 0x5b4: 0xb8, 0x5b5: 0xb8, 0x5b6: 0xb8, 0x5b7: 0xb8, + 0x5b8: 0xb8, 0x5b9: 0xb8, 0x5ba: 0xb8, 0x5bb: 0xb8, 0x5bc: 0xb8, 0x5bd: 0xb8, 0x5be: 0xb8, 0x5bf: 0xb8, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x9b, 0x5c1: 0x9b, 0x5c2: 0x9b, 0x5c3: 0x153, 0x5c4: 0x154, 0x5c5: 0x155, 0x5c6: 0x156, 0x5c7: 0x157, + 0x5c8: 0x9b, 0x5c9: 0x158, 0x5ca: 0xb8, 0x5cb: 0xb8, 0x5cc: 0x9b, 0x5cd: 0x159, 0x5ce: 0xb8, 0x5cf: 0xb8, + 0x5d0: 0x5d, 0x5d1: 0x5e, 0x5d2: 0x5f, 0x5d3: 0x60, 0x5d4: 0x61, 0x5d5: 0x62, 0x5d6: 0x63, 0x5d7: 0x64, + 0x5d8: 0x65, 0x5d9: 0x66, 0x5da: 0x67, 0x5db: 0x68, 0x5dc: 0x69, 0x5dd: 0x6a, 0x5de: 0x6b, 0x5df: 0x6c, + 0x5e0: 0x9b, 0x5e1: 0x9b, 0x5e2: 0x9b, 0x5e3: 0x9b, 0x5e4: 0x9b, 0x5e5: 0x9b, 0x5e6: 0x9b, 0x5e7: 0x9b, + 0x5e8: 0x15a, 0x5e9: 0x15b, 0x5ea: 0x15c, 0x5eb: 0xb8, 0x5ec: 0xb8, 0x5ed: 0xb8, 0x5ee: 0xb8, 0x5ef: 0xb8, + 0x5f0: 0xb8, 0x5f1: 0xb8, 0x5f2: 0xb8, 0x5f3: 0xb8, 0x5f4: 0xb8, 0x5f5: 0xb8, 0x5f6: 0xb8, 0x5f7: 0xb8, + 0x5f8: 0xb8, 0x5f9: 0xb8, 0x5fa: 0xb8, 0x5fb: 0xb8, 0x5fc: 0xb8, 0x5fd: 0xb8, 0x5fe: 0xb8, 0x5ff: 0xb8, + // Block 0x18, offset 0x600 + 0x600: 0x15d, 0x601: 0xb8, 0x602: 0xb8, 0x603: 0xb8, 0x604: 0xb8, 0x605: 0xb8, 0x606: 0xb8, 0x607: 0xb8, + 0x608: 0xb8, 0x609: 0xb8, 0x60a: 0xb8, 0x60b: 0xb8, 0x60c: 0xb8, 0x60d: 0xb8, 0x60e: 0xb8, 0x60f: 0xb8, + 0x610: 0xb8, 0x611: 0xb8, 0x612: 0xb8, 0x613: 0xb8, 0x614: 0xb8, 0x615: 0xb8, 0x616: 0xb8, 0x617: 0xb8, + 0x618: 0xb8, 0x619: 0xb8, 0x61a: 0xb8, 0x61b: 0xb8, 0x61c: 0xb8, 0x61d: 0xb8, 0x61e: 0xb8, 0x61f: 0xb8, + 0x620: 0x9d, 0x621: 0x9d, 0x622: 0x9d, 0x623: 0x15e, 0x624: 0x6d, 0x625: 0x15f, 0x626: 0xb8, 0x627: 0xb8, + 0x628: 0xb8, 0x629: 0xb8, 0x62a: 0xb8, 0x62b: 0xb8, 0x62c: 0xb8, 0x62d: 0xb8, 0x62e: 0xb8, 0x62f: 0xb8, + 0x630: 0xb8, 0x631: 0xb8, 0x632: 0xb8, 0x633: 0xb8, 0x634: 0xb8, 0x635: 0xb8, 0x636: 0xb8, 0x637: 0xb8, + 0x638: 0x6e, 0x639: 0x6f, 0x63a: 0x70, 0x63b: 0x160, 0x63c: 0xb8, 0x63d: 0xb8, 0x63e: 0xb8, 0x63f: 0xb8, + // Block 0x19, offset 0x640 + 0x640: 0x161, 0x641: 0x9b, 0x642: 0x162, 0x643: 0x163, 0x644: 0x71, 0x645: 0x72, 0x646: 0x164, 0x647: 0x165, + 0x648: 0x73, 0x649: 0x166, 0x64a: 0xb8, 0x64b: 0xb8, 0x64c: 0x9b, 0x64d: 0x9b, 0x64e: 0x9b, 0x64f: 0x9b, + 0x650: 0x9b, 0x651: 0x9b, 0x652: 0x9b, 0x653: 0x9b, 0x654: 0x9b, 0x655: 0x9b, 0x656: 0x9b, 0x657: 0x9b, + 0x658: 0x9b, 0x659: 0x9b, 0x65a: 0x9b, 0x65b: 0x167, 0x65c: 0x9b, 0x65d: 0x168, 0x65e: 0x9b, 0x65f: 0x169, + 0x660: 0x16a, 0x661: 0x16b, 0x662: 0x16c, 0x663: 0xb8, 0x664: 0x16d, 0x665: 0x16e, 0x666: 0x16f, 0x667: 0x170, + 0x668: 0xb8, 0x669: 0xb8, 0x66a: 0xb8, 0x66b: 0xb8, 0x66c: 0xb8, 0x66d: 0xb8, 0x66e: 0xb8, 0x66f: 0xb8, + 0x670: 0xb8, 0x671: 0xb8, 0x672: 0xb8, 0x673: 0xb8, 0x674: 0xb8, 0x675: 0xb8, 0x676: 0xb8, 0x677: 0xb8, + 0x678: 0xb8, 0x679: 0xb8, 0x67a: 0xb8, 0x67b: 0xb8, 0x67c: 0xb8, 0x67d: 0xb8, 0x67e: 0xb8, 0x67f: 0xb8, + // Block 0x1a, offset 0x680 + 0x680: 0x9d, 0x681: 0x9d, 0x682: 0x9d, 0x683: 0x9d, 0x684: 0x9d, 0x685: 0x9d, 0x686: 0x9d, 0x687: 0x9d, + 0x688: 0x9d, 0x689: 0x9d, 0x68a: 0x9d, 0x68b: 0x9d, 0x68c: 0x9d, 0x68d: 0x9d, 0x68e: 0x9d, 0x68f: 0x9d, + 0x690: 0x9d, 0x691: 0x9d, 0x692: 0x9d, 0x693: 0x9d, 0x694: 0x9d, 0x695: 0x9d, 0x696: 0x9d, 0x697: 0x9d, + 0x698: 0x9d, 0x699: 0x9d, 0x69a: 0x9d, 0x69b: 0x171, 0x69c: 0x9d, 0x69d: 0x9d, 0x69e: 0x9d, 0x69f: 0x9d, + 0x6a0: 0x9d, 0x6a1: 0x9d, 0x6a2: 0x9d, 0x6a3: 0x9d, 0x6a4: 0x9d, 0x6a5: 0x9d, 0x6a6: 0x9d, 0x6a7: 0x9d, + 0x6a8: 0x9d, 0x6a9: 0x9d, 0x6aa: 0x9d, 0x6ab: 0x9d, 0x6ac: 0x9d, 0x6ad: 0x9d, 0x6ae: 0x9d, 0x6af: 0x9d, + 0x6b0: 0x9d, 0x6b1: 0x9d, 0x6b2: 0x9d, 0x6b3: 0x9d, 0x6b4: 0x9d, 0x6b5: 0x9d, 0x6b6: 0x9d, 0x6b7: 0x9d, + 0x6b8: 0x9d, 0x6b9: 0x9d, 0x6ba: 0x9d, 0x6bb: 0x9d, 0x6bc: 0x9d, 0x6bd: 0x9d, 0x6be: 0x9d, 0x6bf: 0x9d, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x9d, 0x6c1: 0x9d, 0x6c2: 0x9d, 0x6c3: 0x9d, 0x6c4: 0x9d, 0x6c5: 0x9d, 0x6c6: 0x9d, 0x6c7: 0x9d, + 0x6c8: 0x9d, 0x6c9: 0x9d, 0x6ca: 0x9d, 0x6cb: 0x9d, 0x6cc: 0x9d, 0x6cd: 0x9d, 0x6ce: 0x9d, 0x6cf: 0x9d, + 0x6d0: 0x9d, 0x6d1: 0x9d, 0x6d2: 0x9d, 0x6d3: 0x9d, 0x6d4: 0x9d, 0x6d5: 0x9d, 0x6d6: 0x9d, 0x6d7: 0x9d, + 0x6d8: 0x9d, 0x6d9: 0x9d, 0x6da: 0x9d, 0x6db: 0x9d, 0x6dc: 0x172, 0x6dd: 0x9d, 0x6de: 0x9d, 0x6df: 0x9d, + 0x6e0: 0x173, 0x6e1: 0x9d, 0x6e2: 0x9d, 0x6e3: 0x9d, 0x6e4: 0x9d, 0x6e5: 0x9d, 0x6e6: 0x9d, 0x6e7: 0x9d, + 0x6e8: 0x9d, 0x6e9: 0x9d, 0x6ea: 0x9d, 0x6eb: 0x9d, 0x6ec: 0x9d, 0x6ed: 0x9d, 0x6ee: 0x9d, 0x6ef: 0x9d, + 0x6f0: 0x9d, 0x6f1: 0x9d, 0x6f2: 0x9d, 0x6f3: 0x9d, 0x6f4: 0x9d, 0x6f5: 0x9d, 0x6f6: 0x9d, 0x6f7: 0x9d, + 0x6f8: 0x9d, 0x6f9: 0x9d, 0x6fa: 0x9d, 0x6fb: 0x9d, 0x6fc: 0x9d, 0x6fd: 0x9d, 0x6fe: 0x9d, 0x6ff: 0x9d, + // Block 0x1c, offset 0x700 + 0x700: 0x9d, 0x701: 0x9d, 0x702: 0x9d, 0x703: 0x9d, 0x704: 0x9d, 0x705: 0x9d, 0x706: 0x9d, 0x707: 0x9d, + 0x708: 0x9d, 0x709: 0x9d, 0x70a: 0x9d, 0x70b: 0x9d, 0x70c: 0x9d, 0x70d: 0x9d, 0x70e: 0x9d, 0x70f: 0x9d, + 0x710: 0x9d, 0x711: 0x9d, 0x712: 0x9d, 0x713: 0x9d, 0x714: 0x9d, 0x715: 0x9d, 0x716: 0x9d, 0x717: 0x9d, + 0x718: 0x9d, 0x719: 0x9d, 0x71a: 0x9d, 0x71b: 0x9d, 0x71c: 0x9d, 0x71d: 0x9d, 0x71e: 0x9d, 0x71f: 0x9d, + 0x720: 0x9d, 0x721: 0x9d, 0x722: 0x9d, 0x723: 0x9d, 0x724: 0x9d, 0x725: 0x9d, 0x726: 0x9d, 0x727: 0x9d, + 0x728: 0x9d, 0x729: 0x9d, 0x72a: 0x9d, 0x72b: 0x9d, 0x72c: 0x9d, 0x72d: 0x9d, 0x72e: 0x9d, 0x72f: 0x9d, + 0x730: 0x9d, 0x731: 0x9d, 0x732: 0x9d, 0x733: 0x9d, 0x734: 0x9d, 0x735: 0x9d, 0x736: 0x9d, 0x737: 0x9d, + 0x738: 0x9d, 0x739: 0x9d, 0x73a: 0x174, 0x73b: 0xb8, 0x73c: 0xb8, 0x73d: 0xb8, 0x73e: 0xb8, 0x73f: 0xb8, + // Block 0x1d, offset 0x740 + 0x740: 0xb8, 0x741: 0xb8, 0x742: 0xb8, 0x743: 0xb8, 0x744: 0xb8, 0x745: 0xb8, 0x746: 0xb8, 0x747: 0xb8, + 0x748: 0xb8, 0x749: 0xb8, 0x74a: 0xb8, 0x74b: 0xb8, 0x74c: 0xb8, 0x74d: 0xb8, 0x74e: 0xb8, 0x74f: 0xb8, + 0x750: 0xb8, 0x751: 0xb8, 0x752: 0xb8, 0x753: 0xb8, 0x754: 0xb8, 0x755: 0xb8, 0x756: 0xb8, 0x757: 0xb8, + 0x758: 0xb8, 0x759: 0xb8, 0x75a: 0xb8, 0x75b: 0xb8, 0x75c: 0xb8, 0x75d: 0xb8, 0x75e: 0xb8, 0x75f: 0xb8, + 0x760: 0x74, 0x761: 0x75, 0x762: 0x76, 0x763: 0x175, 0x764: 0x77, 0x765: 0x78, 0x766: 0x176, 0x767: 0x79, + 0x768: 0x7a, 0x769: 0xb8, 0x76a: 0xb8, 0x76b: 0xb8, 0x76c: 0xb8, 0x76d: 0xb8, 0x76e: 0xb8, 0x76f: 0xb8, + 0x770: 0xb8, 0x771: 0xb8, 0x772: 0xb8, 0x773: 0xb8, 0x774: 0xb8, 0x775: 0xb8, 0x776: 0xb8, 0x777: 0xb8, + 0x778: 0xb8, 0x779: 0xb8, 0x77a: 0xb8, 0x77b: 0xb8, 0x77c: 0xb8, 0x77d: 0xb8, 0x77e: 0xb8, 0x77f: 0xb8, + // Block 0x1e, offset 0x780 + 0x790: 0x0d, 0x791: 0x0e, 0x792: 0x0f, 0x793: 0x10, 0x794: 0x11, 0x795: 0x0b, 0x796: 0x12, 0x797: 0x07, + 0x798: 0x13, 0x799: 0x0b, 0x79a: 0x0b, 0x79b: 0x14, 0x79c: 0x0b, 0x79d: 0x15, 0x79e: 0x16, 0x79f: 0x17, + 0x7a0: 0x07, 0x7a1: 0x07, 0x7a2: 0x07, 0x7a3: 0x07, 0x7a4: 0x07, 0x7a5: 0x07, 0x7a6: 0x07, 0x7a7: 0x07, + 0x7a8: 0x07, 0x7a9: 0x07, 0x7aa: 0x18, 0x7ab: 0x19, 0x7ac: 0x1a, 0x7ad: 0x0b, 0x7ae: 0x0b, 0x7af: 0x1b, + 0x7b0: 0x0b, 0x7b1: 0x0b, 0x7b2: 0x0b, 0x7b3: 0x0b, 0x7b4: 0x0b, 0x7b5: 0x0b, 0x7b6: 0x0b, 0x7b7: 0x0b, + 0x7b8: 0x0b, 0x7b9: 0x0b, 0x7ba: 0x0b, 0x7bb: 0x0b, 0x7bc: 0x0b, 0x7bd: 0x0b, 0x7be: 0x0b, 0x7bf: 0x0b, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x0b, 0x7c1: 0x0b, 0x7c2: 0x0b, 0x7c3: 0x0b, 0x7c4: 0x0b, 0x7c5: 0x0b, 0x7c6: 0x0b, 0x7c7: 0x0b, + 0x7c8: 0x0b, 0x7c9: 0x0b, 0x7ca: 0x0b, 0x7cb: 0x0b, 0x7cc: 0x0b, 0x7cd: 0x0b, 0x7ce: 0x0b, 0x7cf: 0x0b, + 0x7d0: 0x0b, 0x7d1: 0x0b, 0x7d2: 0x0b, 0x7d3: 0x0b, 0x7d4: 0x0b, 0x7d5: 0x0b, 0x7d6: 0x0b, 0x7d7: 0x0b, + 0x7d8: 0x0b, 0x7d9: 0x0b, 0x7da: 0x0b, 0x7db: 0x0b, 0x7dc: 0x0b, 0x7dd: 0x0b, 0x7de: 0x0b, 0x7df: 0x0b, + 0x7e0: 0x0b, 0x7e1: 0x0b, 0x7e2: 0x0b, 0x7e3: 0x0b, 0x7e4: 0x0b, 0x7e5: 0x0b, 0x7e6: 0x0b, 0x7e7: 0x0b, + 0x7e8: 0x0b, 0x7e9: 0x0b, 0x7ea: 0x0b, 0x7eb: 0x0b, 0x7ec: 0x0b, 0x7ed: 0x0b, 0x7ee: 0x0b, 0x7ef: 0x0b, + 0x7f0: 0x0b, 0x7f1: 0x0b, 0x7f2: 0x0b, 0x7f3: 0x0b, 0x7f4: 0x0b, 0x7f5: 0x0b, 0x7f6: 0x0b, 0x7f7: 0x0b, + 0x7f8: 0x0b, 0x7f9: 0x0b, 0x7fa: 0x0b, 0x7fb: 0x0b, 0x7fc: 0x0b, 0x7fd: 0x0b, 0x7fe: 0x0b, 0x7ff: 0x0b, + // Block 0x20, offset 0x800 + 0x800: 0x177, 0x801: 0x178, 0x802: 0xb8, 0x803: 0xb8, 0x804: 0x179, 0x805: 0x179, 0x806: 0x179, 0x807: 0x17a, + 0x808: 0xb8, 0x809: 0xb8, 0x80a: 0xb8, 0x80b: 0xb8, 0x80c: 0xb8, 0x80d: 0xb8, 0x80e: 0xb8, 0x80f: 0xb8, + 0x810: 0xb8, 0x811: 0xb8, 0x812: 0xb8, 0x813: 0xb8, 0x814: 0xb8, 0x815: 0xb8, 0x816: 0xb8, 0x817: 0xb8, + 0x818: 0xb8, 0x819: 0xb8, 0x81a: 0xb8, 0x81b: 0xb8, 0x81c: 0xb8, 0x81d: 0xb8, 0x81e: 0xb8, 0x81f: 0xb8, + 0x820: 0xb8, 0x821: 0xb8, 0x822: 0xb8, 0x823: 0xb8, 0x824: 0xb8, 0x825: 0xb8, 0x826: 0xb8, 0x827: 0xb8, + 0x828: 0xb8, 0x829: 0xb8, 0x82a: 0xb8, 0x82b: 0xb8, 0x82c: 0xb8, 0x82d: 0xb8, 0x82e: 0xb8, 0x82f: 0xb8, + 0x830: 0xb8, 0x831: 0xb8, 0x832: 0xb8, 0x833: 0xb8, 0x834: 0xb8, 0x835: 0xb8, 0x836: 0xb8, 0x837: 0xb8, + 0x838: 0xb8, 0x839: 0xb8, 0x83a: 0xb8, 0x83b: 0xb8, 0x83c: 0xb8, 0x83d: 0xb8, 0x83e: 0xb8, 0x83f: 0xb8, + // Block 0x21, offset 0x840 + 0x840: 0x0b, 0x841: 0x0b, 0x842: 0x0b, 0x843: 0x0b, 0x844: 0x0b, 0x845: 0x0b, 0x846: 0x0b, 0x847: 0x0b, + 0x848: 0x0b, 0x849: 0x0b, 0x84a: 0x0b, 0x84b: 0x0b, 0x84c: 0x0b, 0x84d: 0x0b, 0x84e: 0x0b, 0x84f: 0x0b, + 0x850: 0x0b, 0x851: 0x0b, 0x852: 0x0b, 0x853: 0x0b, 0x854: 0x0b, 0x855: 0x0b, 0x856: 0x0b, 0x857: 0x0b, + 0x858: 0x0b, 0x859: 0x0b, 0x85a: 0x0b, 0x85b: 0x0b, 0x85c: 0x0b, 0x85d: 0x0b, 0x85e: 0x0b, 0x85f: 0x0b, + 0x860: 0x1e, 0x861: 0x0b, 0x862: 0x0b, 0x863: 0x0b, 0x864: 0x0b, 0x865: 0x0b, 0x866: 0x0b, 0x867: 0x0b, + 0x868: 0x0b, 0x869: 0x0b, 0x86a: 0x0b, 0x86b: 0x0b, 0x86c: 0x0b, 0x86d: 0x0b, 0x86e: 0x0b, 0x86f: 0x0b, + 0x870: 0x0b, 0x871: 0x0b, 0x872: 0x0b, 0x873: 0x0b, 0x874: 0x0b, 0x875: 0x0b, 0x876: 0x0b, 0x877: 0x0b, + 0x878: 0x0b, 0x879: 0x0b, 0x87a: 0x0b, 0x87b: 0x0b, 0x87c: 0x0b, 0x87d: 0x0b, 0x87e: 0x0b, 0x87f: 0x0b, + // Block 0x22, offset 0x880 + 0x880: 0x0b, 0x881: 0x0b, 0x882: 0x0b, 0x883: 0x0b, 0x884: 0x0b, 0x885: 0x0b, 0x886: 0x0b, 0x887: 0x0b, + 0x888: 0x0b, 0x889: 0x0b, 0x88a: 0x0b, 0x88b: 0x0b, 0x88c: 0x0b, 0x88d: 0x0b, 0x88e: 0x0b, 0x88f: 0x0b, +} + +// idnaSparseOffset: 256 entries, 512 bytes +var idnaSparseOffset = []uint16{0x0, 0x8, 0x19, 0x25, 0x27, 0x2c, 0x34, 0x3f, 0x4b, 0x5c, 0x60, 0x6f, 0x74, 0x7b, 0x87, 0x95, 0xa3, 0xa8, 0xb1, 0xc1, 0xcf, 0xdc, 0xe8, 0xf9, 0x103, 0x10a, 0x117, 0x128, 0x12f, 0x13a, 0x149, 0x157, 0x161, 0x163, 0x167, 0x169, 0x175, 0x180, 0x188, 0x18e, 0x194, 0x199, 0x19e, 0x1a1, 0x1a5, 0x1ab, 0x1b0, 0x1bc, 0x1c6, 0x1cc, 0x1dd, 0x1e7, 0x1ea, 0x1f2, 0x1f5, 0x202, 0x20a, 0x20e, 0x215, 0x21d, 0x22d, 0x239, 0x23b, 0x245, 0x251, 0x25d, 0x269, 0x271, 0x276, 0x280, 0x291, 0x295, 0x2a0, 0x2a4, 0x2ad, 0x2b5, 0x2bb, 0x2c0, 0x2c3, 0x2c6, 0x2ca, 0x2d0, 0x2d4, 0x2d8, 0x2de, 0x2e5, 0x2eb, 0x2f3, 0x2fa, 0x305, 0x30f, 0x313, 0x316, 0x31c, 0x320, 0x322, 0x325, 0x327, 0x32a, 0x334, 0x337, 0x346, 0x34a, 0x34f, 0x352, 0x356, 0x35b, 0x360, 0x366, 0x36c, 0x37b, 0x381, 0x385, 0x394, 0x399, 0x3a1, 0x3ab, 0x3b6, 0x3be, 0x3cf, 0x3d8, 0x3e8, 0x3f5, 0x3ff, 0x404, 0x411, 0x415, 0x41a, 0x41c, 0x420, 0x422, 0x426, 0x42f, 0x435, 0x439, 0x449, 0x453, 0x458, 0x45b, 0x461, 0x468, 0x46d, 0x471, 0x477, 0x47c, 0x485, 0x48a, 0x490, 0x497, 0x49e, 0x4a5, 0x4a9, 0x4ae, 0x4b1, 0x4b6, 0x4c2, 0x4c8, 0x4cd, 0x4d4, 0x4dc, 0x4e1, 0x4e5, 0x4f5, 0x4fc, 0x500, 0x504, 0x50b, 0x50e, 0x511, 0x515, 0x519, 0x51f, 0x528, 0x534, 0x53b, 0x544, 0x54c, 0x553, 0x561, 0x56e, 0x57b, 0x584, 0x588, 0x596, 0x59e, 0x5a9, 0x5b2, 0x5b8, 0x5c0, 0x5c9, 0x5d3, 0x5d6, 0x5e2, 0x5e5, 0x5ea, 0x5ed, 0x5f7, 0x600, 0x60c, 0x60f, 0x614, 0x617, 0x61a, 0x61d, 0x624, 0x62b, 0x62f, 0x63a, 0x63d, 0x643, 0x648, 0x64c, 0x64f, 0x652, 0x655, 0x65a, 0x664, 0x667, 0x66b, 0x67a, 0x686, 0x68a, 0x68f, 0x694, 0x698, 0x69d, 0x6a6, 0x6b1, 0x6b7, 0x6bf, 0x6c3, 0x6c7, 0x6cd, 0x6d3, 0x6d8, 0x6db, 0x6e9, 0x6f0, 0x6f3, 0x6f6, 0x6fa, 0x700, 0x705, 0x70f, 0x714, 0x717, 0x71a, 0x71d, 0x720, 0x724, 0x727, 0x737, 0x748, 0x74d, 0x74f, 0x751} + +// idnaSparseValues: 1876 entries, 7504 bytes +var idnaSparseValues = [1876]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x07}, + {value: 0xe105, lo: 0x80, hi: 0x96}, + {value: 0x0018, lo: 0x97, hi: 0x97}, + {value: 0xe105, lo: 0x98, hi: 0x9e}, + {value: 0x001f, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbf}, + // Block 0x1, offset 0x8 + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0xe01d, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x0335, lo: 0x83, hi: 0x83}, + {value: 0x034d, lo: 0x84, hi: 0x84}, + {value: 0x0365, lo: 0x85, hi: 0x85}, + {value: 0xe00d, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0xe00d, lo: 0x88, hi: 0x88}, + {value: 0x0008, lo: 0x89, hi: 0x89}, + {value: 0xe00d, lo: 0x8a, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0x8b}, + {value: 0xe00d, lo: 0x8c, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0x8d}, + {value: 0xe00d, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0xbf}, + // Block 0x2, offset 0x19 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x0249, lo: 0xb0, hi: 0xb0}, + {value: 0x037d, lo: 0xb1, hi: 0xb1}, + {value: 0x0259, lo: 0xb2, hi: 0xb2}, + {value: 0x0269, lo: 0xb3, hi: 0xb3}, + {value: 0x034d, lo: 0xb4, hi: 0xb4}, + {value: 0x0395, lo: 0xb5, hi: 0xb5}, + {value: 0xe1bd, lo: 0xb6, hi: 0xb6}, + {value: 0x0279, lo: 0xb7, hi: 0xb7}, + {value: 0x0289, lo: 0xb8, hi: 0xb8}, + {value: 0x0008, lo: 0xb9, hi: 0xbf}, + // Block 0x3, offset 0x25 + {value: 0x0000, lo: 0x01}, + {value: 0x1308, lo: 0x80, hi: 0xbf}, + // Block 0x4, offset 0x27 + {value: 0x0000, lo: 0x04}, + {value: 0x03f5, lo: 0x80, hi: 0x8f}, + {value: 0xe105, lo: 0x90, hi: 0x9f}, + {value: 0x049d, lo: 0xa0, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x5, offset 0x2c + {value: 0x0000, lo: 0x07}, + {value: 0xe185, lo: 0x80, hi: 0x8f}, + {value: 0x0545, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x98}, + {value: 0x0008, lo: 0x99, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xbf}, + // Block 0x6, offset 0x34 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0401, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x88}, + {value: 0x0018, lo: 0x89, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x1308, lo: 0x91, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbe}, + {value: 0x1308, lo: 0xbf, hi: 0xbf}, + // Block 0x7, offset 0x3f + {value: 0x0000, lo: 0x0b}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x1308, lo: 0x81, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0x83}, + {value: 0x1308, lo: 0x84, hi: 0x85}, + {value: 0x0018, lo: 0x86, hi: 0x86}, + {value: 0x1308, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x8, offset 0x4b + {value: 0x0000, lo: 0x10}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0208, lo: 0x81, hi: 0x87}, + {value: 0x0408, lo: 0x88, hi: 0x88}, + {value: 0x0208, lo: 0x89, hi: 0x8a}, + {value: 0x1308, lo: 0x8b, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xad}, + {value: 0x0208, lo: 0xae, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb0}, + {value: 0x0408, lo: 0xb1, hi: 0xb3}, + {value: 0x0008, lo: 0xb4, hi: 0xb4}, + {value: 0x0429, lo: 0xb5, hi: 0xb5}, + {value: 0x0451, lo: 0xb6, hi: 0xb6}, + {value: 0x0479, lo: 0xb7, hi: 0xb7}, + {value: 0x04a1, lo: 0xb8, hi: 0xb8}, + {value: 0x0208, lo: 0xb9, hi: 0xbf}, + // Block 0x9, offset 0x5c + {value: 0x0000, lo: 0x03}, + {value: 0x0208, lo: 0x80, hi: 0x87}, + {value: 0x0408, lo: 0x88, hi: 0x99}, + {value: 0x0208, lo: 0x9a, hi: 0xbf}, + // Block 0xa, offset 0x60 + {value: 0x0000, lo: 0x0e}, + {value: 0x1308, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8c}, + {value: 0x0408, lo: 0x8d, hi: 0x8d}, + {value: 0x0208, lo: 0x8e, hi: 0x98}, + {value: 0x0408, lo: 0x99, hi: 0x9b}, + {value: 0x0208, lo: 0x9c, hi: 0xaa}, + {value: 0x0408, lo: 0xab, hi: 0xac}, + {value: 0x0208, lo: 0xad, hi: 0xb0}, + {value: 0x0408, lo: 0xb1, hi: 0xb1}, + {value: 0x0208, lo: 0xb2, hi: 0xb2}, + {value: 0x0408, lo: 0xb3, hi: 0xb4}, + {value: 0x0208, lo: 0xb5, hi: 0xb7}, + {value: 0x0408, lo: 0xb8, hi: 0xb9}, + {value: 0x0208, lo: 0xba, hi: 0xbf}, + // Block 0xb, offset 0x6f + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x1308, lo: 0xa6, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xc, offset 0x74 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0208, lo: 0x8a, hi: 0xaa}, + {value: 0x1308, lo: 0xab, hi: 0xb3}, + {value: 0x0008, lo: 0xb4, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0xd, offset 0x7b + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x1308, lo: 0x96, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0x9a}, + {value: 0x1308, lo: 0x9b, hi: 0xa3}, + {value: 0x0008, lo: 0xa4, hi: 0xa4}, + {value: 0x1308, lo: 0xa5, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xa8}, + {value: 0x1308, lo: 0xa9, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xe, offset 0x87 + {value: 0x0000, lo: 0x0d}, + {value: 0x0408, lo: 0x80, hi: 0x80}, + {value: 0x0208, lo: 0x81, hi: 0x85}, + {value: 0x0408, lo: 0x86, hi: 0x87}, + {value: 0x0208, lo: 0x88, hi: 0x88}, + {value: 0x0408, lo: 0x89, hi: 0x89}, + {value: 0x0208, lo: 0x8a, hi: 0x93}, + {value: 0x0408, lo: 0x94, hi: 0x94}, + {value: 0x0208, lo: 0x95, hi: 0x95}, + {value: 0x0008, lo: 0x96, hi: 0x98}, + {value: 0x1308, lo: 0x99, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xbf}, + // Block 0xf, offset 0x95 + {value: 0x0000, lo: 0x0d}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0208, lo: 0xa0, hi: 0xa9}, + {value: 0x0408, lo: 0xaa, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xad}, + {value: 0x0408, lo: 0xae, hi: 0xae}, + {value: 0x0208, lo: 0xaf, hi: 0xb0}, + {value: 0x0408, lo: 0xb1, hi: 0xb2}, + {value: 0x0208, lo: 0xb3, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xb5}, + {value: 0x0208, lo: 0xb6, hi: 0xb8}, + {value: 0x0408, lo: 0xb9, hi: 0xb9}, + {value: 0x0208, lo: 0xba, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x10, offset 0xa3 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x93}, + {value: 0x1308, lo: 0x94, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xa2}, + {value: 0x1308, lo: 0xa3, hi: 0xbf}, + // Block 0x11, offset 0xa8 + {value: 0x0000, lo: 0x08}, + {value: 0x1308, lo: 0x80, hi: 0x82}, + {value: 0x1008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0xb9}, + {value: 0x1308, lo: 0xba, hi: 0xba}, + {value: 0x1008, lo: 0xbb, hi: 0xbb}, + {value: 0x1308, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbf}, + // Block 0x12, offset 0xb1 + {value: 0x0000, lo: 0x0f}, + {value: 0x1308, lo: 0x80, hi: 0x80}, + {value: 0x1008, lo: 0x81, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x85}, + {value: 0x1008, lo: 0x86, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x1008, lo: 0x8a, hi: 0x8c}, + {value: 0x1b08, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x96}, + {value: 0x1008, lo: 0x97, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x13, offset 0xc1 + {value: 0x0000, lo: 0x0d}, + {value: 0x1308, lo: 0x80, hi: 0x80}, + {value: 0x1008, lo: 0x81, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xa9}, + {value: 0x0008, lo: 0xaa, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x1308, lo: 0xbe, hi: 0xbf}, + // Block 0x14, offset 0xcf + {value: 0x0000, lo: 0x0c}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x1308, lo: 0x81, hi: 0x81}, + {value: 0x1008, lo: 0x82, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbf}, + // Block 0x15, offset 0xdc + {value: 0x0000, lo: 0x0b}, + {value: 0x0040, lo: 0x80, hi: 0x81}, + {value: 0x1008, lo: 0x82, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xb2}, + {value: 0x0008, lo: 0xb3, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x16, offset 0xe8 + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x89}, + {value: 0x1b08, lo: 0x8a, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8e}, + {value: 0x1008, lo: 0x8f, hi: 0x91}, + {value: 0x1308, lo: 0x92, hi: 0x94}, + {value: 0x0040, lo: 0x95, hi: 0x95}, + {value: 0x1308, lo: 0x96, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x1008, lo: 0x98, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xb1}, + {value: 0x1008, lo: 0xb2, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x17, offset 0xf9 + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xb0}, + {value: 0x1308, lo: 0xb1, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb2}, + {value: 0x08f1, lo: 0xb3, hi: 0xb3}, + {value: 0x1308, lo: 0xb4, hi: 0xb9}, + {value: 0x1b08, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x18, offset 0x103 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x1308, lo: 0x87, hi: 0x8e}, + {value: 0x0018, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0xbf}, + // Block 0x19, offset 0x10a + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x1308, lo: 0x88, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0961, lo: 0x9c, hi: 0x9c}, + {value: 0x0999, lo: 0x9d, hi: 0x9d}, + {value: 0x0008, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x1a, offset 0x117 + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0x8b}, + {value: 0xe03d, lo: 0x8c, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x97}, + {value: 0x1308, lo: 0x98, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xb4}, + {value: 0x1308, lo: 0xb5, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xb6}, + {value: 0x1308, lo: 0xb7, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xb8}, + {value: 0x1308, lo: 0xb9, hi: 0xb9}, + {value: 0x0018, lo: 0xba, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbf}, + // Block 0x1b, offset 0x128 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x1308, lo: 0x86, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0xbf}, + // Block 0x1c, offset 0x12f + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x1008, lo: 0xab, hi: 0xac}, + {value: 0x1308, lo: 0xad, hi: 0xb0}, + {value: 0x1008, lo: 0xb1, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb7}, + {value: 0x1008, lo: 0xb8, hi: 0xb8}, + {value: 0x1b08, lo: 0xb9, hi: 0xba}, + {value: 0x1008, lo: 0xbb, hi: 0xbc}, + {value: 0x1308, lo: 0xbd, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0x1d, offset 0x13a + {value: 0x0000, lo: 0x0e}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x95}, + {value: 0x1008, lo: 0x96, hi: 0x97}, + {value: 0x1308, lo: 0x98, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0x9d}, + {value: 0x1308, lo: 0x9e, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xa1}, + {value: 0x1008, lo: 0xa2, hi: 0xa4}, + {value: 0x0008, lo: 0xa5, hi: 0xa6}, + {value: 0x1008, lo: 0xa7, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb0}, + {value: 0x1308, lo: 0xb1, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xbf}, + // Block 0x1e, offset 0x149 + {value: 0x0000, lo: 0x0d}, + {value: 0x0008, lo: 0x80, hi: 0x81}, + {value: 0x1308, lo: 0x82, hi: 0x82}, + {value: 0x1008, lo: 0x83, hi: 0x84}, + {value: 0x1308, lo: 0x85, hi: 0x86}, + {value: 0x1008, lo: 0x87, hi: 0x8c}, + {value: 0x1308, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x8e}, + {value: 0x1008, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x1008, lo: 0x9a, hi: 0x9c}, + {value: 0x1308, lo: 0x9d, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x1f, offset 0x157 + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x86}, + {value: 0x055d, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8c}, + {value: 0x055d, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbb}, + {value: 0xe105, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbf}, + // Block 0x20, offset 0x161 + {value: 0x0000, lo: 0x01}, + {value: 0x0018, lo: 0x80, hi: 0xbf}, + // Block 0x21, offset 0x163 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xbf}, + // Block 0x22, offset 0x167 + {value: 0x0000, lo: 0x01}, + {value: 0x0008, lo: 0x80, hi: 0xbf}, + // Block 0x23, offset 0x169 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x24, offset 0x175 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x25, offset 0x180 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbf}, + // Block 0x26, offset 0x188 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbf}, + // Block 0x27, offset 0x18e + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9c}, + {value: 0x1308, lo: 0x9d, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x28, offset 0x194 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x29, offset 0x199 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0xe045, lo: 0xb8, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x2a, offset 0x19e + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xbf}, + // Block 0x2b, offset 0x1a1 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xac}, + {value: 0x0018, lo: 0xad, hi: 0xae}, + {value: 0x0008, lo: 0xaf, hi: 0xbf}, + // Block 0x2c, offset 0x1a5 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x2d, offset 0x1ab + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x2e, offset 0x1b0 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x91}, + {value: 0x1308, lo: 0x92, hi: 0x93}, + {value: 0x1b08, lo: 0x94, hi: 0x94}, + {value: 0x0040, lo: 0x95, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb3}, + {value: 0x1b08, lo: 0xb4, hi: 0xb4}, + {value: 0x0018, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x2f, offset 0x1bc + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x1308, lo: 0x92, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x30, offset 0x1c6 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xb3}, + {value: 0x1340, lo: 0xb4, hi: 0xb5}, + {value: 0x1008, lo: 0xb6, hi: 0xb6}, + {value: 0x1308, lo: 0xb7, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbf}, + // Block 0x31, offset 0x1cc + {value: 0x0000, lo: 0x10}, + {value: 0x1008, lo: 0x80, hi: 0x85}, + {value: 0x1308, lo: 0x86, hi: 0x86}, + {value: 0x1008, lo: 0x87, hi: 0x88}, + {value: 0x1308, lo: 0x89, hi: 0x91}, + {value: 0x1b08, lo: 0x92, hi: 0x92}, + {value: 0x1308, lo: 0x93, hi: 0x93}, + {value: 0x0018, lo: 0x94, hi: 0x96}, + {value: 0x0008, lo: 0x97, hi: 0x97}, + {value: 0x0018, lo: 0x98, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0x9c}, + {value: 0x1308, lo: 0x9d, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x32, offset 0x1dd + {value: 0x0000, lo: 0x09}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x86}, + {value: 0x0218, lo: 0x87, hi: 0x87}, + {value: 0x0018, lo: 0x88, hi: 0x8a}, + {value: 0x13c0, lo: 0x8b, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0208, lo: 0xa0, hi: 0xbf}, + // Block 0x33, offset 0x1e7 + {value: 0x0000, lo: 0x02}, + {value: 0x0208, lo: 0x80, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0x34, offset 0x1ea + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x1308, lo: 0x85, hi: 0x86}, + {value: 0x0208, lo: 0x87, hi: 0xa8}, + {value: 0x1308, lo: 0xa9, hi: 0xa9}, + {value: 0x0208, lo: 0xaa, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x35, offset 0x1f2 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0x36, offset 0x1f5 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x1308, lo: 0xa0, hi: 0xa2}, + {value: 0x1008, lo: 0xa3, hi: 0xa6}, + {value: 0x1308, lo: 0xa7, hi: 0xa8}, + {value: 0x1008, lo: 0xa9, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x1008, lo: 0xb0, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb2}, + {value: 0x1008, lo: 0xb3, hi: 0xb8}, + {value: 0x1308, lo: 0xb9, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x37, offset 0x202 + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x38, offset 0x20a + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x39, offset 0x20e + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0028, lo: 0x9a, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0xbf}, + // Block 0x3a, offset 0x215 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x1308, lo: 0x97, hi: 0x98}, + {value: 0x1008, lo: 0x99, hi: 0x9a}, + {value: 0x1308, lo: 0x9b, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x3b, offset 0x21d + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x94}, + {value: 0x1008, lo: 0x95, hi: 0x95}, + {value: 0x1308, lo: 0x96, hi: 0x96}, + {value: 0x1008, lo: 0x97, hi: 0x97}, + {value: 0x1308, lo: 0x98, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x1b08, lo: 0xa0, hi: 0xa0}, + {value: 0x1008, lo: 0xa1, hi: 0xa1}, + {value: 0x1308, lo: 0xa2, hi: 0xa2}, + {value: 0x1008, lo: 0xa3, hi: 0xa4}, + {value: 0x1308, lo: 0xa5, hi: 0xac}, + {value: 0x1008, lo: 0xad, hi: 0xb2}, + {value: 0x1308, lo: 0xb3, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbe}, + {value: 0x1308, lo: 0xbf, hi: 0xbf}, + // Block 0x3c, offset 0x22d + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa7}, + {value: 0x0018, lo: 0xa8, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xbd}, + {value: 0x1318, lo: 0xbe, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x3d, offset 0x239 + {value: 0x0000, lo: 0x01}, + {value: 0x0040, lo: 0x80, hi: 0xbf}, + // Block 0x3e, offset 0x23b + {value: 0x0000, lo: 0x09}, + {value: 0x1308, lo: 0x80, hi: 0x83}, + {value: 0x1008, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0xb3}, + {value: 0x1308, lo: 0xb4, hi: 0xb4}, + {value: 0x1008, lo: 0xb5, hi: 0xb5}, + {value: 0x1308, lo: 0xb6, hi: 0xba}, + {value: 0x1008, lo: 0xbb, hi: 0xbb}, + {value: 0x1308, lo: 0xbc, hi: 0xbc}, + {value: 0x1008, lo: 0xbd, hi: 0xbf}, + // Block 0x3f, offset 0x245 + {value: 0x0000, lo: 0x0b}, + {value: 0x1008, lo: 0x80, hi: 0x81}, + {value: 0x1308, lo: 0x82, hi: 0x82}, + {value: 0x1008, lo: 0x83, hi: 0x83}, + {value: 0x1808, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0xaa}, + {value: 0x1308, lo: 0xab, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x40, offset 0x251 + {value: 0x0000, lo: 0x0b}, + {value: 0x1308, lo: 0x80, hi: 0x81}, + {value: 0x1008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xa0}, + {value: 0x1008, lo: 0xa1, hi: 0xa1}, + {value: 0x1308, lo: 0xa2, hi: 0xa5}, + {value: 0x1008, lo: 0xa6, hi: 0xa7}, + {value: 0x1308, lo: 0xa8, hi: 0xa9}, + {value: 0x1808, lo: 0xaa, hi: 0xaa}, + {value: 0x1b08, lo: 0xab, hi: 0xab}, + {value: 0x1308, lo: 0xac, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xbf}, + // Block 0x41, offset 0x25d + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x1308, lo: 0xa6, hi: 0xa6}, + {value: 0x1008, lo: 0xa7, hi: 0xa7}, + {value: 0x1308, lo: 0xa8, hi: 0xa9}, + {value: 0x1008, lo: 0xaa, hi: 0xac}, + {value: 0x1308, lo: 0xad, hi: 0xad}, + {value: 0x1008, lo: 0xae, hi: 0xae}, + {value: 0x1308, lo: 0xaf, hi: 0xb1}, + {value: 0x1808, lo: 0xb2, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbb}, + {value: 0x0018, lo: 0xbc, hi: 0xbf}, + // Block 0x42, offset 0x269 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa3}, + {value: 0x1008, lo: 0xa4, hi: 0xab}, + {value: 0x1308, lo: 0xac, hi: 0xb3}, + {value: 0x1008, lo: 0xb4, hi: 0xb5}, + {value: 0x1308, lo: 0xb6, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbf}, + // Block 0x43, offset 0x271 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0x44, offset 0x276 + {value: 0x0000, lo: 0x09}, + {value: 0x0e29, lo: 0x80, hi: 0x80}, + {value: 0x0e41, lo: 0x81, hi: 0x81}, + {value: 0x0e59, lo: 0x82, hi: 0x82}, + {value: 0x0e71, lo: 0x83, hi: 0x83}, + {value: 0x0e89, lo: 0x84, hi: 0x85}, + {value: 0x0ea1, lo: 0x86, hi: 0x86}, + {value: 0x0eb9, lo: 0x87, hi: 0x87}, + {value: 0x057d, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0xbf}, + // Block 0x45, offset 0x280 + {value: 0x0000, lo: 0x10}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x1308, lo: 0x90, hi: 0x92}, + {value: 0x0018, lo: 0x93, hi: 0x93}, + {value: 0x1308, lo: 0x94, hi: 0xa0}, + {value: 0x1008, lo: 0xa1, hi: 0xa1}, + {value: 0x1308, lo: 0xa2, hi: 0xa8}, + {value: 0x0008, lo: 0xa9, hi: 0xac}, + {value: 0x1308, lo: 0xad, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb1}, + {value: 0x1008, lo: 0xb2, hi: 0xb3}, + {value: 0x1308, lo: 0xb4, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb7}, + {value: 0x1308, lo: 0xb8, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x46, offset 0x291 + {value: 0x0000, lo: 0x03}, + {value: 0x1308, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xba}, + {value: 0x1308, lo: 0xbb, hi: 0xbf}, + // Block 0x47, offset 0x295 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x87}, + {value: 0xe045, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0xe045, lo: 0x98, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0xe045, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb7}, + {value: 0xe045, lo: 0xb8, hi: 0xbf}, + // Block 0x48, offset 0x2a0 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x1318, lo: 0x90, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbf}, + // Block 0x49, offset 0x2a4 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x88}, + {value: 0x24c1, lo: 0x89, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x4a, offset 0x2ad + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0xab}, + {value: 0x24f1, lo: 0xac, hi: 0xac}, + {value: 0x2529, lo: 0xad, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xae}, + {value: 0x2579, lo: 0xaf, hi: 0xaf}, + {value: 0x25b1, lo: 0xb0, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xbf}, + // Block 0x4b, offset 0x2b5 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x9f}, + {value: 0x0080, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xad}, + {value: 0x0080, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x4c, offset 0x2bb + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0xa8}, + {value: 0x09c5, lo: 0xa9, hi: 0xa9}, + {value: 0x09e5, lo: 0xaa, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xbf}, + // Block 0x4d, offset 0x2c0 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x4e, offset 0x2c3 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xbf}, + // Block 0x4f, offset 0x2c6 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x8b}, + {value: 0x28c1, lo: 0x8c, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0xbf}, + // Block 0x50, offset 0x2ca + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0xb3}, + {value: 0x0e66, lo: 0xb4, hi: 0xb4}, + {value: 0x292a, lo: 0xb5, hi: 0xb5}, + {value: 0x0e86, lo: 0xb6, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0x51, offset 0x2d0 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x9b}, + {value: 0x2941, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0xbf}, + // Block 0x52, offset 0x2d4 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0x53, offset 0x2d8 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0x0018, lo: 0x98, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbc}, + {value: 0x0018, lo: 0xbd, hi: 0xbf}, + // Block 0x54, offset 0x2de + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0xab}, + {value: 0x0018, lo: 0xac, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x55, offset 0x2e5 + {value: 0x0000, lo: 0x05}, + {value: 0xe185, lo: 0x80, hi: 0x8f}, + {value: 0x03f5, lo: 0x90, hi: 0x9f}, + {value: 0x0ea5, lo: 0xa0, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x56, offset 0x2eb + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x57, offset 0x2f3 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xae}, + {value: 0xe075, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbe}, + {value: 0x1b08, lo: 0xbf, hi: 0xbf}, + // Block 0x58, offset 0x2fa + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x59, offset 0x305 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x1308, lo: 0xa0, hi: 0xbf}, + // Block 0x5a, offset 0x30f + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xae}, + {value: 0x0008, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x5b, offset 0x313 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0xbf}, + // Block 0x5c, offset 0x316 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9e}, + {value: 0x0edd, lo: 0x9f, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbf}, + // Block 0x5d, offset 0x31c + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb2}, + {value: 0x0efd, lo: 0xb3, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x5e, offset 0x320 + {value: 0x0020, lo: 0x01}, + {value: 0x0f1d, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x322 + {value: 0x0020, lo: 0x02}, + {value: 0x171d, lo: 0x80, hi: 0x8f}, + {value: 0x18fd, lo: 0x90, hi: 0xbf}, + // Block 0x60, offset 0x325 + {value: 0x0020, lo: 0x01}, + {value: 0x1efd, lo: 0x80, hi: 0xbf}, + // Block 0x61, offset 0x327 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xbf}, + // Block 0x62, offset 0x32a + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x98}, + {value: 0x1308, lo: 0x99, hi: 0x9a}, + {value: 0x29e2, lo: 0x9b, hi: 0x9b}, + {value: 0x2a0a, lo: 0x9c, hi: 0x9c}, + {value: 0x0008, lo: 0x9d, hi: 0x9e}, + {value: 0x2a31, lo: 0x9f, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xbf}, + // Block 0x63, offset 0x334 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xbe}, + {value: 0x2a69, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x337 + {value: 0x0000, lo: 0x0e}, + {value: 0x0040, lo: 0x80, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xb0}, + {value: 0x2a1d, lo: 0xb1, hi: 0xb1}, + {value: 0x2a3d, lo: 0xb2, hi: 0xb2}, + {value: 0x2a5d, lo: 0xb3, hi: 0xb3}, + {value: 0x2a7d, lo: 0xb4, hi: 0xb4}, + {value: 0x2a5d, lo: 0xb5, hi: 0xb5}, + {value: 0x2a9d, lo: 0xb6, hi: 0xb6}, + {value: 0x2abd, lo: 0xb7, hi: 0xb7}, + {value: 0x2add, lo: 0xb8, hi: 0xb9}, + {value: 0x2afd, lo: 0xba, hi: 0xbb}, + {value: 0x2b1d, lo: 0xbc, hi: 0xbd}, + {value: 0x2afd, lo: 0xbe, hi: 0xbf}, + // Block 0x65, offset 0x346 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x34a + {value: 0x0030, lo: 0x04}, + {value: 0x2aa2, lo: 0x80, hi: 0x9d}, + {value: 0x305a, lo: 0x9e, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x30a2, lo: 0xa0, hi: 0xbf}, + // Block 0x67, offset 0x34f + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0x68, offset 0x352 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x69, offset 0x356 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0x6a, offset 0x35b + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xbf}, + // Block 0x6b, offset 0x360 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x0018, lo: 0xa6, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb1}, + {value: 0x0018, lo: 0xb2, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0x6c, offset 0x366 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0xb6}, + {value: 0x0008, lo: 0xb7, hi: 0xb7}, + {value: 0x2009, lo: 0xb8, hi: 0xb8}, + {value: 0x6e89, lo: 0xb9, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xbf}, + // Block 0x6d, offset 0x36c + {value: 0x0000, lo: 0x0e}, + {value: 0x0008, lo: 0x80, hi: 0x81}, + {value: 0x1308, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0x85}, + {value: 0x1b08, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x8a}, + {value: 0x1308, lo: 0x8b, hi: 0x8b}, + {value: 0x0008, lo: 0x8c, hi: 0xa2}, + {value: 0x1008, lo: 0xa3, hi: 0xa4}, + {value: 0x1308, lo: 0xa5, hi: 0xa6}, + {value: 0x1008, lo: 0xa7, hi: 0xa7}, + {value: 0x0018, lo: 0xa8, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x6e, offset 0x37b + {value: 0x0000, lo: 0x05}, + {value: 0x0208, lo: 0x80, hi: 0xb1}, + {value: 0x0108, lo: 0xb2, hi: 0xb2}, + {value: 0x0008, lo: 0xb3, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0x6f, offset 0x381 + {value: 0x0000, lo: 0x03}, + {value: 0x1008, lo: 0x80, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0xb3}, + {value: 0x1008, lo: 0xb4, hi: 0xbf}, + // Block 0x70, offset 0x385 + {value: 0x0000, lo: 0x0e}, + {value: 0x1008, lo: 0x80, hi: 0x83}, + {value: 0x1b08, lo: 0x84, hi: 0x84}, + {value: 0x1308, lo: 0x85, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x1308, lo: 0xa0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xba}, + {value: 0x0008, lo: 0xbb, hi: 0xbb}, + {value: 0x0018, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x71, offset 0x394 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x1308, lo: 0xa6, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x72, offset 0x399 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x1308, lo: 0x87, hi: 0x91}, + {value: 0x1008, lo: 0x92, hi: 0x92}, + {value: 0x1808, lo: 0x93, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x73, offset 0x3a1 + {value: 0x0000, lo: 0x09}, + {value: 0x1308, lo: 0x80, hi: 0x82}, + {value: 0x1008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0xb2}, + {value: 0x1308, lo: 0xb3, hi: 0xb3}, + {value: 0x1008, lo: 0xb4, hi: 0xb5}, + {value: 0x1308, lo: 0xb6, hi: 0xb9}, + {value: 0x1008, lo: 0xba, hi: 0xbb}, + {value: 0x1308, lo: 0xbc, hi: 0xbc}, + {value: 0x1008, lo: 0xbd, hi: 0xbf}, + // Block 0x74, offset 0x3ab + {value: 0x0000, lo: 0x0a}, + {value: 0x1808, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa4}, + {value: 0x1308, lo: 0xa5, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x75, offset 0x3b6 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa8}, + {value: 0x1308, lo: 0xa9, hi: 0xae}, + {value: 0x1008, lo: 0xaf, hi: 0xb0}, + {value: 0x1308, lo: 0xb1, hi: 0xb2}, + {value: 0x1008, lo: 0xb3, hi: 0xb4}, + {value: 0x1308, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x76, offset 0x3be + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x82}, + {value: 0x1308, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x8b}, + {value: 0x1308, lo: 0x8c, hi: 0x8c}, + {value: 0x1008, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xba}, + {value: 0x1008, lo: 0xbb, hi: 0xbb}, + {value: 0x1308, lo: 0xbc, hi: 0xbc}, + {value: 0x1008, lo: 0xbd, hi: 0xbd}, + {value: 0x0008, lo: 0xbe, hi: 0xbf}, + // Block 0x77, offset 0x3cf + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb6}, + {value: 0x1308, lo: 0xb7, hi: 0xb8}, + {value: 0x0008, lo: 0xb9, hi: 0xbd}, + {value: 0x1308, lo: 0xbe, hi: 0xbf}, + // Block 0x78, offset 0x3d8 + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x1308, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x9a}, + {value: 0x0008, lo: 0x9b, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xaa}, + {value: 0x1008, lo: 0xab, hi: 0xab}, + {value: 0x1308, lo: 0xac, hi: 0xad}, + {value: 0x1008, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb4}, + {value: 0x1008, lo: 0xb5, hi: 0xb5}, + {value: 0x1b08, lo: 0xb6, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x79, offset 0x3e8 + {value: 0x0000, lo: 0x0c}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x88}, + {value: 0x0008, lo: 0x89, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x90}, + {value: 0x0008, lo: 0x91, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x7a, offset 0x3f5 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9b}, + {value: 0x4465, lo: 0x9c, hi: 0x9c}, + {value: 0x447d, lo: 0x9d, hi: 0x9d}, + {value: 0x2971, lo: 0x9e, hi: 0x9e}, + {value: 0xe06d, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xaf}, + {value: 0x4495, lo: 0xb0, hi: 0xbf}, + // Block 0x7b, offset 0x3ff + {value: 0x0000, lo: 0x04}, + {value: 0x44b5, lo: 0x80, hi: 0x8f}, + {value: 0x44d5, lo: 0x90, hi: 0x9f}, + {value: 0x44f5, lo: 0xa0, hi: 0xaf}, + {value: 0x44d5, lo: 0xb0, hi: 0xbf}, + // Block 0x7c, offset 0x404 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0xa2}, + {value: 0x1008, lo: 0xa3, hi: 0xa4}, + {value: 0x1308, lo: 0xa5, hi: 0xa5}, + {value: 0x1008, lo: 0xa6, hi: 0xa7}, + {value: 0x1308, lo: 0xa8, hi: 0xa8}, + {value: 0x1008, lo: 0xa9, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xab}, + {value: 0x1008, lo: 0xac, hi: 0xac}, + {value: 0x1b08, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x7d, offset 0x411 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x7e, offset 0x415 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8a}, + {value: 0x0018, lo: 0x8b, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x7f, offset 0x41a + {value: 0x0020, lo: 0x01}, + {value: 0x4515, lo: 0x80, hi: 0xbf}, + // Block 0x80, offset 0x41c + {value: 0x0020, lo: 0x03}, + {value: 0x4d15, lo: 0x80, hi: 0x94}, + {value: 0x4ad5, lo: 0x95, hi: 0x95}, + {value: 0x4fb5, lo: 0x96, hi: 0xbf}, + // Block 0x81, offset 0x420 + {value: 0x0020, lo: 0x01}, + {value: 0x54f5, lo: 0x80, hi: 0xbf}, + // Block 0x82, offset 0x422 + {value: 0x0020, lo: 0x03}, + {value: 0x5cf5, lo: 0x80, hi: 0x84}, + {value: 0x5655, lo: 0x85, hi: 0x85}, + {value: 0x5d95, lo: 0x86, hi: 0xbf}, + // Block 0x83, offset 0x426 + {value: 0x0020, lo: 0x08}, + {value: 0x6b55, lo: 0x80, hi: 0x8f}, + {value: 0x6d15, lo: 0x90, hi: 0x90}, + {value: 0x6d55, lo: 0x91, hi: 0xab}, + {value: 0x6ea1, lo: 0xac, hi: 0xac}, + {value: 0x70b5, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x70d5, lo: 0xb0, hi: 0xbf}, + // Block 0x84, offset 0x42f + {value: 0x0020, lo: 0x05}, + {value: 0x72d5, lo: 0x80, hi: 0xad}, + {value: 0x6535, lo: 0xae, hi: 0xae}, + {value: 0x7895, lo: 0xaf, hi: 0xb5}, + {value: 0x6f55, lo: 0xb6, hi: 0xb6}, + {value: 0x7975, lo: 0xb7, hi: 0xbf}, + // Block 0x85, offset 0x435 + {value: 0x0028, lo: 0x03}, + {value: 0x7c21, lo: 0x80, hi: 0x82}, + {value: 0x7be1, lo: 0x83, hi: 0x83}, + {value: 0x7c99, lo: 0x84, hi: 0xbf}, + // Block 0x86, offset 0x439 + {value: 0x0038, lo: 0x0f}, + {value: 0x9db1, lo: 0x80, hi: 0x83}, + {value: 0x9e59, lo: 0x84, hi: 0x85}, + {value: 0x9e91, lo: 0x86, hi: 0x87}, + {value: 0x9ec9, lo: 0x88, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0xa089, lo: 0x92, hi: 0x97}, + {value: 0xa1a1, lo: 0x98, hi: 0x9c}, + {value: 0xa281, lo: 0x9d, hi: 0xb3}, + {value: 0x9d41, lo: 0xb4, hi: 0xb4}, + {value: 0x9db1, lo: 0xb5, hi: 0xb5}, + {value: 0xa789, lo: 0xb6, hi: 0xbb}, + {value: 0xa869, lo: 0xbc, hi: 0xbc}, + {value: 0xa7f9, lo: 0xbd, hi: 0xbd}, + {value: 0xa8d9, lo: 0xbe, hi: 0xbf}, + // Block 0x87, offset 0x449 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbb}, + {value: 0x0008, lo: 0xbc, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0x88, offset 0x453 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0x89, offset 0x458 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x8a, offset 0x45b + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0x8b, offset 0x461 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa0}, + {value: 0x0040, lo: 0xa1, hi: 0xbf}, + // Block 0x8c, offset 0x468 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbc}, + {value: 0x1308, lo: 0xbd, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x8d, offset 0x46d + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x8e, offset 0x471 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x9f}, + {value: 0x1308, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x8f, offset 0x477 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x90, offset 0x47c + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb5}, + {value: 0x1308, lo: 0xb6, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x91, offset 0x485 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x92, offset 0x48a + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0x93, offset 0x490 + {value: 0x0000, lo: 0x06}, + {value: 0xe145, lo: 0x80, hi: 0x87}, + {value: 0xe1c5, lo: 0x88, hi: 0x8f}, + {value: 0xe145, lo: 0x90, hi: 0x97}, + {value: 0x8ad5, lo: 0x98, hi: 0x9f}, + {value: 0x8aed, lo: 0xa0, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xbf}, + // Block 0x94, offset 0x497 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x8aed, lo: 0xb0, hi: 0xb7}, + {value: 0x8ad5, lo: 0xb8, hi: 0xbf}, + // Block 0x95, offset 0x49e + {value: 0x0000, lo: 0x06}, + {value: 0xe145, lo: 0x80, hi: 0x87}, + {value: 0xe1c5, lo: 0x88, hi: 0x8f}, + {value: 0xe145, lo: 0x90, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x96, offset 0x4a5 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x97, offset 0x4a9 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xae}, + {value: 0x0018, lo: 0xaf, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x98, offset 0x4ae + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x99, offset 0x4b1 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xbf}, + // Block 0x9a, offset 0x4b6 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb6}, + {value: 0x0008, lo: 0xb7, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbb}, + {value: 0x0008, lo: 0xbc, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x4c2 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x96}, + {value: 0x0018, lo: 0x97, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0x9c, offset 0x4c8 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa6}, + {value: 0x0018, lo: 0xa7, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x9d, offset 0x4cd + {value: 0x0000, lo: 0x06}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb3}, + {value: 0x0008, lo: 0xb4, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbf}, + // Block 0x9e, offset 0x4d4 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0018, lo: 0x96, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x9f, offset 0x4dc + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbb}, + {value: 0x0018, lo: 0xbc, hi: 0xbd}, + {value: 0x0008, lo: 0xbe, hi: 0xbf}, + // Block 0xa0, offset 0x4e1 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x91}, + {value: 0x0018, lo: 0x92, hi: 0xbf}, + // Block 0xa1, offset 0x4e5 + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x1308, lo: 0x81, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x1308, lo: 0x85, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8b}, + {value: 0x1308, lo: 0x8c, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x94}, + {value: 0x0008, lo: 0x95, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0x98}, + {value: 0x0008, lo: 0x99, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb7}, + {value: 0x1308, lo: 0xb8, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbe}, + {value: 0x1b08, lo: 0xbf, hi: 0xbf}, + // Block 0xa2, offset 0x4f5 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbc}, + {value: 0x0018, lo: 0xbd, hi: 0xbf}, + // Block 0xa3, offset 0x4fc + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0xa4, offset 0x500 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb8}, + {value: 0x0018, lo: 0xb9, hi: 0xbf}, + // Block 0xa5, offset 0x504 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0x0018, lo: 0x98, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xbf}, + // Block 0xa6, offset 0x50b + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0xbf}, + // Block 0xa7, offset 0x50e + {value: 0x0000, lo: 0x02}, + {value: 0x03dd, lo: 0x80, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xa8, offset 0x511 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb9}, + {value: 0x0018, lo: 0xba, hi: 0xbf}, + // Block 0xa9, offset 0x515 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xaa, offset 0x519 + {value: 0x0000, lo: 0x05}, + {value: 0x1008, lo: 0x80, hi: 0x80}, + {value: 0x1308, lo: 0x81, hi: 0x81}, + {value: 0x1008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xb7}, + {value: 0x1308, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x51f + {value: 0x0000, lo: 0x08}, + {value: 0x1308, lo: 0x80, hi: 0x85}, + {value: 0x1b08, lo: 0x86, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x91}, + {value: 0x0018, lo: 0x92, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbe}, + {value: 0x1b08, lo: 0xbf, hi: 0xbf}, + // Block 0xac, offset 0x528 + {value: 0x0000, lo: 0x0b}, + {value: 0x1308, lo: 0x80, hi: 0x81}, + {value: 0x1008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xaf}, + {value: 0x1008, lo: 0xb0, hi: 0xb2}, + {value: 0x1308, lo: 0xb3, hi: 0xb6}, + {value: 0x1008, lo: 0xb7, hi: 0xb8}, + {value: 0x1b08, lo: 0xb9, hi: 0xb9}, + {value: 0x1308, lo: 0xba, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbc}, + {value: 0x0340, lo: 0xbd, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0xad, offset 0x534 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x81}, + {value: 0x0040, lo: 0x82, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xae, offset 0x53b + {value: 0x0000, lo: 0x08}, + {value: 0x1308, lo: 0x80, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xa6}, + {value: 0x1308, lo: 0xa7, hi: 0xab}, + {value: 0x1008, lo: 0xac, hi: 0xac}, + {value: 0x1308, lo: 0xad, hi: 0xb2}, + {value: 0x1b08, lo: 0xb3, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xb5}, + {value: 0x0008, lo: 0xb6, hi: 0xbf}, + // Block 0xaf, offset 0x544 + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb2}, + {value: 0x1308, lo: 0xb3, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb5}, + {value: 0x0008, lo: 0xb6, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xb0, offset 0x54c + {value: 0x0000, lo: 0x06}, + {value: 0x1308, lo: 0x80, hi: 0x81}, + {value: 0x1008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xb2}, + {value: 0x1008, lo: 0xb3, hi: 0xb5}, + {value: 0x1308, lo: 0xb6, hi: 0xbe}, + {value: 0x1008, lo: 0xbf, hi: 0xbf}, + // Block 0xb1, offset 0x553 + {value: 0x0000, lo: 0x0d}, + {value: 0x1808, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x89}, + {value: 0x1308, lo: 0x8a, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0xb2, offset 0x561 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0x92}, + {value: 0x0008, lo: 0x93, hi: 0xab}, + {value: 0x1008, lo: 0xac, hi: 0xae}, + {value: 0x1308, lo: 0xaf, hi: 0xb1}, + {value: 0x1008, lo: 0xb2, hi: 0xb3}, + {value: 0x1308, lo: 0xb4, hi: 0xb4}, + {value: 0x1808, lo: 0xb5, hi: 0xb5}, + {value: 0x1308, lo: 0xb6, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xbd}, + {value: 0x1308, lo: 0xbe, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xb3, offset 0x56e + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9e}, + {value: 0x0008, lo: 0x9f, hi: 0xa8}, + {value: 0x0018, lo: 0xa9, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xb4, offset 0x57b + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x1308, lo: 0x9f, hi: 0x9f}, + {value: 0x1008, lo: 0xa0, hi: 0xa2}, + {value: 0x1308, lo: 0xa3, hi: 0xa9}, + {value: 0x1b08, lo: 0xaa, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xb5, offset 0x584 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xb4}, + {value: 0x1008, lo: 0xb5, hi: 0xb7}, + {value: 0x1308, lo: 0xb8, hi: 0xbf}, + // Block 0xb6, offset 0x588 + {value: 0x0000, lo: 0x0d}, + {value: 0x1008, lo: 0x80, hi: 0x81}, + {value: 0x1b08, lo: 0x82, hi: 0x82}, + {value: 0x1308, lo: 0x83, hi: 0x84}, + {value: 0x1008, lo: 0x85, hi: 0x85}, + {value: 0x1308, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x8a}, + {value: 0x0018, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0xb7, offset 0x596 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x1008, lo: 0xb0, hi: 0xb2}, + {value: 0x1308, lo: 0xb3, hi: 0xb8}, + {value: 0x1008, lo: 0xb9, hi: 0xb9}, + {value: 0x1308, lo: 0xba, hi: 0xba}, + {value: 0x1008, lo: 0xbb, hi: 0xbe}, + {value: 0x1308, lo: 0xbf, hi: 0xbf}, + // Block 0xb8, offset 0x59e + {value: 0x0000, lo: 0x0a}, + {value: 0x1308, lo: 0x80, hi: 0x80}, + {value: 0x1008, lo: 0x81, hi: 0x81}, + {value: 0x1b08, lo: 0x82, hi: 0x82}, + {value: 0x1308, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x85}, + {value: 0x0018, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xb9, offset 0x5a9 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xae}, + {value: 0x1008, lo: 0xaf, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x1008, lo: 0xb8, hi: 0xbb}, + {value: 0x1308, lo: 0xbc, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbe}, + {value: 0x1b08, lo: 0xbf, hi: 0xbf}, + // Block 0xba, offset 0x5b2 + {value: 0x0000, lo: 0x05}, + {value: 0x1308, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x9b}, + {value: 0x1308, lo: 0x9c, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0xbb, offset 0x5b8 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x1008, lo: 0xb0, hi: 0xb2}, + {value: 0x1308, lo: 0xb3, hi: 0xba}, + {value: 0x1008, lo: 0xbb, hi: 0xbc}, + {value: 0x1308, lo: 0xbd, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbe}, + {value: 0x1b08, lo: 0xbf, hi: 0xbf}, + // Block 0xbc, offset 0x5c0 + {value: 0x0000, lo: 0x08}, + {value: 0x1308, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xbf}, + // Block 0xbd, offset 0x5c9 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x1308, lo: 0xab, hi: 0xab}, + {value: 0x1008, lo: 0xac, hi: 0xac}, + {value: 0x1308, lo: 0xad, hi: 0xad}, + {value: 0x1008, lo: 0xae, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb5}, + {value: 0x1808, lo: 0xb6, hi: 0xb6}, + {value: 0x1308, lo: 0xb7, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0xbe, offset 0x5d3 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0xbf}, + // Block 0xbf, offset 0x5d6 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9c}, + {value: 0x1308, lo: 0x9d, hi: 0x9f}, + {value: 0x1008, lo: 0xa0, hi: 0xa1}, + {value: 0x1308, lo: 0xa2, hi: 0xa5}, + {value: 0x1008, lo: 0xa6, hi: 0xa6}, + {value: 0x1308, lo: 0xa7, hi: 0xaa}, + {value: 0x1b08, lo: 0xab, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0018, lo: 0xba, hi: 0xbf}, + // Block 0xc0, offset 0x5e2 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x049d, lo: 0xa0, hi: 0xbf}, + // Block 0xc1, offset 0x5e5 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0xc2, offset 0x5ea + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0xc3, offset 0x5ed + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0xae}, + {value: 0x1008, lo: 0xaf, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb7}, + {value: 0x1308, lo: 0xb8, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbe}, + {value: 0x1b08, lo: 0xbf, hi: 0xbf}, + // Block 0xc4, offset 0x5f7 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xbf}, + // Block 0xc5, offset 0x600 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x91}, + {value: 0x1308, lo: 0x92, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xa8}, + {value: 0x1008, lo: 0xa9, hi: 0xa9}, + {value: 0x1308, lo: 0xaa, hi: 0xb0}, + {value: 0x1008, lo: 0xb1, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb3}, + {value: 0x1008, lo: 0xb4, hi: 0xb4}, + {value: 0x1308, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xc6, offset 0x60c + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xc7, offset 0x60f + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0xc8, offset 0x614 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0xbf}, + // Block 0xc9, offset 0x617 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xbf}, + // Block 0xca, offset 0x61a + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0xbf}, + // Block 0xcb, offset 0x61d + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0xcc, offset 0x624 + {value: 0x0000, lo: 0x06}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb4}, + {value: 0x0018, lo: 0xb5, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0xcd, offset 0x62b + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0xce, offset 0x62f + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xa2}, + {value: 0x0008, lo: 0xa3, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbf}, + // Block 0xcf, offset 0x63a + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0xbf}, + // Block 0xd0, offset 0x63d + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x1008, lo: 0x91, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xd1, offset 0x643 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x8e}, + {value: 0x1308, lo: 0x8f, hi: 0x92}, + {value: 0x0008, lo: 0x93, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0xd2, offset 0x648 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa0}, + {value: 0x0040, lo: 0xa1, hi: 0xbf}, + // Block 0xd3, offset 0x64c + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xbf}, + // Block 0xd4, offset 0x64f + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xd5, offset 0x652 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x81}, + {value: 0x0040, lo: 0x82, hi: 0xbf}, + // Block 0xd6, offset 0x655 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0xd7, offset 0x65a + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0x9c}, + {value: 0x1308, lo: 0x9d, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x03c0, lo: 0xa0, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xbf}, + // Block 0xd8, offset 0x664 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0xd9, offset 0x667 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa8}, + {value: 0x0018, lo: 0xa9, hi: 0xbf}, + // Block 0xda, offset 0x66b + {value: 0x0000, lo: 0x0e}, + {value: 0x0018, lo: 0x80, hi: 0x9d}, + {value: 0xb5b9, lo: 0x9e, hi: 0x9e}, + {value: 0xb601, lo: 0x9f, hi: 0x9f}, + {value: 0xb649, lo: 0xa0, hi: 0xa0}, + {value: 0xb6b1, lo: 0xa1, hi: 0xa1}, + {value: 0xb719, lo: 0xa2, hi: 0xa2}, + {value: 0xb781, lo: 0xa3, hi: 0xa3}, + {value: 0xb7e9, lo: 0xa4, hi: 0xa4}, + {value: 0x1018, lo: 0xa5, hi: 0xa6}, + {value: 0x1318, lo: 0xa7, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xac}, + {value: 0x1018, lo: 0xad, hi: 0xb2}, + {value: 0x0340, lo: 0xb3, hi: 0xba}, + {value: 0x1318, lo: 0xbb, hi: 0xbf}, + // Block 0xdb, offset 0x67a + {value: 0x0000, lo: 0x0b}, + {value: 0x1318, lo: 0x80, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0x84}, + {value: 0x1318, lo: 0x85, hi: 0x8b}, + {value: 0x0018, lo: 0x8c, hi: 0xa9}, + {value: 0x1318, lo: 0xaa, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xba}, + {value: 0xb851, lo: 0xbb, hi: 0xbb}, + {value: 0xb899, lo: 0xbc, hi: 0xbc}, + {value: 0xb8e1, lo: 0xbd, hi: 0xbd}, + {value: 0xb949, lo: 0xbe, hi: 0xbe}, + {value: 0xb9b1, lo: 0xbf, hi: 0xbf}, + // Block 0xdc, offset 0x686 + {value: 0x0000, lo: 0x03}, + {value: 0xba19, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xbf}, + // Block 0xdd, offset 0x68a + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x81}, + {value: 0x1318, lo: 0x82, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0xbf}, + // Block 0xde, offset 0x68f + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xdf, offset 0x694 + {value: 0x0000, lo: 0x03}, + {value: 0x1308, lo: 0x80, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xba}, + {value: 0x1308, lo: 0xbb, hi: 0xbf}, + // Block 0xe0, offset 0x698 + {value: 0x0000, lo: 0x04}, + {value: 0x1308, lo: 0x80, hi: 0xac}, + {value: 0x0018, lo: 0xad, hi: 0xb4}, + {value: 0x1308, lo: 0xb5, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0xe1, offset 0x69d + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x1308, lo: 0x84, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x9a}, + {value: 0x1308, lo: 0x9b, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa0}, + {value: 0x1308, lo: 0xa1, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0xe2, offset 0x6a6 + {value: 0x0000, lo: 0x0a}, + {value: 0x1308, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x1308, lo: 0x88, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x9a}, + {value: 0x1308, lo: 0x9b, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xa2}, + {value: 0x1308, lo: 0xa3, hi: 0xa4}, + {value: 0x0040, lo: 0xa5, hi: 0xa5}, + {value: 0x1308, lo: 0xa6, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xbf}, + // Block 0xe3, offset 0x6b1 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0x8f}, + {value: 0x1308, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0xbf}, + // Block 0xe4, offset 0x6b7 + {value: 0x0000, lo: 0x07}, + {value: 0x0208, lo: 0x80, hi: 0x83}, + {value: 0x1308, lo: 0x84, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0xe5, offset 0x6bf + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xe6, offset 0x6c3 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0xe7, offset 0x6c7 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xbf}, + // Block 0xe8, offset 0x6cd + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x0018, lo: 0x91, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0xe9, offset 0x6d3 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x8f}, + {value: 0xc1c1, lo: 0x90, hi: 0x90}, + {value: 0x0018, lo: 0x91, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xbf}, + // Block 0xea, offset 0x6d8 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0xa5}, + {value: 0x0018, lo: 0xa6, hi: 0xbf}, + // Block 0xeb, offset 0x6db + {value: 0x0000, lo: 0x0d}, + {value: 0xc7e9, lo: 0x80, hi: 0x80}, + {value: 0xc839, lo: 0x81, hi: 0x81}, + {value: 0xc889, lo: 0x82, hi: 0x82}, + {value: 0xc8d9, lo: 0x83, hi: 0x83}, + {value: 0xc929, lo: 0x84, hi: 0x84}, + {value: 0xc979, lo: 0x85, hi: 0x85}, + {value: 0xc9c9, lo: 0x86, hi: 0x86}, + {value: 0xca19, lo: 0x87, hi: 0x87}, + {value: 0xca69, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0xcab9, lo: 0x90, hi: 0x90}, + {value: 0xcad9, lo: 0x91, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0xbf}, + // Block 0xec, offset 0x6e9 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x92}, + {value: 0x0040, lo: 0x93, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xed, offset 0x6f0 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0xee, offset 0x6f3 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x94}, + {value: 0x0040, lo: 0x95, hi: 0xbf}, + // Block 0xef, offset 0x6f6 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0xf0, offset 0x6fa + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbf}, + // Block 0xf1, offset 0x700 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xbf}, + // Block 0xf2, offset 0x705 + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xb2}, + {value: 0x0018, lo: 0xb3, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xf3, offset 0x70f + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xbf}, + // Block 0xf4, offset 0x714 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0xbf}, + // Block 0xf5, offset 0x717 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0xbf}, + // Block 0xf6, offset 0x71a + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0xbf}, + // Block 0xf7, offset 0x71d + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0xf8, offset 0x720 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0xf9, offset 0x724 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xbf}, + // Block 0xfa, offset 0x727 + {value: 0x0020, lo: 0x0f}, + {value: 0xdeb9, lo: 0x80, hi: 0x89}, + {value: 0x8dfd, lo: 0x8a, hi: 0x8a}, + {value: 0xdff9, lo: 0x8b, hi: 0x9c}, + {value: 0x8e1d, lo: 0x9d, hi: 0x9d}, + {value: 0xe239, lo: 0x9e, hi: 0xa2}, + {value: 0x8e3d, lo: 0xa3, hi: 0xa3}, + {value: 0xe2d9, lo: 0xa4, hi: 0xab}, + {value: 0x7ed5, lo: 0xac, hi: 0xac}, + {value: 0xe3d9, lo: 0xad, hi: 0xaf}, + {value: 0x8e5d, lo: 0xb0, hi: 0xb0}, + {value: 0xe439, lo: 0xb1, hi: 0xb6}, + {value: 0x8e7d, lo: 0xb7, hi: 0xb9}, + {value: 0xe4f9, lo: 0xba, hi: 0xba}, + {value: 0x8edd, lo: 0xbb, hi: 0xbb}, + {value: 0xe519, lo: 0xbc, hi: 0xbf}, + // Block 0xfb, offset 0x737 + {value: 0x0020, lo: 0x10}, + {value: 0x937d, lo: 0x80, hi: 0x80}, + {value: 0xf099, lo: 0x81, hi: 0x86}, + {value: 0x939d, lo: 0x87, hi: 0x8a}, + {value: 0xd9f9, lo: 0x8b, hi: 0x8b}, + {value: 0xf159, lo: 0x8c, hi: 0x96}, + {value: 0x941d, lo: 0x97, hi: 0x97}, + {value: 0xf2b9, lo: 0x98, hi: 0xa3}, + {value: 0x943d, lo: 0xa4, hi: 0xa6}, + {value: 0xf439, lo: 0xa7, hi: 0xaa}, + {value: 0x949d, lo: 0xab, hi: 0xab}, + {value: 0xf4b9, lo: 0xac, hi: 0xac}, + {value: 0x94bd, lo: 0xad, hi: 0xad}, + {value: 0xf4d9, lo: 0xae, hi: 0xaf}, + {value: 0x94dd, lo: 0xb0, hi: 0xb1}, + {value: 0xf519, lo: 0xb2, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xfc, offset 0x748 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0340, lo: 0x81, hi: 0x81}, + {value: 0x0040, lo: 0x82, hi: 0x9f}, + {value: 0x0340, lo: 0xa0, hi: 0xbf}, + // Block 0xfd, offset 0x74d + {value: 0x0000, lo: 0x01}, + {value: 0x0340, lo: 0x80, hi: 0xbf}, + // Block 0xfe, offset 0x74f + {value: 0x0000, lo: 0x01}, + {value: 0x13c0, lo: 0x80, hi: 0xbf}, + // Block 0xff, offset 0x751 + {value: 0x0000, lo: 0x02}, + {value: 0x13c0, lo: 0x80, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, +} + +// Total table size 41559 bytes (40KiB); checksum: F4A1FA4E diff --git a/vendor/golang.org/x/net/idna/trie.go b/vendor/golang.org/x/net/idna/trie.go new file mode 100644 index 00000000000..c4ef847e7a3 --- /dev/null +++ b/vendor/golang.org/x/net/idna/trie.go @@ -0,0 +1,72 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package idna + +// appendMapping appends the mapping for the respective rune. isMapped must be +// true. A mapping is a categorization of a rune as defined in UTS #46. +func (c info) appendMapping(b []byte, s string) []byte { + index := int(c >> indexShift) + if c&xorBit == 0 { + s := mappings[index:] + return append(b, s[1:s[0]+1]...) + } + b = append(b, s...) + if c&inlineXOR == inlineXOR { + // TODO: support and handle two-byte inline masks + b[len(b)-1] ^= byte(index) + } else { + for p := len(b) - int(xorData[index]); p < len(b); p++ { + index++ + b[p] ^= xorData[index] + } + } + return b +} + +// Sparse block handling code. + +type valueRange struct { + value uint16 // header: value:stride + lo, hi byte // header: lo:n +} + +type sparseBlocks struct { + values []valueRange + offset []uint16 +} + +var idnaSparse = sparseBlocks{ + values: idnaSparseValues[:], + offset: idnaSparseOffset[:], +} + +// Don't use newIdnaTrie to avoid unconditional linking in of the table. +var trie = &idnaTrie{} + +// lookup determines the type of block n and looks up the value for b. +// For n < t.cutoff, the block is a simple lookup table. Otherwise, the block +// is a list of ranges with an accompanying value. Given a matching range r, +// the value for b is by r.value + (b - r.lo) * stride. +func (t *sparseBlocks) lookup(n uint32, b byte) uint16 { + offset := t.offset[n] + header := t.values[offset] + lo := offset + 1 + hi := lo + uint16(header.lo) + for lo < hi { + m := lo + (hi-lo)/2 + r := t.values[m] + if r.lo <= b && b <= r.hi { + return r.value + uint16(b-r.lo)*header.value + } + if b < r.lo { + hi = m + } else { + lo = m + 1 + } + } + return 0 +} diff --git a/vendor/golang.org/x/net/idna/trieval.go b/vendor/golang.org/x/net/idna/trieval.go new file mode 100644 index 00000000000..63cb03b59b1 --- /dev/null +++ b/vendor/golang.org/x/net/idna/trieval.go @@ -0,0 +1,114 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package idna + +// This file contains definitions for interpreting the trie value of the idna +// trie generated by "go run gen*.go". It is shared by both the generator +// program and the resultant package. Sharing is achieved by the generator +// copying gen_trieval.go to trieval.go and changing what's above this comment. + +// info holds information from the IDNA mapping table for a single rune. It is +// the value returned by a trie lookup. In most cases, all information fits in +// a 16-bit value. For mappings, this value may contain an index into a slice +// with the mapped string. Such mappings can consist of the actual mapped value +// or an XOR pattern to be applied to the bytes of the UTF8 encoding of the +// input rune. This technique is used by the cases packages and reduces the +// table size significantly. +// +// The per-rune values have the following format: +// +// if mapped { +// if inlinedXOR { +// 15..13 inline XOR marker +// 12..11 unused +// 10..3 inline XOR mask +// } else { +// 15..3 index into xor or mapping table +// } +// } else { +// 15..13 unused +// 12 modifier (including virama) +// 11 virama modifier +// 10..8 joining type +// 7..3 category type +// } +// 2 use xor pattern +// 1..0 mapped category +// +// See the definitions below for a more detailed description of the various +// bits. +type info uint16 + +const ( + catSmallMask = 0x3 + catBigMask = 0xF8 + indexShift = 3 + xorBit = 0x4 // interpret the index as an xor pattern + inlineXOR = 0xE000 // These bits are set if the XOR pattern is inlined. + + joinShift = 8 + joinMask = 0x07 + + viramaModifier = 0x0800 + modifier = 0x1000 +) + +// A category corresponds to a category defined in the IDNA mapping table. +type category uint16 + +const ( + unknown category = 0 // not defined currently in unicode. + mapped category = 1 + disallowedSTD3Mapped category = 2 + deviation category = 3 +) + +const ( + valid category = 0x08 + validNV8 category = 0x18 + validXV8 category = 0x28 + disallowed category = 0x40 + disallowedSTD3Valid category = 0x80 + ignored category = 0xC0 +) + +// join types and additional rune information +const ( + joiningL = (iota + 1) + joiningD + joiningT + joiningR + + //the following types are derived during processing + joinZWJ + joinZWNJ + joinVirama + numJoinTypes +) + +func (c info) isMapped() bool { + return c&0x3 != 0 +} + +func (c info) category() category { + small := c & catSmallMask + if small != 0 { + return category(small) + } + return category(c & catBigMask) +} + +func (c info) joinType() info { + if c.isMapped() { + return 0 + } + return (c >> joinShift) & joinMask +} + +func (c info) isModifier() bool { + return c&(modifier|catSmallMask) == modifier +} + +func (c info) isViramaModifier() bool { + return c&(viramaModifier|catSmallMask) == viramaModifier +} diff --git a/vendor/golang.org/x/net/internal/timeseries/timeseries.go b/vendor/golang.org/x/net/internal/timeseries/timeseries.go index 3f90b7300d4..4b24137ffbc 100644 --- a/vendor/golang.org/x/net/internal/timeseries/timeseries.go +++ b/vendor/golang.org/x/net/internal/timeseries/timeseries.go @@ -371,7 +371,7 @@ func (ts *timeSeries) ComputeRange(start, finish time.Time, num int) []Observabl } } - // Failed to find a level that covers the desired range. So just + // Failed to find a level that covers the desired range. So just // extract from the last level, even if it doesn't cover the entire // desired range. ts.extract(ts.levels[len(ts.levels)-1], start, finish, num, results) diff --git a/vendor/golang.org/x/net/proxy/per_host.go b/vendor/golang.org/x/net/proxy/per_host.go index f540b196f7d..242d5623f80 100644 --- a/vendor/golang.org/x/net/proxy/per_host.go +++ b/vendor/golang.org/x/net/proxy/per_host.go @@ -9,7 +9,7 @@ import ( "strings" ) -// A PerHost directs connections to a default Dialer unless the hostname +// A PerHost directs connections to a default Dialer unless the host name // requested matches one of a number of exceptions. type PerHost struct { def, bypass Dialer @@ -76,7 +76,7 @@ func (p *PerHost) dialerForRequest(host string) Dialer { // AddFromString parses a string that contains comma-separated values // specifying hosts that should use the bypass proxy. Each value is either an -// IP address, a CIDR range, a zone (*.example.com) or a hostname +// IP address, a CIDR range, a zone (*.example.com) or a host name // (localhost). A best effort is made to parse the string and errors are // ignored. func (p *PerHost) AddFromString(s string) { @@ -131,7 +131,7 @@ func (p *PerHost) AddZone(zone string) { p.bypassZones = append(p.bypassZones, zone) } -// AddHost specifies a hostname that will use the bypass proxy. +// AddHost specifies a host name that will use the bypass proxy. func (p *PerHost) AddHost(host string) { if strings.HasSuffix(host, ".") { host = host[:len(host)-1] diff --git a/vendor/golang.org/x/net/proxy/proxy.go b/vendor/golang.org/x/net/proxy/proxy.go index 8ccb0c5f756..9f232f8b5b7 100644 --- a/vendor/golang.org/x/net/proxy/proxy.go +++ b/vendor/golang.org/x/net/proxy/proxy.go @@ -11,6 +11,7 @@ import ( "net" "net/url" "os" + "sync" ) // A Dialer is a means to establish a connection. @@ -27,7 +28,7 @@ type Auth struct { // FromEnvironment returns the dialer specified by the proxy related variables in // the environment. func FromEnvironment() Dialer { - allProxy := os.Getenv("all_proxy") + allProxy := allProxyEnv.Get() if len(allProxy) == 0 { return Direct } @@ -41,7 +42,7 @@ func FromEnvironment() Dialer { return Direct } - noProxy := os.Getenv("no_proxy") + noProxy := noProxyEnv.Get() if len(noProxy) == 0 { return proxy } @@ -92,3 +93,42 @@ func FromURL(u *url.URL, forward Dialer) (Dialer, error) { return nil, errors.New("proxy: unknown scheme: " + u.Scheme) } + +var ( + allProxyEnv = &envOnce{ + names: []string{"ALL_PROXY", "all_proxy"}, + } + noProxyEnv = &envOnce{ + names: []string{"NO_PROXY", "no_proxy"}, + } +) + +// envOnce looks up an environment variable (optionally by multiple +// names) once. It mitigates expensive lookups on some platforms +// (e.g. Windows). +// (Borrowed from net/http/transport.go) +type envOnce struct { + names []string + once sync.Once + val string +} + +func (e *envOnce) Get() string { + e.once.Do(e.init) + return e.val +} + +func (e *envOnce) init() { + for _, n := range e.names { + e.val = os.Getenv(n) + if e.val != "" { + return + } + } +} + +// reset is used by tests +func (e *envOnce) reset() { + e.once = sync.Once{} + e.val = "" +} diff --git a/vendor/golang.org/x/net/proxy/socks5.go b/vendor/golang.org/x/net/proxy/socks5.go index 9b9628239a1..2efec6e8d7e 100644 --- a/vendor/golang.org/x/net/proxy/socks5.go +++ b/vendor/golang.org/x/net/proxy/socks5.go @@ -72,24 +72,28 @@ func (s *socks5) Dial(network, addr string) (net.Conn, error) { if err != nil { return nil, err } - closeConn := &conn - defer func() { - if closeConn != nil { - (*closeConn).Close() - } - }() - - host, portStr, err := net.SplitHostPort(addr) - if err != nil { + if err := s.connect(conn, addr); err != nil { + conn.Close() return nil, err } + return conn, nil +} + +// connect takes an existing connection to a socks5 proxy server, +// and commands the server to extend that connection to target, +// which must be a canonical address with a host and port. +func (s *socks5) connect(conn net.Conn, target string) error { + host, portStr, err := net.SplitHostPort(target) + if err != nil { + return err + } port, err := strconv.Atoi(portStr) if err != nil { - return nil, errors.New("proxy: failed to parse port number: " + portStr) + return errors.New("proxy: failed to parse port number: " + portStr) } if port < 1 || port > 0xffff { - return nil, errors.New("proxy: port number out of range: " + portStr) + return errors.New("proxy: port number out of range: " + portStr) } // the size here is just an estimate @@ -103,17 +107,17 @@ func (s *socks5) Dial(network, addr string) (net.Conn, error) { } if _, err := conn.Write(buf); err != nil { - return nil, errors.New("proxy: failed to write greeting to SOCKS5 proxy at " + s.addr + ": " + err.Error()) + return errors.New("proxy: failed to write greeting to SOCKS5 proxy at " + s.addr + ": " + err.Error()) } if _, err := io.ReadFull(conn, buf[:2]); err != nil { - return nil, errors.New("proxy: failed to read greeting from SOCKS5 proxy at " + s.addr + ": " + err.Error()) + return errors.New("proxy: failed to read greeting from SOCKS5 proxy at " + s.addr + ": " + err.Error()) } if buf[0] != 5 { - return nil, errors.New("proxy: SOCKS5 proxy at " + s.addr + " has unexpected version " + strconv.Itoa(int(buf[0]))) + return errors.New("proxy: SOCKS5 proxy at " + s.addr + " has unexpected version " + strconv.Itoa(int(buf[0]))) } if buf[1] == 0xff { - return nil, errors.New("proxy: SOCKS5 proxy at " + s.addr + " requires authentication") + return errors.New("proxy: SOCKS5 proxy at " + s.addr + " requires authentication") } if buf[1] == socks5AuthPassword { @@ -125,15 +129,15 @@ func (s *socks5) Dial(network, addr string) (net.Conn, error) { buf = append(buf, s.password...) if _, err := conn.Write(buf); err != nil { - return nil, errors.New("proxy: failed to write authentication request to SOCKS5 proxy at " + s.addr + ": " + err.Error()) + return errors.New("proxy: failed to write authentication request to SOCKS5 proxy at " + s.addr + ": " + err.Error()) } if _, err := io.ReadFull(conn, buf[:2]); err != nil { - return nil, errors.New("proxy: failed to read authentication reply from SOCKS5 proxy at " + s.addr + ": " + err.Error()) + return errors.New("proxy: failed to read authentication reply from SOCKS5 proxy at " + s.addr + ": " + err.Error()) } if buf[1] != 0 { - return nil, errors.New("proxy: SOCKS5 proxy at " + s.addr + " rejected username/password") + return errors.New("proxy: SOCKS5 proxy at " + s.addr + " rejected username/password") } } @@ -150,7 +154,7 @@ func (s *socks5) Dial(network, addr string) (net.Conn, error) { buf = append(buf, ip...) } else { if len(host) > 255 { - return nil, errors.New("proxy: destination hostname too long: " + host) + return errors.New("proxy: destination host name too long: " + host) } buf = append(buf, socks5Domain) buf = append(buf, byte(len(host))) @@ -159,11 +163,11 @@ func (s *socks5) Dial(network, addr string) (net.Conn, error) { buf = append(buf, byte(port>>8), byte(port)) if _, err := conn.Write(buf); err != nil { - return nil, errors.New("proxy: failed to write connect request to SOCKS5 proxy at " + s.addr + ": " + err.Error()) + return errors.New("proxy: failed to write connect request to SOCKS5 proxy at " + s.addr + ": " + err.Error()) } if _, err := io.ReadFull(conn, buf[:4]); err != nil { - return nil, errors.New("proxy: failed to read connect reply from SOCKS5 proxy at " + s.addr + ": " + err.Error()) + return errors.New("proxy: failed to read connect reply from SOCKS5 proxy at " + s.addr + ": " + err.Error()) } failure := "unknown error" @@ -172,7 +176,7 @@ func (s *socks5) Dial(network, addr string) (net.Conn, error) { } if len(failure) > 0 { - return nil, errors.New("proxy: SOCKS5 proxy at " + s.addr + " failed to connect: " + failure) + return errors.New("proxy: SOCKS5 proxy at " + s.addr + " failed to connect: " + failure) } bytesToDiscard := 0 @@ -184,11 +188,11 @@ func (s *socks5) Dial(network, addr string) (net.Conn, error) { case socks5Domain: _, err := io.ReadFull(conn, buf[:1]) if err != nil { - return nil, errors.New("proxy: failed to read domain length from SOCKS5 proxy at " + s.addr + ": " + err.Error()) + return errors.New("proxy: failed to read domain length from SOCKS5 proxy at " + s.addr + ": " + err.Error()) } bytesToDiscard = int(buf[0]) default: - return nil, errors.New("proxy: got unknown address type " + strconv.Itoa(int(buf[3])) + " from SOCKS5 proxy at " + s.addr) + return errors.New("proxy: got unknown address type " + strconv.Itoa(int(buf[3])) + " from SOCKS5 proxy at " + s.addr) } if cap(buf) < bytesToDiscard { @@ -197,14 +201,13 @@ func (s *socks5) Dial(network, addr string) (net.Conn, error) { buf = buf[:bytesToDiscard] } if _, err := io.ReadFull(conn, buf); err != nil { - return nil, errors.New("proxy: failed to read address from SOCKS5 proxy at " + s.addr + ": " + err.Error()) + return errors.New("proxy: failed to read address from SOCKS5 proxy at " + s.addr + ": " + err.Error()) } // Also need to discard the port number if _, err := io.ReadFull(conn, buf[:2]); err != nil { - return nil, errors.New("proxy: failed to read port from SOCKS5 proxy at " + s.addr + ": " + err.Error()) + return errors.New("proxy: failed to read port from SOCKS5 proxy at " + s.addr + ": " + err.Error()) } - closeConn = nil - return conn, nil + return nil } diff --git a/vendor/golang.org/x/net/trace/BUILD b/vendor/golang.org/x/net/trace/BUILD index c43efc45080..4af84f24e52 100644 --- a/vendor/golang.org/x/net/trace/BUILD +++ b/vendor/golang.org/x/net/trace/BUILD @@ -6,6 +6,8 @@ go_library( "events.go", "histogram.go", "trace.go", + "trace_go16.go", + "trace_go17.go", ], visibility = ["//visibility:public"], deps = [ diff --git a/vendor/golang.org/x/net/trace/events.go b/vendor/golang.org/x/net/trace/events.go index d8daec1a791..c646a6952e5 100644 --- a/vendor/golang.org/x/net/trace/events.go +++ b/vendor/golang.org/x/net/trace/events.go @@ -39,9 +39,9 @@ var buckets = []bucket{ } // RenderEvents renders the HTML page typically served at /debug/events. -// It does not do any auth checking; see AuthRequest for the default auth check -// used by the handler registered on http.DefaultServeMux. -// req may be nil. +// It does not do any auth checking. The request may be nil. +// +// Most users will use the Events handler. func RenderEvents(w http.ResponseWriter, req *http.Request, sensitive bool) { now := time.Now() data := &struct { diff --git a/vendor/golang.org/x/net/trace/trace.go b/vendor/golang.org/x/net/trace/trace.go index 9eb55e7fd44..7d112ba613a 100644 --- a/vendor/golang.org/x/net/trace/trace.go +++ b/vendor/golang.org/x/net/trace/trace.go @@ -77,7 +77,6 @@ import ( "sync/atomic" "time" - "golang.org/x/net/context" "golang.org/x/net/internal/timeseries" ) @@ -111,30 +110,46 @@ var AuthRequest = func(req *http.Request) (any, sensitive bool) { } func init() { - http.HandleFunc("/debug/requests", func(w http.ResponseWriter, req *http.Request) { - any, sensitive := AuthRequest(req) - if !any { - http.Error(w, "not allowed", http.StatusUnauthorized) - return - } - w.Header().Set("Content-Type", "text/html; charset=utf-8") - Render(w, req, sensitive) - }) - http.HandleFunc("/debug/events", func(w http.ResponseWriter, req *http.Request) { - any, sensitive := AuthRequest(req) - if !any { - http.Error(w, "not allowed", http.StatusUnauthorized) - return - } - w.Header().Set("Content-Type", "text/html; charset=utf-8") - RenderEvents(w, req, sensitive) - }) + // TODO(jbd): Serve Traces from /debug/traces in the future? + // There is no requirement for a request to be present to have traces. + http.HandleFunc("/debug/requests", Traces) + http.HandleFunc("/debug/events", Events) +} + +// Traces responds with traces from the program. +// The package initialization registers it in http.DefaultServeMux +// at /debug/requests. +// +// It performs authorization by running AuthRequest. +func Traces(w http.ResponseWriter, req *http.Request) { + any, sensitive := AuthRequest(req) + if !any { + http.Error(w, "not allowed", http.StatusUnauthorized) + return + } + w.Header().Set("Content-Type", "text/html; charset=utf-8") + Render(w, req, sensitive) +} + +// Events responds with a page of events collected by EventLogs. +// The package initialization registers it in http.DefaultServeMux +// at /debug/events. +// +// It performs authorization by running AuthRequest. +func Events(w http.ResponseWriter, req *http.Request) { + any, sensitive := AuthRequest(req) + if !any { + http.Error(w, "not allowed", http.StatusUnauthorized) + return + } + w.Header().Set("Content-Type", "text/html; charset=utf-8") + RenderEvents(w, req, sensitive) } // Render renders the HTML page typically served at /debug/requests. -// It does not do any auth checking; see AuthRequest for the default auth check -// used by the handler registered on http.DefaultServeMux. -// req may be nil. +// It does not do any auth checking. The request may be nil. +// +// Most users will use the Traces handler. func Render(w io.Writer, req *http.Request, sensitive bool) { data := &struct { Families []string @@ -271,18 +286,6 @@ type contextKeyT string var contextKey = contextKeyT("golang.org/x/net/trace.Trace") -// NewContext returns a copy of the parent context -// and associates it with a Trace. -func NewContext(ctx context.Context, tr Trace) context.Context { - return context.WithValue(ctx, contextKey, tr) -} - -// FromContext returns the Trace bound to the context, if any. -func FromContext(ctx context.Context) (tr Trace, ok bool) { - tr, ok = ctx.Value(contextKey).(Trace) - return -} - // Trace represents an active request. type Trace interface { // LazyLog adds x to the event log. It will be evaluated each time the diff --git a/vendor/golang.org/x/net/trace/trace_go16.go b/vendor/golang.org/x/net/trace/trace_go16.go new file mode 100644 index 00000000000..d6081911853 --- /dev/null +++ b/vendor/golang.org/x/net/trace/trace_go16.go @@ -0,0 +1,21 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !go1.7 + +package trace + +import "golang.org/x/net/context" + +// NewContext returns a copy of the parent context +// and associates it with a Trace. +func NewContext(ctx context.Context, tr Trace) context.Context { + return context.WithValue(ctx, contextKey, tr) +} + +// FromContext returns the Trace bound to the context, if any. +func FromContext(ctx context.Context) (tr Trace, ok bool) { + tr, ok = ctx.Value(contextKey).(Trace) + return +} diff --git a/vendor/golang.org/x/net/trace/trace_go17.go b/vendor/golang.org/x/net/trace/trace_go17.go new file mode 100644 index 00000000000..df6e1fba7ca --- /dev/null +++ b/vendor/golang.org/x/net/trace/trace_go17.go @@ -0,0 +1,21 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build go1.7 + +package trace + +import "context" + +// NewContext returns a copy of the parent context +// and associates it with a Trace. +func NewContext(ctx context.Context, tr Trace) context.Context { + return context.WithValue(ctx, contextKey, tr) +} + +// FromContext returns the Trace bound to the context, if any. +func FromContext(ctx context.Context) (tr Trace, ok bool) { + tr, ok = ctx.Value(contextKey).(Trace) + return +} diff --git a/vendor/golang.org/x/text/cases/BUILD b/vendor/golang.org/x/text/cases/BUILD index 80ec339c609..934a5eb1753 100644 --- a/vendor/golang.org/x/text/cases/BUILD +++ b/vendor/golang.org/x/text/cases/BUILD @@ -11,8 +11,10 @@ go_library( "tables.go", "trieval.go", ], + cgo = True, visibility = ["//visibility:public"], deps = [ + "//vendor/golang.org/x/text/internal:go_default_library", "//vendor/golang.org/x/text/language:go_default_library", "//vendor/golang.org/x/text/transform:go_default_library", "//vendor/golang.org/x/text/unicode/norm:go_default_library", diff --git a/vendor/golang.org/x/text/cases/cases.go b/vendor/golang.org/x/text/cases/cases.go index 13b3a5716d9..cf70630e121 100644 --- a/vendor/golang.org/x/text/cases/cases.go +++ b/vendor/golang.org/x/text/cases/cases.go @@ -35,7 +35,7 @@ import ( // A Caser may be stateful and should therefore not be shared between // goroutines. type Caser struct { - t transform.Transformer + t transform.SpanningTransformer } // Bytes returns a new byte slice with the result of converting b to the case @@ -56,12 +56,17 @@ func (c Caser) String(s string) string { // Transform. func (c Caser) Reset() { c.t.Reset() } -// Transform implements the Transformer interface and transforms the given input -// to the case form implemented by c. +// Transform implements the transform.Transformer interface and transforms the +// given input to the case form implemented by c. func (c Caser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { return c.t.Transform(dst, src, atEOF) } +// Span implements the transform.SpanningTransformer interface. +func (c Caser) Span(src []byte, atEOF bool) (n int, err error) { + return c.t.Span(src, atEOF) +} + // Upper returns a Caser for language-specific uppercasing. func Upper(t language.Tag, opts ...Option) Caser { return Caser{makeUpper(t, getOpts(opts...))} @@ -83,14 +88,20 @@ func Title(t language.Tag, opts ...Option) Caser { // // Case folding does not normalize the input and may not preserve a normal form. // Use the collate or search package for more convenient and linguistically -// sound comparisons. Use unicode/precis for string comparisons where security -// aspects are a concern. +// sound comparisons. Use golang.org/x/text/secure/precis for string comparisons +// where security aspects are a concern. func Fold(opts ...Option) Caser { return Caser{makeFold(getOpts(opts...))} } // An Option is used to modify the behavior of a Caser. -type Option func(o *options) +type Option func(o options) options + +// TODO: consider these options to take a boolean as well, like FinalSigma. +// The advantage of using this approach is that other providers of a lower-case +// algorithm could set different defaults by prefixing a user-provided slice +// of options with their own. This is handy, for instance, for the precis +// package which would override the default to not handle the Greek final sigma. var ( // NoLower disables the lowercasing of non-leading letters for a title @@ -110,20 +121,42 @@ type options struct { // TODO: segmenter, max ignorable, alternative versions, etc. - noFinalSigma bool // Only used for testing. + ignoreFinalSigma bool } func getOpts(o ...Option) (res options) { for _, f := range o { - f(&res) + res = f(res) } return } -func noLower(o *options) { +func noLower(o options) options { o.noLower = true + return o } -func compact(o *options) { +func compact(o options) options { o.simple = true + return o +} + +// HandleFinalSigma specifies whether the special handling of Greek final sigma +// should be enabled. Unicode prescribes handling the Greek final sigma for all +// locales, but standards like IDNA and PRECIS override this default. +func HandleFinalSigma(enable bool) Option { + if enable { + return handleFinalSigma + } + return ignoreFinalSigma +} + +func ignoreFinalSigma(o options) options { + o.ignoreFinalSigma = true + return o +} + +func handleFinalSigma(o options) options { + o.ignoreFinalSigma = false + return o } diff --git a/vendor/golang.org/x/text/cases/context.go b/vendor/golang.org/x/text/cases/context.go index 0d2e497ebc3..e9aa9e1936f 100644 --- a/vendor/golang.org/x/text/cases/context.go +++ b/vendor/golang.org/x/text/cases/context.go @@ -4,9 +4,7 @@ package cases -import ( - "golang.org/x/text/transform" -) +import "golang.org/x/text/transform" // A context is used for iterating over source bytes, fetching case info and // writing to a destination buffer. @@ -56,6 +54,14 @@ func (c *context) ret() (nDst, nSrc int, err error) { return c.nDst, c.nSrc, transform.ErrShortSrc } +// retSpan returns the return values for the Span method. It checks whether +// there were insufficient bytes in src to complete and introduces an error +// accordingly, if necessary. +func (c *context) retSpan() (n int, err error) { + _, nSrc, err := c.ret() + return nSrc, err +} + // checkpoint sets the return value buffer points for Transform to the current // positions. func (c *context) checkpoint() { @@ -200,6 +206,23 @@ func lower(c *context) bool { return c.copy() } +func isLower(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cLower { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + // upper writes the uppercase version of the current rune to dst. func upper(c *context) bool { ct := c.caseType() @@ -226,6 +249,29 @@ func upper(c *context) bool { return c.copy() } +// isUpper writes the isUppercase version of the current rune to dst. +func isUpper(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cUpper { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + // Get length of first special case mapping. + n := (e[1] >> lengthBits) & lengthMask + if ct == cTitle { + n = e[1] & lengthMask + } + if n != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + // title writes the title case version of the current rune to dst. func title(c *context) bool { ct := c.caseType() @@ -257,6 +303,33 @@ func title(c *context) bool { return c.copy() } +// isTitle reports whether the current rune is in title case. +func isTitle(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cTitle { + return true + } + if c.info&exceptionBit == 0 { + if ct == cLower { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + // Get the exception data. + e := exceptions[c.info>>exceptionShift:] + if nTitle := e[1] & lengthMask; nTitle != noChange { + c.err = transform.ErrEndOfSpan + return false + } + nFirst := (e[1] >> lengthBits) & lengthMask + if ct == cLower && nFirst != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + // foldFull writes the foldFull version of the current rune to dst. func foldFull(c *context) bool { if c.info&hasMappingMask == 0 { @@ -279,3 +352,25 @@ func foldFull(c *context) bool { } return c.writeString(e[2 : 2+n]) } + +// isFoldFull reports whether the current run is mapped to foldFull +func isFoldFull(c *context) bool { + if c.info&hasMappingMask == 0 { + return true + } + ct := c.caseType() + if c.info&exceptionBit == 0 { + if ct != cLower || c.info&inverseFoldBit != 0 { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + e := exceptions[c.info>>exceptionShift:] + n := e[0] & lengthMask + if n == 0 && ct == cLower { + return true + } + c.err = transform.ErrEndOfSpan + return false +} diff --git a/vendor/golang.org/x/text/cases/fold.go b/vendor/golang.org/x/text/cases/fold.go index e95bfa8ea26..85cc434fac0 100644 --- a/vendor/golang.org/x/text/cases/fold.go +++ b/vendor/golang.org/x/text/cases/fold.go @@ -18,7 +18,15 @@ func (t *caseFolder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err return c.ret() } -func makeFold(o options) transform.Transformer { +func (t *caseFolder) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isFoldFull(&c) { + c.checkpoint() + } + return c.retSpan() +} + +func makeFold(o options) transform.SpanningTransformer { // TODO: Special case folding, through option Language, Special/Turkic, or // both. // TODO: Implement Compact options. diff --git a/vendor/golang.org/x/text/cases/gen.go b/vendor/golang.org/x/text/cases/gen.go index f46170fca1e..24b72300396 100644 --- a/vendor/golang.org/x/text/cases/gen.go +++ b/vendor/golang.org/x/text/cases/gen.go @@ -76,7 +76,7 @@ type breakCategory int const ( breakBreak breakCategory = iota breakLetter - breakIgnored + breakMid ) // mapping returns the case mapping for the given case type. @@ -162,9 +162,14 @@ func parseUCD() []runeInfo { // We collapse the word breaking properties onto the categories we need. switch p.String(1) { // TODO: officially we need to canonicalize. - case "Format", "MidLetter", "MidNumLet", "Single_Quote": - ri.BreakCat = breakIgnored - case "ALetter", "Hebrew_Letter", "Numeric", "Extend", "ExtendNumLet": + case "MidLetter", "MidNumLet", "Single_Quote": + ri.BreakCat = breakMid + if !ri.CaseIgnorable { + // finalSigma relies on the fact that all breakMid runes are + // also a Case_Ignorable. Revisit this code when this changes. + log.Fatalf("Rune %U, which has a break category mid, is not a case ignorable", ri) + } + case "ALetter", "Hebrew_Letter", "Numeric", "Extend", "ExtendNumLet", "Format", "ZWJ": ri.BreakCat = breakLetter } }) @@ -240,8 +245,11 @@ func makeEntry(ri *runeInfo) { case above: // Above ccc = cccAbove } - if ri.BreakCat == breakBreak { + switch ri.BreakCat { + case breakBreak: ccc = cccBreak + case breakMid: + ri.entry |= isMidBit } ri.entry |= ccc @@ -588,7 +596,7 @@ func verifyProperties(chars []runeInfo) { // decomposition is greater than U+00FF, the rune is always // great and not a modifier. if f := runes[0]; unicode.IsMark(f) || f > 0xFF && !unicode.Is(unicode.Greek, f) { - log.Fatalf("%U: expeced first rune of Greek decomposition to be letter, found %U", r, f) + log.Fatalf("%U: expected first rune of Greek decomposition to be letter, found %U", r, f) } // A.6.2: Any follow-up rune in a Greek decomposition is a // modifier of which the first should be gobbled in @@ -597,7 +605,7 @@ func verifyProperties(chars []runeInfo) { switch m { case 0x0313, 0x0314, 0x0301, 0x0300, 0x0306, 0x0342, 0x0308, 0x0304, 0x345: default: - log.Fatalf("%U: modifier %U is outside of expeced Greek modifier set", r, m) + log.Fatalf("%U: modifier %U is outside of expected Greek modifier set", r, m) } } } @@ -690,7 +698,7 @@ func genTablesTest() { parse("auxiliary/WordBreakProperty.txt", func(p *ucd.Parser) { switch p.String(1) { case "Extend", "Format", "MidLetter", "MidNumLet", "Single_Quote", - "ALetter", "Hebrew_Letter", "Numeric", "ExtendNumLet": + "ALetter", "Hebrew_Letter", "Numeric", "ExtendNumLet", "ZWJ": notBreak[p.Rune(0)] = true } }) diff --git a/vendor/golang.org/x/text/cases/gen_trieval.go b/vendor/golang.org/x/text/cases/gen_trieval.go index cf1a99d5e5e..376d22c8f9d 100644 --- a/vendor/golang.org/x/text/cases/gen_trieval.go +++ b/vendor/golang.org/x/text/cases/gen_trieval.go @@ -26,6 +26,7 @@ package main // Only 13..8 are used for XOR patterns. // 7 inverseFold (fold to upper, not to lower) // 6 index: interpret the XOR pattern as an index +// or isMid if case mode is cIgnorableUncased. // 5..4 CCC: zero (normal or break), above or other // } // 3 exception: interpret this value as an exception index @@ -48,6 +49,7 @@ const ( ignorableValue = 0x0004 inverseFoldBit = 1 << 7 + isMidBit = 1 << 6 exceptionBit = 1 << 3 exceptionShift = 5 @@ -57,7 +59,7 @@ const ( xorShift = 8 // There is no mapping if all xor bits and the exception bit are zero. - hasMappingMask = 0xffc0 | exceptionBit + hasMappingMask = 0xff80 | exceptionBit ) // The case mode bits encodes the case type of a rune. This includes uncased, @@ -95,10 +97,6 @@ func (c info) isCaseIgnorable() bool { return c&ignorableMask == ignorableValue } -func (c info) isCaseIgnorableAndNonBreakStarter() bool { - return c&(fullCasedMask|cccMask) == (ignorableValue | cccZero) -} - func (c info) isNotCasedAndNotCaseIgnorable() bool { return c&fullCasedMask == 0 } @@ -107,6 +105,10 @@ func (c info) isCaseIgnorableAndNotCased() bool { return c&fullCasedMask == cIgnorableUncased } +func (c info) isMid() bool { + return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased +} + // The case mapping implementation will need to know about various Canonical // Combining Class (CCC) values. We encode two of these in the trie value: // cccZero (0) and cccAbove (230). If the value is cccOther, it means that diff --git a/vendor/golang.org/x/text/cases/icu.go b/vendor/golang.org/x/text/cases/icu.go new file mode 100644 index 00000000000..46530d1e408 --- /dev/null +++ b/vendor/golang.org/x/text/cases/icu.go @@ -0,0 +1,61 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build icu + +package cases + +// Ideally these functions would be defined in a test file, but go test doesn't +// allow CGO in tests. The build tag should ensure either way that these +// functions will not end up in the package. + +// TODO: Ensure that the correct ICU version is set. + +/* +#cgo LDFLAGS: -licui18n.57 -licuuc.57 +#include +#include +#include +#include +#include +*/ +import "C" + +import "unsafe" + +func doICU(tag, caser, input string) string { + err := C.UErrorCode(0) + loc := C.CString(tag) + cm := C.ucasemap_open(loc, C.uint32_t(0), &err) + + buf := make([]byte, len(input)*4) + dst := (*C.char)(unsafe.Pointer(&buf[0])) + src := C.CString(input) + + cn := C.int32_t(0) + + switch caser { + case "fold": + cn = C.ucasemap_utf8FoldCase(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "lower": + cn = C.ucasemap_utf8ToLower(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "upper": + cn = C.ucasemap_utf8ToUpper(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "title": + cn = C.ucasemap_utf8ToTitle(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + } + return string(buf[:cn]) +} diff --git a/vendor/golang.org/x/text/cases/info.go b/vendor/golang.org/x/text/cases/info.go index 669d7ae1fae..3b51f03d681 100644 --- a/vendor/golang.org/x/text/cases/info.go +++ b/vendor/golang.org/x/text/cases/info.go @@ -28,9 +28,6 @@ func (c info) cccType() info { // only makes sense, though, if the performance and/or space penalty of using // the generic breaker is big. Extra data will only be needed for non-cased // runes, which means there are sufficient bits left in the caseType. -// Also note that the standard breaking algorithm doesn't always make sense -// for title casing. For example, a4a -> A4a, but a"4a -> A"4A (where " stands -// for modifier \u0308). // ICU prohibits breaking in such cases as well. // For the purpose of title casing we use an approximation of the Unicode Word @@ -41,17 +38,19 @@ func (c info) cccType() info { // categories, with associated rules: // // 1) Letter: -// ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend. +// ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend, Format_FE, ZWJ. // Rule: Never break between consecutive runes of this category. // // 2) Mid: -// Format, MidLetter, MidNumLet, Single_Quote. -// (Cf. case-ignorable: MidLetter, MidNumLet or cat is Mn, Me, Cf, Lm or Sk). +// MidLetter, MidNumLet, Single_Quote. +// (Cf. case-ignorable: MidLetter, MidNumLet, Single_Quote or cat is Mn, +// Me, Cf, Lm or Sk). // Rule: Don't break between Letter and Mid, but break between two Mids. // // 3) Break: -// Any other category, including NewLine, CR, LF and Double_Quote. These -// categories should always result in a break between two cased letters. +// Any other category: NewLine, MidNum, CR, LF, Double_Quote, Katakana, and +// Other. +// These categories should always result in a break between two cased letters. // Rule: Always break. // // Note 1: the Katakana and MidNum categories can, in esoteric cases, result in diff --git a/vendor/golang.org/x/text/cases/map.go b/vendor/golang.org/x/text/cases/map.go index f2a8e96d09e..4baebaaa6ef 100644 --- a/vendor/golang.org/x/text/cases/map.go +++ b/vendor/golang.org/x/text/cases/map.go @@ -13,6 +13,7 @@ import ( "unicode" "unicode/utf8" + "golang.org/x/text/internal" "golang.org/x/text/language" "golang.org/x/text/transform" "golang.org/x/text/unicode/norm" @@ -24,6 +25,11 @@ import ( // dst so far won't need changing as we see more source bytes. type mapFunc func(*context) bool +// A spanFunc takes a context set to the current rune and returns whether this +// rune would be altered when written to the output. It may advance the context +// to the next rune. It returns whether a checkpoint is possible. +type spanFunc func(*context) bool + // maxIgnorable defines the maximum number of ignorables to consider for // lookahead operations. const maxIgnorable = 30 @@ -36,12 +42,12 @@ func init() { for _, s := range strings.Split(supported, " ") { tags = append(tags, language.MustParse(s)) } - matcher = language.NewMatcher(tags) + matcher = internal.NewInheritanceMatcher(tags) Supported = language.NewCoverage(tags) } var ( - matcher language.Matcher + matcher *internal.InheritanceMatcher Supported language.Coverage @@ -50,56 +56,69 @@ var ( // Some uppercase mappers are stateless, so we can precompute the // Transformers and save a bit on runtime allocations. - upperFunc = []mapFunc{ - nil, // und - nil, // af - aztrUpper(upper), // az - elUpper, // el - ltUpper(upper), // lt - nil, // nl - aztrUpper(upper), // tr + upperFunc = []struct { + upper mapFunc + span spanFunc + }{ + {nil, nil}, // und + {nil, nil}, // af + {aztrUpper(upper), isUpper}, // az + {elUpper, noSpan}, // el + {ltUpper(upper), noSpan}, // lt + {nil, nil}, // nl + {aztrUpper(upper), isUpper}, // tr } - undUpper transform.Transformer = &undUpperCaser{} + undUpper transform.SpanningTransformer = &undUpperCaser{} + undLower transform.SpanningTransformer = &undLowerCaser{} + undLowerIgnoreSigma transform.SpanningTransformer = &undLowerIgnoreSigmaCaser{} lowerFunc = []mapFunc{ - lower, // und - lower, // af + nil, // und + nil, // af aztrLower, // az - lower, // el + nil, // el ltLower, // lt - lower, // nl + nil, // nl aztrLower, // tr } titleInfos = []struct { - title, lower mapFunc - rewrite func(*context) + title mapFunc + lower mapFunc + titleSpan spanFunc + rewrite func(*context) }{ - {title, lower, nil}, // und - {title, lower, afnlRewrite}, // af - {aztrUpper(title), aztrLower, nil}, // az - {title, lower, nil}, // el - {ltUpper(title), ltLower, nil}, // lt - {nlTitle, lower, afnlRewrite}, // nl - {aztrUpper(title), aztrLower, nil}, // tr + {title, lower, isTitle, nil}, // und + {title, lower, isTitle, afnlRewrite}, // af + {aztrUpper(title), aztrLower, isTitle, nil}, // az + {title, lower, isTitle, nil}, // el + {ltUpper(title), ltLower, noSpan, nil}, // lt + {nlTitle, lower, nlTitleSpan, afnlRewrite}, // nl + {aztrUpper(title), aztrLower, isTitle, nil}, // tr } ) -func makeUpper(t language.Tag, o options) transform.Transformer { +func makeUpper(t language.Tag, o options) transform.SpanningTransformer { _, i, _ := matcher.Match(t) - f := upperFunc[i] + f := upperFunc[i].upper if f == nil { return undUpper } - return &simpleCaser{f: f} + return &simpleCaser{f: f, span: upperFunc[i].span} } -func makeLower(t language.Tag, o options) transform.Transformer { +func makeLower(t language.Tag, o options) transform.SpanningTransformer { _, i, _ := matcher.Match(t) f := lowerFunc[i] - if o.noFinalSigma { - return &simpleCaser{f: f} + if f == nil { + if o.ignoreFinalSigma { + return undLowerIgnoreSigma + } + return undLower + } + if o.ignoreFinalSigma { + return &simpleCaser{f: f, span: isLower} } return &lowerCaser{ first: f, @@ -107,22 +126,28 @@ func makeLower(t language.Tag, o options) transform.Transformer { } } -func makeTitle(t language.Tag, o options) transform.Transformer { +func makeTitle(t language.Tag, o options) transform.SpanningTransformer { _, i, _ := matcher.Match(t) x := &titleInfos[i] lower := x.lower if o.noLower { lower = (*context).copy - } else if !o.noFinalSigma { + } else if !o.ignoreFinalSigma { lower = finalSigma(lower) } return &titleCaser{ - title: x.title, - lower: lower, - rewrite: x.rewrite, + title: x.title, + lower: lower, + titleSpan: x.titleSpan, + rewrite: x.rewrite, } } +func noSpan(c *context) bool { + c.err = transform.ErrEndOfSpan + return false +} + // TODO: consider a similar special case for the fast majority lower case. This // is a bit more involved so will require some more precise benchmarking to // justify it. @@ -132,7 +157,7 @@ type undUpperCaser struct{ transform.NopResetter } // undUpperCaser implements the Transformer interface for doing an upper case // mapping for the root locale (und). It eliminates the need for an allocation // as it prevents escaping by not using function pointers. -func (t *undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { +func (t undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { c := context{dst: dst, src: src, atEOF: atEOF} for c.next() { upper(&c) @@ -141,26 +166,117 @@ func (t *undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, return c.ret() } +func (t undUpperCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isUpper(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerIgnoreSigmaCaser implements the Transformer interface for doing +// a lower case mapping for the root locale (und) ignoring final sigma +// handling. This casing algorithm is used in some performance-critical packages +// like secure/precis and x/net/http/idna, which warrants its special-casing. +type undLowerIgnoreSigmaCaser struct{ transform.NopResetter } + +func (t undLowerIgnoreSigmaCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && lower(&c) { + c.checkpoint() + } + return c.ret() + +} + +// Span implements a generic lower-casing. This is possible as isLower works +// for all lowercasing variants. All lowercase variants only vary in how they +// transform a non-lowercase letter. They will never change an already lowercase +// letter. In addition, there is no state. +func (t undLowerIgnoreSigmaCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + type simpleCaser struct { context - f mapFunc + f mapFunc + span spanFunc } // simpleCaser implements the Transformer interface for doing a case operation // on a rune-by-rune basis. func (t *simpleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - t.context = context{dst: dst, src: src, atEOF: atEOF} - c := &t.context - for c.next() && t.f(c) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && t.f(&c) { c.checkpoint() } return c.ret() } +func (t *simpleCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && t.span(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerCaser implements the Transformer interface for doing a lower case +// mapping for the root locale (und) ignoring final sigma handling. This casing +// algorithm is used in some performance-critical packages like secure/precis +// and x/net/http/idna, which warrants its special-casing. +type undLowerCaser struct{ transform.NopResetter } + +func (t undLowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + + for isInterWord := true; c.next(); { + if isInterWord { + if c.info.isCased() { + if !lower(&c) { + break + } + isInterWord = false + } else if !c.copy() { + break + } + } else { + if c.info.isNotCasedAndNotCaseIgnorable() { + if !c.copy() { + break + } + isInterWord = true + } else if !c.hasPrefix("Σ") { + if !lower(&c) { + break + } + } else if !finalSigmaBody(&c) { + break + } + } + c.checkpoint() + } + return c.ret() +} + +func (t undLowerCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + // lowerCaser implements the Transformer interface. The default Unicode lower // casing requires different treatment for the first and subsequent characters // of a word, most notably to handle the Greek final Sigma. type lowerCaser struct { + undLowerIgnoreSigmaCaser + context first, midWord mapFunc @@ -202,7 +318,9 @@ type titleCaser struct { context // rune mappings used by the actual casing algorithms. - title, lower mapFunc + title mapFunc + lower mapFunc + titleSpan spanFunc rewrite func(*context) } @@ -228,10 +346,10 @@ func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err t.rewrite(c) } - wasMid := p.isCaseIgnorableAndNonBreakStarter() + wasMid := p.isMid() // Break out of this loop on failure to ensure we do not modify the // state incorrectly. - if p.isCased() && !p.isCaseIgnorableAndNotCased() { + if p.isCased() { if !c.isMidWord { if !t.title(c) { break @@ -242,71 +360,139 @@ func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err } } else if !c.copy() { break - } - - // TODO: make this an "else if" if we can prove that no rune that does - // not match the first condition of the if statement can be a break. - if p.isBreak() { + } else if p.isBreak() { c.isMidWord = false } // As we save the state of the transformer, it is safe to call // checkpoint after any successful write. - c.checkpoint() + if !(c.isMidWord && wasMid) { + c.checkpoint() + } if !c.next() { break } - if wasMid && c.info.isCaseIgnorableAndNonBreakStarter() { + if wasMid && c.info.isMid() { c.isMidWord = false } } return c.ret() } +func (t *titleCaser) Span(src []byte, atEOF bool) (n int, err error) { + t.context = context{src: src, atEOF: atEOF, isMidWord: t.isMidWord} + c := &t.context + + if !c.next() { + return c.retSpan() + } + + for { + p := c.info + if t.rewrite != nil { + t.rewrite(c) + } + + wasMid := p.isMid() + // Break out of this loop on failure to ensure we do not modify the + // state incorrectly. + if p.isCased() { + if !c.isMidWord { + if !t.titleSpan(c) { + break + } + c.isMidWord = true + } else if !isLower(c) { + break + } + } else if p.isBreak() { + c.isMidWord = false + } + // As we save the state of the transformer, it is safe to call + // checkpoint after any successful write. + if !(c.isMidWord && wasMid) { + c.checkpoint() + } + + if !c.next() { + break + } + if wasMid && c.info.isMid() { + c.isMidWord = false + } + } + return c.retSpan() +} + // finalSigma adds Greek final Sigma handing to another casing function. It // determines whether a lowercased sigma should be σ or ς, by looking ahead for // case-ignorables and a cased letters. func finalSigma(f mapFunc) mapFunc { return func(c *context) bool { - // ::NFD(); - // # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA - // Σ } [:case-ignorable:]* [:cased:] → σ; - // [:cased:] [:case-ignorable:]* { Σ → ς; - // ::Any-Lower; - // ::NFC(); - if !c.hasPrefix("Σ") { return f(c) } - - p := c.pDst - c.writeString("ς") - // We need to do one more iteration after maxIgnorable, as a cased - // letter is not an ignorable and may modify the result. - for i := 0; i < maxIgnorable+1; i++ { - if !c.next() { - return false - } - if !c.info.isCaseIgnorable() { - if c.info.isCased() { - // p+1 is guaranteed to be in bounds: if writing ς was - // successful, p+1 will contain the second byte of ς. If not, - // this function will have returned after c.next returned false. - c.dst[p+1]++ // ς → σ - } - c.unreadRune() - return true - } - // A case ignorable may also introduce a word break, so we may need - // to continue searching even after detecting a break. - c.isMidWord = c.isMidWord && !c.info.isBreak() - c.copy() - } - return true + return finalSigmaBody(c) } } +func finalSigmaBody(c *context) bool { + // Current rune must be ∑. + + // ::NFD(); + // # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA + // Σ } [:case-ignorable:]* [:cased:] → σ; + // [:cased:] [:case-ignorable:]* { Σ → ς; + // ::Any-Lower; + // ::NFC(); + + p := c.pDst + c.writeString("ς") + + // TODO: we should do this here, but right now this will never have an + // effect as this is called when the prefix is Sigma, whereas Dutch and + // Afrikaans only test for an apostrophe. + // + // if t.rewrite != nil { + // t.rewrite(c) + // } + + // We need to do one more iteration after maxIgnorable, as a cased + // letter is not an ignorable and may modify the result. + wasMid := false + for i := 0; i < maxIgnorable+1; i++ { + if !c.next() { + return false + } + if !c.info.isCaseIgnorable() { + // All Midword runes are also case ignorable, so we are + // guaranteed to have a letter or word break here. As we are + // unreading the run, there is no need to unset c.isMidWord; + // the title caser will handle this. + if c.info.isCased() { + // p+1 is guaranteed to be in bounds: if writing ς was + // successful, p+1 will contain the second byte of ς. If not, + // this function will have returned after c.next returned false. + c.dst[p+1]++ // ς → σ + } + c.unreadRune() + return true + } + // A case ignorable may also introduce a word break, so we may need + // to continue searching even after detecting a break. + isMid := c.info.isMid() + if (wasMid && isMid) || c.info.isBreak() { + c.isMidWord = false + } + wasMid = isMid + c.copy() + } + return true +} + +// finalSigmaSpan would be the same as isLower. + // elUpper implements Greek upper casing, which entails removing a predefined // set of non-blocked modifiers. Note that these accents should not be removed // for title casing! @@ -376,6 +562,8 @@ func elUpper(c *context) bool { return i == maxIgnorable } +// TODO: implement elUpperSpan (low-priority: complex and infrequent). + func ltLower(c *context) bool { // From CLDR: // # Introduce an explicit dot above when lowercasing capital I's and J's @@ -390,10 +578,10 @@ func ltLower(c *context) bool { // ::NFD(); // I } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0307; // J } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → j \u0307; - // Į } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → į \u0307; - // Ì → i \u0307 \u0300; - // Í → i \u0307 \u0301; - // Ĩ → i \u0307 \u0303; + // I \u0328 (Į) } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0328 \u0307; + // I \u0300 (Ì) → i \u0307 \u0300; + // I \u0301 (Í) → i \u0307 \u0301; + // I \u0303 (Ĩ) → i \u0307 \u0303; // ::Any-Lower(); // ::NFC(); @@ -445,9 +633,16 @@ func ltLower(c *context) bool { return i == maxIgnorable } +// ltLowerSpan would be the same as isLower. + func ltUpper(f mapFunc) mapFunc { return func(c *context) bool { + // Unicode: + // 0307; 0307; ; ; lt After_Soft_Dotted; # COMBINING DOT ABOVE + // // From CLDR: + // # Remove \u0307 following soft-dotteds (i, j, and the like), with possible + // # intervening non-230 marks. // ::NFD(); // [:Soft_Dotted:] [^[:ccc=Not_Reordered:][:ccc=Above:]]* { \u0307 → ; // ::Any-Upper(); @@ -511,6 +706,8 @@ func ltUpper(f mapFunc) mapFunc { } } +// TODO: implement ltUpperSpan (low priority: complex and infrequent). + func aztrUpper(f mapFunc) mapFunc { return func(c *context) bool { // i→İ; @@ -571,6 +768,8 @@ Loop: return c.writeString("ı") && c.writeBytes(c.src[start:c.pSrc+c.sz]) && done } +// aztrLowerSpan would be the same as isLower. + func nlTitle(c *context) bool { // From CLDR: // # Special titlecasing for Dutch initial "ij". @@ -591,6 +790,24 @@ func nlTitle(c *context) bool { return true } +func nlTitleSpan(c *context) bool { + // From CLDR: + // # Special titlecasing for Dutch initial "ij". + // ::Any-Title(); + // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; + if c.src[c.pSrc] != 'I' { + return isTitle(c) + } + if !c.next() || c.src[c.pSrc] == 'j' { + return false + } + if c.src[c.pSrc] != 'J' { + c.unreadRune() + } + return true +} + // Not part of CLDR, but see http://unicode.org/cldr/trac/ticket/7078. func afnlRewrite(c *context) { if c.hasPrefix("'") || c.hasPrefix("’") { diff --git a/vendor/golang.org/x/text/cases/tables.go b/vendor/golang.org/x/text/cases/tables.go index 4257e57aef2..e6e95a68542 100644 --- a/vendor/golang.org/x/text/cases/tables.go +++ b/vendor/golang.org/x/text/cases/tables.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package cases @@ -216,7 +216,7 @@ func (t *caseTrie) lookupStringUnsafe(s string) uint16 { return 0 } -// caseTrie. Total size: 11750 bytes (11.47 KiB). Checksum: 9ec26581a3006e0d. +// caseTrie. Total size: 11742 bytes (11.47 KiB). Checksum: 147a11466b427436. type caseTrie struct{} func newCaseTrie(i int) *caseTrie { @@ -238,10 +238,10 @@ func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { // The third block is the zero block. var caseValues = [1280]uint16{ // Block 0x0, offset 0x0 - 0x27: 0x0014, - 0x2e: 0x0014, + 0x27: 0x0054, + 0x2e: 0x0054, 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, - 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0014, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, // Block 0x1, offset 0x40 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, @@ -316,7 +316,7 @@ var caseValues = [1280]uint16{ 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, // Block 0x8, offset 0x200 0x204: 0x0004, 0x205: 0x0004, - 0x206: 0x2a13, 0x207: 0x0014, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x1e2a, 0x211: 0x2013, 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, @@ -571,10 +571,10 @@ var caseIndex = [1600]uint16{ } // sparseOffsets: 272 entries, 544 bytes -var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x3a, 0x3d, 0x41, 0x44, 0x48, 0x52, 0x54, 0x59, 0x69, 0x70, 0x75, 0x83, 0x84, 0x92, 0xa1, 0xab, 0xae, 0xb4, 0xbc, 0xbe, 0xc0, 0xce, 0xd4, 0xe2, 0xed, 0xf8, 0x103, 0x10f, 0x119, 0x124, 0x12f, 0x13b, 0x147, 0x14f, 0x157, 0x161, 0x16c, 0x178, 0x17e, 0x189, 0x18e, 0x196, 0x199, 0x19e, 0x1a2, 0x1a6, 0x1ad, 0x1b6, 0x1be, 0x1bf, 0x1c8, 0x1cf, 0x1d7, 0x1dd, 0x1e3, 0x1e8, 0x1ec, 0x1ef, 0x1f1, 0x1f4, 0x1f9, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x207, 0x20c, 0x210, 0x219, 0x21c, 0x21f, 0x225, 0x226, 0x231, 0x232, 0x233, 0x238, 0x245, 0x24d, 0x255, 0x25e, 0x267, 0x270, 0x275, 0x278, 0x281, 0x28e, 0x290, 0x297, 0x299, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c2, 0x2c8, 0x2c9, 0x2d7, 0x2dc, 0x2df, 0x2e4, 0x2e8, 0x2ee, 0x2f3, 0x2f6, 0x2fb, 0x300, 0x301, 0x307, 0x309, 0x30a, 0x30c, 0x30e, 0x311, 0x312, 0x314, 0x317, 0x31d, 0x321, 0x323, 0x329, 0x330, 0x334, 0x33d, 0x33e, 0x346, 0x34a, 0x34f, 0x357, 0x35d, 0x363, 0x36d, 0x372, 0x37b, 0x381, 0x388, 0x38c, 0x394, 0x396, 0x398, 0x39b, 0x39d, 0x39f, 0x3a0, 0x3a1, 0x3a3, 0x3a5, 0x3ab, 0x3b0, 0x3b2, 0x3b8, 0x3bb, 0x3bd, 0x3c3, 0x3c8, 0x3ca, 0x3cb, 0x3cc, 0x3cd, 0x3cf, 0x3d1, 0x3d3, 0x3d6, 0x3d8, 0x3db, 0x3e3, 0x3e6, 0x3ea, 0x3f2, 0x3f4, 0x3f5, 0x3f6, 0x3f8, 0x3fe, 0x400, 0x401, 0x403, 0x405, 0x407, 0x414, 0x415, 0x416, 0x41a, 0x41c, 0x41d, 0x41e, 0x41f, 0x420, 0x424, 0x428, 0x42e, 0x430, 0x437, 0x43a, 0x43e, 0x444, 0x44d, 0x453, 0x459, 0x463, 0x46d, 0x46f, 0x476, 0x47c, 0x482, 0x488, 0x48b, 0x491, 0x494, 0x49c, 0x49d, 0x4a4, 0x4a5, 0x4a8, 0x4a9, 0x4af, 0x4b2, 0x4ba, 0x4bb, 0x4bc, 0x4bd, 0x4be, 0x4c0, 0x4c2, 0x4c4, 0x4c8, 0x4c9, 0x4cb, 0x4cc, 0x4cd, 0x4cf, 0x4d4, 0x4d9, 0x4dd, 0x4de, 0x4e1, 0x4e5, 0x4f0, 0x4f4, 0x4fc, 0x501, 0x505, 0x508, 0x50c, 0x50f, 0x512, 0x517, 0x51b, 0x51f, 0x523, 0x527, 0x529, 0x52b, 0x52e, 0x533, 0x535, 0x53a, 0x543, 0x548, 0x549, 0x54c, 0x54d, 0x54e, 0x550, 0x551, 0x552} +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x3a, 0x3d, 0x41, 0x44, 0x48, 0x52, 0x54, 0x59, 0x69, 0x70, 0x75, 0x83, 0x84, 0x92, 0xa1, 0xab, 0xae, 0xb4, 0xbc, 0xbe, 0xc0, 0xce, 0xd4, 0xe2, 0xed, 0xf8, 0x103, 0x10f, 0x119, 0x124, 0x12f, 0x13b, 0x147, 0x14f, 0x157, 0x161, 0x16c, 0x178, 0x17e, 0x189, 0x18e, 0x196, 0x199, 0x19e, 0x1a2, 0x1a6, 0x1ad, 0x1b6, 0x1be, 0x1bf, 0x1c8, 0x1cf, 0x1d7, 0x1dd, 0x1e3, 0x1e8, 0x1ec, 0x1ef, 0x1f1, 0x1f4, 0x1f9, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x207, 0x20c, 0x210, 0x219, 0x21c, 0x21f, 0x225, 0x226, 0x231, 0x232, 0x233, 0x238, 0x245, 0x24d, 0x255, 0x25e, 0x267, 0x270, 0x275, 0x278, 0x281, 0x28e, 0x290, 0x297, 0x299, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x327, 0x32e, 0x332, 0x33b, 0x33c, 0x344, 0x348, 0x34d, 0x355, 0x35b, 0x361, 0x36b, 0x370, 0x379, 0x37f, 0x386, 0x38a, 0x392, 0x394, 0x396, 0x399, 0x39b, 0x39d, 0x39e, 0x39f, 0x3a1, 0x3a3, 0x3a9, 0x3ae, 0x3b0, 0x3b6, 0x3b9, 0x3bb, 0x3c1, 0x3c6, 0x3c8, 0x3c9, 0x3ca, 0x3cb, 0x3cd, 0x3cf, 0x3d1, 0x3d4, 0x3d6, 0x3d9, 0x3e1, 0x3e4, 0x3e8, 0x3f0, 0x3f2, 0x3f3, 0x3f4, 0x3f6, 0x3fc, 0x3fe, 0x3ff, 0x401, 0x403, 0x405, 0x412, 0x413, 0x414, 0x418, 0x41a, 0x41b, 0x41c, 0x41d, 0x41e, 0x422, 0x426, 0x42c, 0x42e, 0x435, 0x438, 0x43c, 0x442, 0x44b, 0x451, 0x457, 0x461, 0x46b, 0x46d, 0x474, 0x47a, 0x480, 0x486, 0x489, 0x48f, 0x492, 0x49a, 0x49b, 0x4a2, 0x4a3, 0x4a6, 0x4a7, 0x4ad, 0x4b0, 0x4b8, 0x4b9, 0x4ba, 0x4bb, 0x4bc, 0x4be, 0x4c0, 0x4c2, 0x4c6, 0x4c7, 0x4c9, 0x4ca, 0x4cb, 0x4cd, 0x4d2, 0x4d7, 0x4db, 0x4dc, 0x4df, 0x4e3, 0x4ee, 0x4f2, 0x4fa, 0x4ff, 0x503, 0x506, 0x50a, 0x50d, 0x510, 0x515, 0x519, 0x51d, 0x521, 0x525, 0x527, 0x529, 0x52c, 0x531, 0x533, 0x538, 0x541, 0x546, 0x547, 0x54a, 0x54b, 0x54c, 0x54e, 0x54f, 0x550} -// sparseValues: 1362 entries, 5448 bytes -var sparseValues = [1362]valueRange{ +// sparseValues: 1360 entries, 5440 bytes +var sparseValues = [1360]valueRange{ // Block 0x0, offset 0x0 {value: 0x0004, lo: 0xa8, hi: 0xa8}, {value: 0x0012, lo: 0xaa, hi: 0xaa}, @@ -582,7 +582,7 @@ var sparseValues = [1362]valueRange{ {value: 0x0004, lo: 0xaf, hi: 0xaf}, {value: 0x0004, lo: 0xb4, hi: 0xb4}, {value: 0x002a, lo: 0xb5, hi: 0xb5}, - {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, {value: 0x0004, lo: 0xb8, hi: 0xb8}, {value: 0x0012, lo: 0xba, hi: 0xba}, // Block 0x1, offset 0x9 @@ -631,7 +631,7 @@ var sparseValues = [1362]valueRange{ {value: 0x0004, lo: 0x82, hi: 0x85}, {value: 0x0014, lo: 0x86, hi: 0x91}, {value: 0x0004, lo: 0x92, hi: 0x96}, - {value: 0x0014, lo: 0x97, hi: 0x97}, + {value: 0x0054, lo: 0x97, hi: 0x97}, {value: 0x0004, lo: 0x98, hi: 0x9f}, {value: 0x0015, lo: 0xa0, hi: 0xa4}, {value: 0x0004, lo: 0xa5, hi: 0xab}, @@ -701,7 +701,7 @@ var sparseValues = [1362]valueRange{ {value: 0x0034, lo: 0x87, hi: 0x87}, {value: 0x0010, lo: 0x90, hi: 0xaa}, {value: 0x0010, lo: 0xb0, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, // Block 0xf, offset 0x70 {value: 0x0014, lo: 0x80, hi: 0x85}, {value: 0x0024, lo: 0x90, hi: 0x97}, @@ -1372,25 +1372,23 @@ var sparseValues = [1362]valueRange{ {value: 0x0813, lo: 0xb8, hi: 0xbf}, // Block 0x63, offset 0x2b8 {value: 0x0004, lo: 0x8b, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0004, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x8e, hi: 0x8f}, - {value: 0x0014, lo: 0x98, hi: 0x99}, - {value: 0x0014, lo: 0xa4, hi: 0xa4}, - {value: 0x0014, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, {value: 0x0014, lo: 0xaa, hi: 0xae}, {value: 0x0010, lo: 0xaf, hi: 0xaf}, {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x64, offset 0x2c2 + // Block 0x64, offset 0x2c0 {value: 0x0010, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x94, hi: 0x94}, {value: 0x0014, lo: 0xa0, hi: 0xa4}, {value: 0x0014, lo: 0xa6, hi: 0xaf}, {value: 0x0015, lo: 0xb1, hi: 0xb1}, {value: 0x0015, lo: 0xbf, hi: 0xbf}, - // Block 0x65, offset 0x2c8 + // Block 0x65, offset 0x2c6 {value: 0x0015, lo: 0x90, hi: 0x9c}, - // Block 0x66, offset 0x2c9 + // Block 0x66, offset 0x2c7 {value: 0x0024, lo: 0x90, hi: 0x91}, {value: 0x0034, lo: 0x92, hi: 0x93}, {value: 0x0024, lo: 0x94, hi: 0x97}, @@ -1405,112 +1403,112 @@ var sparseValues = [1362]valueRange{ {value: 0x0024, lo: 0xa9, hi: 0xa9}, {value: 0x0034, lo: 0xaa, hi: 0xaf}, {value: 0x0024, lo: 0xb0, hi: 0xb0}, - // Block 0x67, offset 0x2d7 + // Block 0x67, offset 0x2d5 {value: 0x0016, lo: 0x85, hi: 0x86}, {value: 0x0012, lo: 0x87, hi: 0x89}, {value: 0x9d52, lo: 0x8e, hi: 0x8e}, {value: 0x1013, lo: 0xa0, hi: 0xaf}, {value: 0x1012, lo: 0xb0, hi: 0xbf}, - // Block 0x68, offset 0x2dc + // Block 0x68, offset 0x2da {value: 0x0010, lo: 0x80, hi: 0x82}, {value: 0x0716, lo: 0x83, hi: 0x84}, {value: 0x0010, lo: 0x85, hi: 0x88}, - // Block 0x69, offset 0x2df + // Block 0x69, offset 0x2dd {value: 0xa053, lo: 0xb6, hi: 0xb7}, {value: 0xa353, lo: 0xb8, hi: 0xb9}, {value: 0xa653, lo: 0xba, hi: 0xbb}, {value: 0xa353, lo: 0xbc, hi: 0xbd}, {value: 0xa053, lo: 0xbe, hi: 0xbf}, - // Block 0x6a, offset 0x2e4 + // Block 0x6a, offset 0x2e2 {value: 0x3013, lo: 0x80, hi: 0x8f}, {value: 0x6553, lo: 0x90, hi: 0x9f}, {value: 0xa953, lo: 0xa0, hi: 0xae}, {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0x6b, offset 0x2e8 + // Block 0x6b, offset 0x2e6 {value: 0x0117, lo: 0x80, hi: 0xa3}, {value: 0x0012, lo: 0xa4, hi: 0xa4}, {value: 0x0716, lo: 0xab, hi: 0xac}, {value: 0x0316, lo: 0xad, hi: 0xae}, {value: 0x0024, lo: 0xaf, hi: 0xb1}, {value: 0x0117, lo: 0xb2, hi: 0xb3}, - // Block 0x6c, offset 0x2ee + // Block 0x6c, offset 0x2ec {value: 0x6c52, lo: 0x80, hi: 0x9f}, {value: 0x7052, lo: 0xa0, hi: 0xa5}, {value: 0x7052, lo: 0xa7, hi: 0xa7}, {value: 0x7052, lo: 0xad, hi: 0xad}, {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x6d, offset 0x2f3 + // Block 0x6d, offset 0x2f1 {value: 0x0010, lo: 0x80, hi: 0xa7}, {value: 0x0014, lo: 0xaf, hi: 0xaf}, {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x6e, offset 0x2f6 + // Block 0x6e, offset 0x2f4 {value: 0x0010, lo: 0x80, hi: 0x96}, {value: 0x0010, lo: 0xa0, hi: 0xa6}, {value: 0x0010, lo: 0xa8, hi: 0xae}, {value: 0x0010, lo: 0xb0, hi: 0xb6}, {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x6f, offset 0x2fb + // Block 0x6f, offset 0x2f9 {value: 0x0010, lo: 0x80, hi: 0x86}, {value: 0x0010, lo: 0x88, hi: 0x8e}, {value: 0x0010, lo: 0x90, hi: 0x96}, {value: 0x0010, lo: 0x98, hi: 0x9e}, {value: 0x0024, lo: 0xa0, hi: 0xbf}, - // Block 0x70, offset 0x300 + // Block 0x70, offset 0x2fe {value: 0x0014, lo: 0xaf, hi: 0xaf}, - // Block 0x71, offset 0x301 + // Block 0x71, offset 0x2ff {value: 0x0014, lo: 0x85, hi: 0x85}, {value: 0x0034, lo: 0xaa, hi: 0xad}, {value: 0x0030, lo: 0xae, hi: 0xaf}, {value: 0x0004, lo: 0xb1, hi: 0xb5}, {value: 0x0014, lo: 0xbb, hi: 0xbb}, {value: 0x0010, lo: 0xbc, hi: 0xbc}, - // Block 0x72, offset 0x307 + // Block 0x72, offset 0x305 {value: 0x0034, lo: 0x99, hi: 0x9a}, {value: 0x0004, lo: 0x9b, hi: 0x9e}, - // Block 0x73, offset 0x309 + // Block 0x73, offset 0x307 {value: 0x0004, lo: 0xbc, hi: 0xbe}, - // Block 0x74, offset 0x30a + // Block 0x74, offset 0x308 {value: 0x0010, lo: 0x85, hi: 0xad}, {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x75, offset 0x30c + // Block 0x75, offset 0x30a {value: 0x0010, lo: 0x80, hi: 0x8e}, {value: 0x0010, lo: 0xa0, hi: 0xba}, - // Block 0x76, offset 0x30e + // Block 0x76, offset 0x30c {value: 0x0010, lo: 0x80, hi: 0x94}, {value: 0x0014, lo: 0x95, hi: 0x95}, {value: 0x0010, lo: 0x96, hi: 0xbf}, - // Block 0x77, offset 0x311 + // Block 0x77, offset 0x30f {value: 0x0010, lo: 0x80, hi: 0x8c}, - // Block 0x78, offset 0x312 + // Block 0x78, offset 0x310 {value: 0x0010, lo: 0x90, hi: 0xb7}, {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x79, offset 0x314 + // Block 0x79, offset 0x312 {value: 0x0010, lo: 0x80, hi: 0x8b}, {value: 0x0014, lo: 0x8c, hi: 0x8c}, {value: 0x0010, lo: 0x90, hi: 0xab}, - // Block 0x7a, offset 0x317 + // Block 0x7a, offset 0x315 {value: 0x0117, lo: 0x80, hi: 0xad}, {value: 0x0010, lo: 0xae, hi: 0xae}, {value: 0x0024, lo: 0xaf, hi: 0xaf}, {value: 0x0014, lo: 0xb0, hi: 0xb2}, {value: 0x0024, lo: 0xb4, hi: 0xbd}, {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x7b, offset 0x31d + // Block 0x7b, offset 0x31b {value: 0x0117, lo: 0x80, hi: 0x9b}, {value: 0x0015, lo: 0x9c, hi: 0x9d}, {value: 0x0024, lo: 0x9e, hi: 0x9f}, {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x7c, offset 0x321 + // Block 0x7c, offset 0x31f {value: 0x0010, lo: 0x80, hi: 0xaf}, {value: 0x0024, lo: 0xb0, hi: 0xb1}, - // Block 0x7d, offset 0x323 + // Block 0x7d, offset 0x321 {value: 0x0004, lo: 0x80, hi: 0x96}, {value: 0x0014, lo: 0x97, hi: 0x9f}, {value: 0x0004, lo: 0xa0, hi: 0xa1}, {value: 0x0117, lo: 0xa2, hi: 0xaf}, {value: 0x0012, lo: 0xb0, hi: 0xb1}, {value: 0x0117, lo: 0xb2, hi: 0xbf}, - // Block 0x7e, offset 0x329 + // Block 0x7e, offset 0x327 {value: 0x0117, lo: 0x80, hi: 0xaf}, {value: 0x0015, lo: 0xb0, hi: 0xb0}, {value: 0x0012, lo: 0xb1, hi: 0xb8}, @@ -1518,12 +1516,12 @@ var sparseValues = [1362]valueRange{ {value: 0x0716, lo: 0xbb, hi: 0xbc}, {value: 0x8453, lo: 0xbd, hi: 0xbd}, {value: 0x0117, lo: 0xbe, hi: 0xbf}, - // Block 0x7f, offset 0x330 + // Block 0x7f, offset 0x32e {value: 0x0010, lo: 0xb7, hi: 0xb7}, {value: 0x0015, lo: 0xb8, hi: 0xb9}, {value: 0x0012, lo: 0xba, hi: 0xba}, {value: 0x0010, lo: 0xbb, hi: 0xbf}, - // Block 0x80, offset 0x334 + // Block 0x80, offset 0x332 {value: 0x0010, lo: 0x80, hi: 0x81}, {value: 0x0014, lo: 0x82, hi: 0x82}, {value: 0x0010, lo: 0x83, hi: 0x85}, @@ -1533,9 +1531,9 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0x8c, hi: 0xa4}, {value: 0x0014, lo: 0xa5, hi: 0xa6}, {value: 0x0010, lo: 0xa7, hi: 0xa7}, - // Block 0x81, offset 0x33d + // Block 0x81, offset 0x33b {value: 0x0010, lo: 0x80, hi: 0xb3}, - // Block 0x82, offset 0x33e + // Block 0x82, offset 0x33c {value: 0x0010, lo: 0x80, hi: 0x83}, {value: 0x0034, lo: 0x84, hi: 0x84}, {value: 0x0014, lo: 0x85, hi: 0x85}, @@ -1544,18 +1542,18 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0xb2, hi: 0xb7}, {value: 0x0010, lo: 0xbb, hi: 0xbb}, {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x83, offset 0x346 + // Block 0x83, offset 0x344 {value: 0x0010, lo: 0x80, hi: 0xa5}, {value: 0x0014, lo: 0xa6, hi: 0xaa}, {value: 0x0034, lo: 0xab, hi: 0xad}, {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x84, offset 0x34a + // Block 0x84, offset 0x348 {value: 0x0010, lo: 0x80, hi: 0x86}, {value: 0x0014, lo: 0x87, hi: 0x91}, {value: 0x0010, lo: 0x92, hi: 0x92}, {value: 0x0030, lo: 0x93, hi: 0x93}, {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0x85, offset 0x34f + // Block 0x85, offset 0x34d {value: 0x0014, lo: 0x80, hi: 0x82}, {value: 0x0010, lo: 0x83, hi: 0xb2}, {value: 0x0034, lo: 0xb3, hi: 0xb3}, @@ -1564,21 +1562,21 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0xba, hi: 0xbb}, {value: 0x0014, lo: 0xbc, hi: 0xbc}, {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x86, offset 0x357 + // Block 0x86, offset 0x355 {value: 0x0030, lo: 0x80, hi: 0x80}, {value: 0x0014, lo: 0x8f, hi: 0x8f}, {value: 0x0010, lo: 0x90, hi: 0x99}, {value: 0x0014, lo: 0xa5, hi: 0xa5}, {value: 0x0004, lo: 0xa6, hi: 0xa6}, {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x87, offset 0x35d + // Block 0x87, offset 0x35b {value: 0x0010, lo: 0x80, hi: 0xa8}, {value: 0x0014, lo: 0xa9, hi: 0xae}, {value: 0x0010, lo: 0xaf, hi: 0xb0}, {value: 0x0014, lo: 0xb1, hi: 0xb2}, {value: 0x0010, lo: 0xb3, hi: 0xb4}, {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0x88, offset 0x363 + // Block 0x88, offset 0x361 {value: 0x0010, lo: 0x80, hi: 0x82}, {value: 0x0014, lo: 0x83, hi: 0x83}, {value: 0x0010, lo: 0x84, hi: 0x8b}, @@ -1589,13 +1587,13 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0xbb, hi: 0xbb}, {value: 0x0014, lo: 0xbc, hi: 0xbc}, {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x89, offset 0x36d + // Block 0x89, offset 0x36b {value: 0x0024, lo: 0xb0, hi: 0xb0}, {value: 0x0024, lo: 0xb2, hi: 0xb3}, {value: 0x0034, lo: 0xb4, hi: 0xb4}, {value: 0x0024, lo: 0xb7, hi: 0xb8}, {value: 0x0024, lo: 0xbe, hi: 0xbf}, - // Block 0x8a, offset 0x372 + // Block 0x8a, offset 0x370 {value: 0x0024, lo: 0x81, hi: 0x81}, {value: 0x0004, lo: 0x9d, hi: 0x9d}, {value: 0x0010, lo: 0xa0, hi: 0xab}, @@ -1605,14 +1603,14 @@ var sparseValues = [1362]valueRange{ {value: 0x0014, lo: 0xb3, hi: 0xb4}, {value: 0x0010, lo: 0xb5, hi: 0xb5}, {value: 0x0034, lo: 0xb6, hi: 0xb6}, - // Block 0x8b, offset 0x37b + // Block 0x8b, offset 0x379 {value: 0x0010, lo: 0x81, hi: 0x86}, {value: 0x0010, lo: 0x89, hi: 0x8e}, {value: 0x0010, lo: 0x91, hi: 0x96}, {value: 0x0010, lo: 0xa0, hi: 0xa6}, {value: 0x0010, lo: 0xa8, hi: 0xae}, {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x8c, offset 0x381 + // Block 0x8c, offset 0x37f {value: 0x0012, lo: 0x80, hi: 0x92}, {value: 0xac52, lo: 0x93, hi: 0x93}, {value: 0x0012, lo: 0x94, hi: 0x9a}, @@ -1620,12 +1618,12 @@ var sparseValues = [1362]valueRange{ {value: 0x0015, lo: 0x9c, hi: 0x9f}, {value: 0x0012, lo: 0xa0, hi: 0xa5}, {value: 0x74d2, lo: 0xb0, hi: 0xbf}, - // Block 0x8d, offset 0x388 + // Block 0x8d, offset 0x386 {value: 0x78d2, lo: 0x80, hi: 0x8f}, {value: 0x7cd2, lo: 0x90, hi: 0x9f}, {value: 0x80d2, lo: 0xa0, hi: 0xaf}, {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, - // Block 0x8e, offset 0x38c + // Block 0x8e, offset 0x38a {value: 0x0010, lo: 0x80, hi: 0xa4}, {value: 0x0014, lo: 0xa5, hi: 0xa5}, {value: 0x0010, lo: 0xa6, hi: 0xa7}, @@ -1634,105 +1632,105 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0xac, hi: 0xac}, {value: 0x0034, lo: 0xad, hi: 0xad}, {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x8f, offset 0x394 + // Block 0x8f, offset 0x392 {value: 0x0010, lo: 0x80, hi: 0xa3}, {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x90, offset 0x396 + // Block 0x90, offset 0x394 {value: 0x0010, lo: 0x80, hi: 0x86}, {value: 0x0010, lo: 0x8b, hi: 0xbb}, - // Block 0x91, offset 0x398 + // Block 0x91, offset 0x396 {value: 0x0010, lo: 0x80, hi: 0x81}, {value: 0x0010, lo: 0x83, hi: 0x84}, {value: 0x0010, lo: 0x86, hi: 0xbf}, - // Block 0x92, offset 0x39b + // Block 0x92, offset 0x399 {value: 0x0010, lo: 0x80, hi: 0xb1}, {value: 0x0004, lo: 0xb2, hi: 0xbf}, - // Block 0x93, offset 0x39d + // Block 0x93, offset 0x39b {value: 0x0004, lo: 0x80, hi: 0x81}, {value: 0x0010, lo: 0x93, hi: 0xbf}, - // Block 0x94, offset 0x39f + // Block 0x94, offset 0x39d {value: 0x0010, lo: 0x80, hi: 0xbd}, - // Block 0x95, offset 0x3a0 + // Block 0x95, offset 0x39e {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0x96, offset 0x3a1 + // Block 0x96, offset 0x39f {value: 0x0010, lo: 0x80, hi: 0x8f}, {value: 0x0010, lo: 0x92, hi: 0xbf}, - // Block 0x97, offset 0x3a3 + // Block 0x97, offset 0x3a1 {value: 0x0010, lo: 0x80, hi: 0x87}, {value: 0x0010, lo: 0xb0, hi: 0xbb}, - // Block 0x98, offset 0x3a5 + // Block 0x98, offset 0x3a3 {value: 0x0014, lo: 0x80, hi: 0x8f}, - {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0054, lo: 0x93, hi: 0x93}, {value: 0x0024, lo: 0xa0, hi: 0xa6}, {value: 0x0034, lo: 0xa7, hi: 0xad}, {value: 0x0024, lo: 0xae, hi: 0xaf}, {value: 0x0010, lo: 0xb3, hi: 0xb4}, - // Block 0x99, offset 0x3ab + // Block 0x99, offset 0x3a9 {value: 0x0010, lo: 0x8d, hi: 0x8f}, - {value: 0x0014, lo: 0x92, hi: 0x92}, - {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, {value: 0x0010, lo: 0xb0, hi: 0xb4}, {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0x9a, offset 0x3b0 + // Block 0x9a, offset 0x3ae {value: 0x0010, lo: 0x80, hi: 0xbc}, {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x9b, offset 0x3b2 - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0014, lo: 0x8e, hi: 0x8e}, - {value: 0x0014, lo: 0x9a, hi: 0x9a}, + // Block 0x9b, offset 0x3b0 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, {value: 0x5f53, lo: 0xa1, hi: 0xba}, {value: 0x0004, lo: 0xbe, hi: 0xbe}, {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9c, offset 0x3b8 + // Block 0x9c, offset 0x3b6 {value: 0x0004, lo: 0x80, hi: 0x80}, {value: 0x5f52, lo: 0x81, hi: 0x9a}, {value: 0x0004, lo: 0xb0, hi: 0xb0}, - // Block 0x9d, offset 0x3bb + // Block 0x9d, offset 0x3b9 {value: 0x0014, lo: 0x9e, hi: 0x9f}, {value: 0x0010, lo: 0xa0, hi: 0xbe}, - // Block 0x9e, offset 0x3bd + // Block 0x9e, offset 0x3bb {value: 0x0010, lo: 0x82, hi: 0x87}, {value: 0x0010, lo: 0x8a, hi: 0x8f}, {value: 0x0010, lo: 0x92, hi: 0x97}, {value: 0x0010, lo: 0x9a, hi: 0x9c}, {value: 0x0004, lo: 0xa3, hi: 0xa3}, {value: 0x0014, lo: 0xb9, hi: 0xbb}, - // Block 0x9f, offset 0x3c3 + // Block 0x9f, offset 0x3c1 {value: 0x0010, lo: 0x80, hi: 0x8b}, {value: 0x0010, lo: 0x8d, hi: 0xa6}, {value: 0x0010, lo: 0xa8, hi: 0xba}, {value: 0x0010, lo: 0xbc, hi: 0xbd}, {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xa0, offset 0x3c8 + // Block 0xa0, offset 0x3c6 {value: 0x0010, lo: 0x80, hi: 0x8d}, {value: 0x0010, lo: 0x90, hi: 0x9d}, - // Block 0xa1, offset 0x3ca + // Block 0xa1, offset 0x3c8 {value: 0x0010, lo: 0x80, hi: 0xba}, - // Block 0xa2, offset 0x3cb + // Block 0xa2, offset 0x3c9 {value: 0x0010, lo: 0x80, hi: 0xb4}, - // Block 0xa3, offset 0x3cc + // Block 0xa3, offset 0x3ca {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0xa4, offset 0x3cd + // Block 0xa4, offset 0x3cb {value: 0x0010, lo: 0x80, hi: 0x9c}, {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa5, offset 0x3cf + // Block 0xa5, offset 0x3cd {value: 0x0010, lo: 0x80, hi: 0x90}, {value: 0x0034, lo: 0xa0, hi: 0xa0}, - // Block 0xa6, offset 0x3d1 + // Block 0xa6, offset 0x3cf {value: 0x0010, lo: 0x80, hi: 0x9f}, {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xa7, offset 0x3d3 + // Block 0xa7, offset 0x3d1 {value: 0x0010, lo: 0x80, hi: 0x8a}, {value: 0x0010, lo: 0x90, hi: 0xb5}, {value: 0x0024, lo: 0xb6, hi: 0xba}, - // Block 0xa8, offset 0x3d6 + // Block 0xa8, offset 0x3d4 {value: 0x0010, lo: 0x80, hi: 0x9d}, {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa9, offset 0x3d8 + // Block 0xa9, offset 0x3d6 {value: 0x0010, lo: 0x80, hi: 0x83}, {value: 0x0010, lo: 0x88, hi: 0x8f}, {value: 0x0010, lo: 0x91, hi: 0x95}, - // Block 0xaa, offset 0x3db + // Block 0xaa, offset 0x3d9 {value: 0x2813, lo: 0x80, hi: 0x87}, {value: 0x3813, lo: 0x88, hi: 0x8f}, {value: 0x2813, lo: 0x90, hi: 0x97}, @@ -1741,16 +1739,16 @@ var sparseValues = [1362]valueRange{ {value: 0x2812, lo: 0xa8, hi: 0xaf}, {value: 0x3812, lo: 0xb0, hi: 0xb7}, {value: 0x2812, lo: 0xb8, hi: 0xbf}, - // Block 0xab, offset 0x3e3 + // Block 0xab, offset 0x3e1 {value: 0xaf52, lo: 0x80, hi: 0x87}, {value: 0xb252, lo: 0x88, hi: 0x8f}, {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0xac, offset 0x3e6 + // Block 0xac, offset 0x3e4 {value: 0x0010, lo: 0x80, hi: 0x9d}, {value: 0x0010, lo: 0xa0, hi: 0xa9}, {value: 0xb253, lo: 0xb0, hi: 0xb7}, {value: 0xaf53, lo: 0xb8, hi: 0xbf}, - // Block 0xad, offset 0x3ea + // Block 0xad, offset 0x3e8 {value: 0x2813, lo: 0x80, hi: 0x87}, {value: 0x3813, lo: 0x88, hi: 0x8f}, {value: 0x2813, lo: 0x90, hi: 0x93}, @@ -1759,38 +1757,38 @@ var sparseValues = [1362]valueRange{ {value: 0x2812, lo: 0xa8, hi: 0xaf}, {value: 0x3812, lo: 0xb0, hi: 0xb7}, {value: 0x2812, lo: 0xb8, hi: 0xbb}, - // Block 0xae, offset 0x3f2 + // Block 0xae, offset 0x3f0 {value: 0x0010, lo: 0x80, hi: 0xa7}, {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xaf, offset 0x3f4 + // Block 0xaf, offset 0x3f2 {value: 0x0010, lo: 0x80, hi: 0xa3}, - // Block 0xb0, offset 0x3f5 + // Block 0xb0, offset 0x3f3 {value: 0x0010, lo: 0x80, hi: 0xb6}, - // Block 0xb1, offset 0x3f6 + // Block 0xb1, offset 0x3f4 {value: 0x0010, lo: 0x80, hi: 0x95}, {value: 0x0010, lo: 0xa0, hi: 0xa7}, - // Block 0xb2, offset 0x3f8 + // Block 0xb2, offset 0x3f6 {value: 0x0010, lo: 0x80, hi: 0x85}, {value: 0x0010, lo: 0x88, hi: 0x88}, {value: 0x0010, lo: 0x8a, hi: 0xb5}, {value: 0x0010, lo: 0xb7, hi: 0xb8}, {value: 0x0010, lo: 0xbc, hi: 0xbc}, {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xb3, offset 0x3fe + // Block 0xb3, offset 0x3fc {value: 0x0010, lo: 0x80, hi: 0x95}, {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xb4, offset 0x400 + // Block 0xb4, offset 0x3fe {value: 0x0010, lo: 0x80, hi: 0x9e}, - // Block 0xb5, offset 0x401 + // Block 0xb5, offset 0x3ff {value: 0x0010, lo: 0xa0, hi: 0xb2}, {value: 0x0010, lo: 0xb4, hi: 0xb5}, - // Block 0xb6, offset 0x403 + // Block 0xb6, offset 0x401 {value: 0x0010, lo: 0x80, hi: 0x95}, {value: 0x0010, lo: 0xa0, hi: 0xb9}, - // Block 0xb7, offset 0x405 + // Block 0xb7, offset 0x403 {value: 0x0010, lo: 0x80, hi: 0xb7}, {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0xb8, offset 0x407 + // Block 0xb8, offset 0x405 {value: 0x0010, lo: 0x80, hi: 0x80}, {value: 0x0014, lo: 0x81, hi: 0x83}, {value: 0x0014, lo: 0x85, hi: 0x86}, @@ -1804,47 +1802,47 @@ var sparseValues = [1362]valueRange{ {value: 0x0024, lo: 0xb8, hi: 0xb8}, {value: 0x0034, lo: 0xb9, hi: 0xba}, {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xb9, offset 0x414 + // Block 0xb9, offset 0x412 {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0xba, offset 0x415 + // Block 0xba, offset 0x413 {value: 0x0010, lo: 0x80, hi: 0x9c}, - // Block 0xbb, offset 0x416 + // Block 0xbb, offset 0x414 {value: 0x0010, lo: 0x80, hi: 0x87}, {value: 0x0010, lo: 0x89, hi: 0xa4}, {value: 0x0024, lo: 0xa5, hi: 0xa5}, {value: 0x0034, lo: 0xa6, hi: 0xa6}, - // Block 0xbc, offset 0x41a + // Block 0xbc, offset 0x418 {value: 0x0010, lo: 0x80, hi: 0x95}, {value: 0x0010, lo: 0xa0, hi: 0xb2}, - // Block 0xbd, offset 0x41c + // Block 0xbd, offset 0x41a {value: 0x0010, lo: 0x80, hi: 0x91}, - // Block 0xbe, offset 0x41d + // Block 0xbe, offset 0x41b {value: 0x0010, lo: 0x80, hi: 0x88}, - // Block 0xbf, offset 0x41e + // Block 0xbf, offset 0x41c {value: 0x5653, lo: 0x80, hi: 0xb2}, - // Block 0xc0, offset 0x41f + // Block 0xc0, offset 0x41d {value: 0x5652, lo: 0x80, hi: 0xb2}, - // Block 0xc1, offset 0x420 + // Block 0xc1, offset 0x41e {value: 0x0010, lo: 0x80, hi: 0x80}, {value: 0x0014, lo: 0x81, hi: 0x81}, {value: 0x0010, lo: 0x82, hi: 0xb7}, {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xc2, offset 0x424 + // Block 0xc2, offset 0x422 {value: 0x0014, lo: 0x80, hi: 0x85}, {value: 0x0034, lo: 0x86, hi: 0x86}, {value: 0x0010, lo: 0xa6, hi: 0xaf}, {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xc3, offset 0x428 + // Block 0xc3, offset 0x426 {value: 0x0014, lo: 0x80, hi: 0x81}, {value: 0x0010, lo: 0x82, hi: 0xb2}, {value: 0x0014, lo: 0xb3, hi: 0xb6}, {value: 0x0010, lo: 0xb7, hi: 0xb8}, {value: 0x0034, lo: 0xb9, hi: 0xba}, {value: 0x0014, lo: 0xbd, hi: 0xbd}, - // Block 0xc4, offset 0x42e + // Block 0xc4, offset 0x42c {value: 0x0010, lo: 0x90, hi: 0xa8}, {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xc5, offset 0x430 + // Block 0xc5, offset 0x42e {value: 0x0024, lo: 0x80, hi: 0x82}, {value: 0x0010, lo: 0x83, hi: 0xa6}, {value: 0x0014, lo: 0xa7, hi: 0xab}, @@ -1852,23 +1850,23 @@ var sparseValues = [1362]valueRange{ {value: 0x0014, lo: 0xad, hi: 0xb2}, {value: 0x0034, lo: 0xb3, hi: 0xb4}, {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0xc6, offset 0x437 + // Block 0xc6, offset 0x435 {value: 0x0010, lo: 0x90, hi: 0xb2}, {value: 0x0034, lo: 0xb3, hi: 0xb3}, {value: 0x0010, lo: 0xb6, hi: 0xb6}, - // Block 0xc7, offset 0x43a + // Block 0xc7, offset 0x438 {value: 0x0014, lo: 0x80, hi: 0x81}, {value: 0x0010, lo: 0x82, hi: 0xb5}, {value: 0x0014, lo: 0xb6, hi: 0xbe}, {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xc8, offset 0x43e + // Block 0xc8, offset 0x43c {value: 0x0030, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x81, hi: 0x84}, {value: 0x0034, lo: 0x8a, hi: 0x8a}, {value: 0x0014, lo: 0x8b, hi: 0x8c}, {value: 0x0010, lo: 0x90, hi: 0x9a}, {value: 0x0010, lo: 0x9c, hi: 0x9c}, - // Block 0xc9, offset 0x444 + // Block 0xc9, offset 0x442 {value: 0x0010, lo: 0x80, hi: 0x91}, {value: 0x0010, lo: 0x93, hi: 0xae}, {value: 0x0014, lo: 0xaf, hi: 0xb1}, @@ -1878,21 +1876,21 @@ var sparseValues = [1362]valueRange{ {value: 0x0034, lo: 0xb6, hi: 0xb6}, {value: 0x0014, lo: 0xb7, hi: 0xb7}, {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0xca, offset 0x44d + // Block 0xca, offset 0x44b {value: 0x0010, lo: 0x80, hi: 0x86}, {value: 0x0010, lo: 0x88, hi: 0x88}, {value: 0x0010, lo: 0x8a, hi: 0x8d}, {value: 0x0010, lo: 0x8f, hi: 0x9d}, {value: 0x0010, lo: 0x9f, hi: 0xa8}, {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xcb, offset 0x453 + // Block 0xcb, offset 0x451 {value: 0x0010, lo: 0x80, hi: 0x9e}, {value: 0x0014, lo: 0x9f, hi: 0x9f}, {value: 0x0010, lo: 0xa0, hi: 0xa2}, {value: 0x0014, lo: 0xa3, hi: 0xa8}, {value: 0x0034, lo: 0xa9, hi: 0xaa}, {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xcc, offset 0x459 + // Block 0xcc, offset 0x457 {value: 0x0014, lo: 0x80, hi: 0x81}, {value: 0x0010, lo: 0x82, hi: 0x83}, {value: 0x0010, lo: 0x85, hi: 0x8c}, @@ -1903,7 +1901,7 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0xb5, hi: 0xb9}, {value: 0x0034, lo: 0xbc, hi: 0xbc}, {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xcd, offset 0x463 + // Block 0xcd, offset 0x461 {value: 0x0014, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x81, hi: 0x84}, {value: 0x0010, lo: 0x87, hi: 0x88}, @@ -1914,10 +1912,10 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0x9d, hi: 0xa3}, {value: 0x0024, lo: 0xa6, hi: 0xac}, {value: 0x0024, lo: 0xb0, hi: 0xb4}, - // Block 0xce, offset 0x46d + // Block 0xce, offset 0x46b {value: 0x0010, lo: 0x80, hi: 0xb7}, {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xcf, offset 0x46f + // Block 0xcf, offset 0x46d {value: 0x0010, lo: 0x80, hi: 0x81}, {value: 0x0034, lo: 0x82, hi: 0x82}, {value: 0x0014, lo: 0x83, hi: 0x84}, @@ -1925,43 +1923,43 @@ var sparseValues = [1362]valueRange{ {value: 0x0034, lo: 0x86, hi: 0x86}, {value: 0x0010, lo: 0x87, hi: 0x8a}, {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd0, offset 0x476 + // Block 0xd0, offset 0x474 {value: 0x0010, lo: 0x80, hi: 0xb2}, {value: 0x0014, lo: 0xb3, hi: 0xb8}, {value: 0x0010, lo: 0xb9, hi: 0xb9}, {value: 0x0014, lo: 0xba, hi: 0xba}, {value: 0x0010, lo: 0xbb, hi: 0xbe}, {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xd1, offset 0x47c + // Block 0xd1, offset 0x47a {value: 0x0014, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x81, hi: 0x81}, {value: 0x0034, lo: 0x82, hi: 0x83}, {value: 0x0010, lo: 0x84, hi: 0x85}, {value: 0x0010, lo: 0x87, hi: 0x87}, {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd2, offset 0x482 + // Block 0xd2, offset 0x480 {value: 0x0010, lo: 0x80, hi: 0xb1}, {value: 0x0014, lo: 0xb2, hi: 0xb5}, {value: 0x0010, lo: 0xb8, hi: 0xbb}, {value: 0x0014, lo: 0xbc, hi: 0xbd}, {value: 0x0010, lo: 0xbe, hi: 0xbe}, {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd3, offset 0x488 + // Block 0xd3, offset 0x486 {value: 0x0034, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x98, hi: 0x9b}, {value: 0x0014, lo: 0x9c, hi: 0x9d}, - // Block 0xd4, offset 0x48b + // Block 0xd4, offset 0x489 {value: 0x0010, lo: 0x80, hi: 0xb2}, {value: 0x0014, lo: 0xb3, hi: 0xba}, {value: 0x0010, lo: 0xbb, hi: 0xbc}, {value: 0x0014, lo: 0xbd, hi: 0xbd}, {value: 0x0010, lo: 0xbe, hi: 0xbe}, {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd5, offset 0x491 + // Block 0xd5, offset 0x48f {value: 0x0014, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x84, hi: 0x84}, {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd6, offset 0x494 + // Block 0xd6, offset 0x492 {value: 0x0010, lo: 0x80, hi: 0xaa}, {value: 0x0014, lo: 0xab, hi: 0xab}, {value: 0x0010, lo: 0xac, hi: 0xac}, @@ -1970,9 +1968,9 @@ var sparseValues = [1362]valueRange{ {value: 0x0014, lo: 0xb0, hi: 0xb5}, {value: 0x0030, lo: 0xb6, hi: 0xb6}, {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0xd7, offset 0x49c + // Block 0xd7, offset 0x49a {value: 0x0010, lo: 0x80, hi: 0x89}, - // Block 0xd8, offset 0x49d + // Block 0xd8, offset 0x49b {value: 0x0014, lo: 0x9d, hi: 0x9f}, {value: 0x0010, lo: 0xa0, hi: 0xa1}, {value: 0x0014, lo: 0xa2, hi: 0xa5}, @@ -1980,26 +1978,26 @@ var sparseValues = [1362]valueRange{ {value: 0x0014, lo: 0xa7, hi: 0xaa}, {value: 0x0034, lo: 0xab, hi: 0xab}, {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xd9, offset 0x4a4 + // Block 0xd9, offset 0x4a2 {value: 0x5f53, lo: 0xa0, hi: 0xbf}, - // Block 0xda, offset 0x4a5 + // Block 0xda, offset 0x4a3 {value: 0x5f52, lo: 0x80, hi: 0x9f}, {value: 0x0010, lo: 0xa0, hi: 0xa9}, {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xdb, offset 0x4a8 + // Block 0xdb, offset 0x4a6 {value: 0x0010, lo: 0x80, hi: 0xb8}, - // Block 0xdc, offset 0x4a9 + // Block 0xdc, offset 0x4a7 {value: 0x0010, lo: 0x80, hi: 0x88}, {value: 0x0010, lo: 0x8a, hi: 0xaf}, {value: 0x0014, lo: 0xb0, hi: 0xb6}, {value: 0x0014, lo: 0xb8, hi: 0xbd}, {value: 0x0010, lo: 0xbe, hi: 0xbe}, {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xdd, offset 0x4af + // Block 0xdd, offset 0x4ad {value: 0x0010, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x90, hi: 0x99}, {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0xde, offset 0x4b2 + // Block 0xde, offset 0x4b0 {value: 0x0010, lo: 0x80, hi: 0x8f}, {value: 0x0014, lo: 0x92, hi: 0xa7}, {value: 0x0010, lo: 0xa9, hi: 0xa9}, @@ -2008,69 +2006,69 @@ var sparseValues = [1362]valueRange{ {value: 0x0014, lo: 0xb2, hi: 0xb3}, {value: 0x0010, lo: 0xb4, hi: 0xb4}, {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0xdf, offset 0x4ba + // Block 0xdf, offset 0x4b8 {value: 0x0010, lo: 0x80, hi: 0x99}, - // Block 0xe0, offset 0x4bb + // Block 0xe0, offset 0x4b9 {value: 0x0010, lo: 0x80, hi: 0xae}, - // Block 0xe1, offset 0x4bc + // Block 0xe1, offset 0x4ba {value: 0x0010, lo: 0x80, hi: 0x83}, - // Block 0xe2, offset 0x4bd + // Block 0xe2, offset 0x4bb {value: 0x0010, lo: 0x80, hi: 0x86}, - // Block 0xe3, offset 0x4be + // Block 0xe3, offset 0x4bc {value: 0x0010, lo: 0x80, hi: 0x9e}, {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xe4, offset 0x4c0 + // Block 0xe4, offset 0x4be {value: 0x0010, lo: 0x90, hi: 0xad}, {value: 0x0034, lo: 0xb0, hi: 0xb4}, - // Block 0xe5, offset 0x4c2 + // Block 0xe5, offset 0x4c0 {value: 0x0010, lo: 0x80, hi: 0xaf}, {value: 0x0024, lo: 0xb0, hi: 0xb6}, - // Block 0xe6, offset 0x4c4 + // Block 0xe6, offset 0x4c2 {value: 0x0014, lo: 0x80, hi: 0x83}, {value: 0x0010, lo: 0x90, hi: 0x99}, {value: 0x0010, lo: 0xa3, hi: 0xb7}, {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xe7, offset 0x4c8 + // Block 0xe7, offset 0x4c6 {value: 0x0010, lo: 0x80, hi: 0x8f}, - // Block 0xe8, offset 0x4c9 + // Block 0xe8, offset 0x4c7 {value: 0x0010, lo: 0x80, hi: 0x84}, {value: 0x0010, lo: 0x90, hi: 0xbe}, - // Block 0xe9, offset 0x4cb + // Block 0xe9, offset 0x4c9 {value: 0x0014, lo: 0x8f, hi: 0x9f}, - // Block 0xea, offset 0x4cc + // Block 0xea, offset 0x4ca {value: 0x0014, lo: 0xa0, hi: 0xa0}, - // Block 0xeb, offset 0x4cd + // Block 0xeb, offset 0x4cb {value: 0x0010, lo: 0x80, hi: 0xaa}, {value: 0x0010, lo: 0xb0, hi: 0xbc}, - // Block 0xec, offset 0x4cf + // Block 0xec, offset 0x4cd {value: 0x0010, lo: 0x80, hi: 0x88}, {value: 0x0010, lo: 0x90, hi: 0x99}, {value: 0x0014, lo: 0x9d, hi: 0x9d}, {value: 0x0034, lo: 0x9e, hi: 0x9e}, {value: 0x0014, lo: 0xa0, hi: 0xa3}, - // Block 0xed, offset 0x4d4 + // Block 0xed, offset 0x4d2 {value: 0x0030, lo: 0xa5, hi: 0xa6}, {value: 0x0034, lo: 0xa7, hi: 0xa9}, {value: 0x0030, lo: 0xad, hi: 0xb2}, {value: 0x0014, lo: 0xb3, hi: 0xba}, {value: 0x0034, lo: 0xbb, hi: 0xbf}, - // Block 0xee, offset 0x4d9 + // Block 0xee, offset 0x4d7 {value: 0x0034, lo: 0x80, hi: 0x82}, {value: 0x0024, lo: 0x85, hi: 0x89}, {value: 0x0034, lo: 0x8a, hi: 0x8b}, {value: 0x0024, lo: 0xaa, hi: 0xad}, - // Block 0xef, offset 0x4dd + // Block 0xef, offset 0x4db {value: 0x0024, lo: 0x82, hi: 0x84}, - // Block 0xf0, offset 0x4de + // Block 0xf0, offset 0x4dc {value: 0x0013, lo: 0x80, hi: 0x99}, {value: 0x0012, lo: 0x9a, hi: 0xb3}, {value: 0x0013, lo: 0xb4, hi: 0xbf}, - // Block 0xf1, offset 0x4e1 + // Block 0xf1, offset 0x4df {value: 0x0013, lo: 0x80, hi: 0x8d}, {value: 0x0012, lo: 0x8e, hi: 0x94}, {value: 0x0012, lo: 0x96, hi: 0xa7}, {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0xf2, offset 0x4e5 + // Block 0xf2, offset 0x4e3 {value: 0x0013, lo: 0x80, hi: 0x81}, {value: 0x0012, lo: 0x82, hi: 0x9b}, {value: 0x0013, lo: 0x9c, hi: 0x9c}, @@ -2082,12 +2080,12 @@ var sparseValues = [1362]valueRange{ {value: 0x0012, lo: 0xb6, hi: 0xb9}, {value: 0x0012, lo: 0xbb, hi: 0xbb}, {value: 0x0012, lo: 0xbd, hi: 0xbf}, - // Block 0xf3, offset 0x4f0 + // Block 0xf3, offset 0x4ee {value: 0x0012, lo: 0x80, hi: 0x83}, {value: 0x0012, lo: 0x85, hi: 0x8f}, {value: 0x0013, lo: 0x90, hi: 0xa9}, {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0xf4, offset 0x4f4 + // Block 0xf4, offset 0x4f2 {value: 0x0012, lo: 0x80, hi: 0x83}, {value: 0x0013, lo: 0x84, hi: 0x85}, {value: 0x0013, lo: 0x87, hi: 0x8a}, @@ -2096,86 +2094,86 @@ var sparseValues = [1362]valueRange{ {value: 0x0012, lo: 0x9e, hi: 0xb7}, {value: 0x0013, lo: 0xb8, hi: 0xb9}, {value: 0x0013, lo: 0xbb, hi: 0xbe}, - // Block 0xf5, offset 0x4fc + // Block 0xf5, offset 0x4fa {value: 0x0013, lo: 0x80, hi: 0x84}, {value: 0x0013, lo: 0x86, hi: 0x86}, {value: 0x0013, lo: 0x8a, hi: 0x90}, {value: 0x0012, lo: 0x92, hi: 0xab}, {value: 0x0013, lo: 0xac, hi: 0xbf}, - // Block 0xf6, offset 0x501 + // Block 0xf6, offset 0x4ff {value: 0x0013, lo: 0x80, hi: 0x85}, {value: 0x0012, lo: 0x86, hi: 0x9f}, {value: 0x0013, lo: 0xa0, hi: 0xb9}, {value: 0x0012, lo: 0xba, hi: 0xbf}, - // Block 0xf7, offset 0x505 + // Block 0xf7, offset 0x503 {value: 0x0012, lo: 0x80, hi: 0x93}, {value: 0x0013, lo: 0x94, hi: 0xad}, {value: 0x0012, lo: 0xae, hi: 0xbf}, - // Block 0xf8, offset 0x508 + // Block 0xf8, offset 0x506 {value: 0x0012, lo: 0x80, hi: 0x87}, {value: 0x0013, lo: 0x88, hi: 0xa1}, {value: 0x0012, lo: 0xa2, hi: 0xbb}, {value: 0x0013, lo: 0xbc, hi: 0xbf}, - // Block 0xf9, offset 0x50c + // Block 0xf9, offset 0x50a {value: 0x0013, lo: 0x80, hi: 0x95}, {value: 0x0012, lo: 0x96, hi: 0xaf}, {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0xfa, offset 0x50f + // Block 0xfa, offset 0x50d {value: 0x0013, lo: 0x80, hi: 0x89}, {value: 0x0012, lo: 0x8a, hi: 0xa5}, {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0xfb, offset 0x512 + // Block 0xfb, offset 0x510 {value: 0x0013, lo: 0x80, hi: 0x80}, {value: 0x0012, lo: 0x82, hi: 0x9a}, {value: 0x0012, lo: 0x9c, hi: 0xa1}, {value: 0x0013, lo: 0xa2, hi: 0xba}, {value: 0x0012, lo: 0xbc, hi: 0xbf}, - // Block 0xfc, offset 0x517 + // Block 0xfc, offset 0x515 {value: 0x0012, lo: 0x80, hi: 0x94}, {value: 0x0012, lo: 0x96, hi: 0x9b}, {value: 0x0013, lo: 0x9c, hi: 0xb4}, {value: 0x0012, lo: 0xb6, hi: 0xbf}, - // Block 0xfd, offset 0x51b + // Block 0xfd, offset 0x519 {value: 0x0012, lo: 0x80, hi: 0x8e}, {value: 0x0012, lo: 0x90, hi: 0x95}, {value: 0x0013, lo: 0x96, hi: 0xae}, {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0xfe, offset 0x51f + // Block 0xfe, offset 0x51d {value: 0x0012, lo: 0x80, hi: 0x88}, {value: 0x0012, lo: 0x8a, hi: 0x8f}, {value: 0x0013, lo: 0x90, hi: 0xa8}, {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0xff, offset 0x523 + // Block 0xff, offset 0x521 {value: 0x0012, lo: 0x80, hi: 0x82}, {value: 0x0012, lo: 0x84, hi: 0x89}, {value: 0x0017, lo: 0x8a, hi: 0x8b}, {value: 0x0010, lo: 0x8e, hi: 0xbf}, - // Block 0x100, offset 0x527 + // Block 0x100, offset 0x525 {value: 0x0014, lo: 0x80, hi: 0xb6}, {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x101, offset 0x529 + // Block 0x101, offset 0x527 {value: 0x0014, lo: 0x80, hi: 0xac}, {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x102, offset 0x52b + // Block 0x102, offset 0x529 {value: 0x0014, lo: 0x84, hi: 0x84}, {value: 0x0014, lo: 0x9b, hi: 0x9f}, {value: 0x0014, lo: 0xa1, hi: 0xaf}, - // Block 0x103, offset 0x52e + // Block 0x103, offset 0x52c {value: 0x0024, lo: 0x80, hi: 0x86}, {value: 0x0024, lo: 0x88, hi: 0x98}, {value: 0x0024, lo: 0x9b, hi: 0xa1}, {value: 0x0024, lo: 0xa3, hi: 0xa4}, {value: 0x0024, lo: 0xa6, hi: 0xaa}, - // Block 0x104, offset 0x533 + // Block 0x104, offset 0x531 {value: 0x0010, lo: 0x80, hi: 0x84}, {value: 0x0034, lo: 0x90, hi: 0x96}, - // Block 0x105, offset 0x535 + // Block 0x105, offset 0x533 {value: 0xb552, lo: 0x80, hi: 0x81}, {value: 0xb852, lo: 0x82, hi: 0x83}, {value: 0x0024, lo: 0x84, hi: 0x89}, {value: 0x0034, lo: 0x8a, hi: 0x8a}, {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x106, offset 0x53a + // Block 0x106, offset 0x538 {value: 0x0010, lo: 0x80, hi: 0x83}, {value: 0x0010, lo: 0x85, hi: 0x9f}, {value: 0x0010, lo: 0xa1, hi: 0xa2}, @@ -2185,29 +2183,29 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0xb4, hi: 0xb7}, {value: 0x0010, lo: 0xb9, hi: 0xb9}, {value: 0x0010, lo: 0xbb, hi: 0xbb}, - // Block 0x107, offset 0x543 + // Block 0x107, offset 0x541 {value: 0x0010, lo: 0x80, hi: 0x89}, {value: 0x0010, lo: 0x8b, hi: 0x9b}, {value: 0x0010, lo: 0xa1, hi: 0xa3}, {value: 0x0010, lo: 0xa5, hi: 0xa9}, {value: 0x0010, lo: 0xab, hi: 0xbb}, - // Block 0x108, offset 0x548 + // Block 0x108, offset 0x546 {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x109, offset 0x549 + // Block 0x109, offset 0x547 {value: 0x0013, lo: 0x80, hi: 0x89}, {value: 0x0013, lo: 0x90, hi: 0xa9}, {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x10a, offset 0x54c + // Block 0x10a, offset 0x54a {value: 0x0013, lo: 0x80, hi: 0x89}, - // Block 0x10b, offset 0x54d + // Block 0x10b, offset 0x54b {value: 0x0004, lo: 0xbb, hi: 0xbf}, - // Block 0x10c, offset 0x54e + // Block 0x10c, offset 0x54c {value: 0x0014, lo: 0x81, hi: 0x81}, {value: 0x0014, lo: 0xa0, hi: 0xbf}, - // Block 0x10d, offset 0x550 + // Block 0x10d, offset 0x54e {value: 0x0014, lo: 0x80, hi: 0xbf}, - // Block 0x10e, offset 0x551 + // Block 0x10e, offset 0x54f {value: 0x0014, lo: 0x80, hi: 0xaf}, } -// Total table size 13819 bytes (13KiB); checksum: 4CC48DA3 +// Total table size 13811 bytes (13KiB); checksum: 4CC48DA3 diff --git a/vendor/golang.org/x/text/cases/trieval.go b/vendor/golang.org/x/text/cases/trieval.go index 7f2aa5b01b5..fb221f843f4 100644 --- a/vendor/golang.org/x/text/cases/trieval.go +++ b/vendor/golang.org/x/text/cases/trieval.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package cases @@ -22,6 +22,7 @@ package cases // Only 13..8 are used for XOR patterns. // 7 inverseFold (fold to upper, not to lower) // 6 index: interpret the XOR pattern as an index +// or isMid if case mode is cIgnorableUncased. // 5..4 CCC: zero (normal or break), above or other // } // 3 exception: interpret this value as an exception index @@ -44,6 +45,7 @@ const ( ignorableValue = 0x0004 inverseFoldBit = 1 << 7 + isMidBit = 1 << 6 exceptionBit = 1 << 3 exceptionShift = 5 @@ -53,7 +55,7 @@ const ( xorShift = 8 // There is no mapping if all xor bits and the exception bit are zero. - hasMappingMask = 0xffc0 | exceptionBit + hasMappingMask = 0xff80 | exceptionBit ) // The case mode bits encodes the case type of a rune. This includes uncased, @@ -91,10 +93,6 @@ func (c info) isCaseIgnorable() bool { return c&ignorableMask == ignorableValue } -func (c info) isCaseIgnorableAndNonBreakStarter() bool { - return c&(fullCasedMask|cccMask) == (ignorableValue | cccZero) -} - func (c info) isNotCasedAndNotCaseIgnorable() bool { return c&fullCasedMask == 0 } @@ -103,6 +101,10 @@ func (c info) isCaseIgnorableAndNotCased() bool { return c&fullCasedMask == cIgnorableUncased } +func (c info) isMid() bool { + return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased +} + // The case mapping implementation will need to know about various Canonical // Combining Class (CCC) values. We encode two of these in the trie value: // cccZero (0) and cccAbove (230). If the value is cccOther, it means that diff --git a/vendor/golang.org/x/text/encoding/encoding.go b/vendor/golang.org/x/text/encoding/encoding.go index 47fcd1fb16c..abc2c9ad15b 100644 --- a/vendor/golang.org/x/text/encoding/encoding.go +++ b/vendor/golang.org/x/text/encoding/encoding.go @@ -52,7 +52,7 @@ type Decoder struct { } // Bytes converts the given encoded bytes to UTF-8. It returns the converted -// bytes or 0, err if any error occurred. +// bytes or nil, err if any error occurred. func (d *Decoder) Bytes(b []byte) ([]byte, error) { b, _, err := transform.Bytes(d, b) if err != nil { @@ -62,7 +62,7 @@ func (d *Decoder) Bytes(b []byte) ([]byte, error) { } // String converts the given encoded string to UTF-8. It returns the converted -// string or 0, err if any error occurred. +// string or "", err if any error occurred. func (d *Decoder) String(s string) (string, error) { s, _, err := transform.String(d, s) if err != nil { @@ -95,7 +95,7 @@ type Encoder struct { _ struct{} } -// Bytes converts bytes from UTF-8. It returns the converted bytes or 0, err if +// Bytes converts bytes from UTF-8. It returns the converted bytes or nil, err if // any error occurred. func (e *Encoder) Bytes(b []byte) ([]byte, error) { b, _, err := transform.Bytes(e, b) @@ -106,7 +106,7 @@ func (e *Encoder) Bytes(b []byte) ([]byte, error) { } // String converts a string from UTF-8. It returns the converted string or -// 0, err if any error occurred. +// "", err if any error occurred. func (e *Encoder) String(s string) (string, error) { s, _, err := transform.String(e, s) if err != nil { diff --git a/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go b/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go index 2a2da0ef253..7351b4ef8af 100644 --- a/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go +++ b/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go @@ -36,8 +36,8 @@ package identifier // - http://www.ietf.org/rfc/rfc2978.txt // - http://www.unicode.org/reports/tr22/ // - http://www.w3.org/TR/encoding/ -// - http://www.w3.org/TR/encoding/indexes/encodings.json // - https://encoding.spec.whatwg.org/ +// - https://encoding.spec.whatwg.org/encodings.json // - https://tools.ietf.org/html/rfc6657#section-5 // Interface can be implemented by Encodings to define the CCS or CES for which diff --git a/vendor/golang.org/x/text/encoding/internal/identifier/mib.go b/vendor/golang.org/x/text/encoding/internal/identifier/mib.go index 915abfa2973..768842b0a5a 100644 --- a/vendor/golang.org/x/text/encoding/internal/identifier/mib.go +++ b/vendor/golang.org/x/text/encoding/internal/identifier/mib.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package identifier diff --git a/vendor/golang.org/x/text/internal/BUILD b/vendor/golang.org/x/text/internal/BUILD new file mode 100644 index 00000000000..b6e1fe2f8c7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/BUILD @@ -0,0 +1,30 @@ +load("@io_bazel_rules_go//go:def.bzl", "go_library") + +go_library( + name = "go_default_library", + srcs = [ + "internal.go", + "match.go", + "tables.go", + ], + visibility = ["//visibility:public"], + deps = ["//vendor/golang.org/x/text/language:go_default_library"], +) + +filegroup( + name = "package-srcs", + srcs = glob(["**"]), + tags = ["automanaged"], + visibility = ["//visibility:private"], +) + +filegroup( + name = "all-srcs", + srcs = [ + ":package-srcs", + "//vendor/golang.org/x/text/internal/tag:all-srcs", + "//vendor/golang.org/x/text/internal/utf8internal:all-srcs", + ], + tags = ["automanaged"], + visibility = ["//visibility:public"], +) diff --git a/vendor/golang.org/x/text/internal/gen.go b/vendor/golang.org/x/text/internal/gen.go new file mode 100644 index 00000000000..1d678af5740 --- /dev/null +++ b/vendor/golang.org/x/text/internal/gen.go @@ -0,0 +1,52 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +import ( + "log" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/language" + "golang.org/x/text/unicode/cldr" +) + +func main() { + r := gen.OpenCLDRCoreZip() + defer r.Close() + + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + if err != nil { + log.Fatalf("DecodeZip: %v", err) + } + + w := gen.NewCodeWriter() + defer w.WriteGoFile("tables.go", "internal") + + // Create parents table. + parents := make([]uint16, language.NumCompactTags) + for _, loc := range data.Locales() { + tag := language.MustParse(loc) + index, ok := language.CompactIndex(tag) + if !ok { + continue + } + parentIndex := 0 // und + for p := tag.Parent(); p != language.Und; p = p.Parent() { + if x, ok := language.CompactIndex(p); ok { + parentIndex = x + break + } + } + parents[index] = uint16(parentIndex) + } + + w.WriteComment(` + Parent maps a compact index of a tag to the compact index of the parent of + this tag.`) + w.WriteVar("Parent", parents) +} diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go new file mode 100644 index 00000000000..b39dc212245 --- /dev/null +++ b/vendor/golang.org/x/text/internal/internal.go @@ -0,0 +1,51 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go + +// Package internal contains non-exported functionality that are used by +// packages in the text repository. +package internal + +import ( + "sort" + + "golang.org/x/text/language" +) + +// SortTags sorts tags in place. +func SortTags(tags []language.Tag) { + sort.Sort(sorter(tags)) +} + +type sorter []language.Tag + +func (s sorter) Len() int { + return len(s) +} + +func (s sorter) Swap(i, j int) { + s[i], s[j] = s[j], s[i] +} + +func (s sorter) Less(i, j int) bool { + return s[i].String() < s[j].String() +} + +// UniqueTags sorts and filters duplicate tags in place and returns a slice with +// only unique tags. +func UniqueTags(tags []language.Tag) []language.Tag { + if len(tags) <= 1 { + return tags + } + SortTags(tags) + k := 0 + for i := 1; i < len(tags); i++ { + if tags[k].String() < tags[i].String() { + k++ + tags[k] = tags[i] + } + } + return tags[:k+1] +} diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go new file mode 100644 index 00000000000..a67fcaca13f --- /dev/null +++ b/vendor/golang.org/x/text/internal/match.go @@ -0,0 +1,67 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package internal + +// This file contains matchers that implement CLDR inheritance. +// +// See http://unicode.org/reports/tr35/#Locale_Inheritance. +// +// Some of the inheritance described in this document is already handled by +// the cldr package. + +import ( + "golang.org/x/text/language" +) + +// TODO: consider if (some of the) matching algorithm needs to be public after +// getting some feel about what is generic and what is specific. + +// NewInheritanceMatcher returns a matcher that matches based on the inheritance +// chain. +// +// The matcher uses canonicalization and the parent relationship to find a +// match. The resulting match will always be either Und or a language with the +// same language and script as the requested language. It will not match +// languages for which there is understood to be mutual or one-directional +// intelligibility. +// +// A Match will indicate an Exact match if the language matches after +// canonicalization and High if the matched tag is a parent. +func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { + tags := &InheritanceMatcher{make(map[language.Tag]int)} + for i, tag := range t { + ct, err := language.All.Canonicalize(tag) + if err != nil { + ct = tag + } + tags.index[ct] = i + } + return tags +} + +type InheritanceMatcher struct { + index map[language.Tag]int +} + +func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { + for _, t := range want { + ct, err := language.All.Canonicalize(t) + if err != nil { + ct = t + } + conf := language.Exact + for { + if index, ok := m.index[ct]; ok { + return ct, index, conf + } + if ct == language.Und { + break + } + ct = ct.Parent() + conf = language.High + } + } + return language.Und, 0, language.No +} diff --git a/vendor/golang.org/x/text/internal/tables.go b/vendor/golang.org/x/text/internal/tables.go new file mode 100644 index 00000000000..a53042aab3e --- /dev/null +++ b/vendor/golang.org/x/text/internal/tables.go @@ -0,0 +1,117 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package internal + +// Parent maps a compact index of a tag to the compact index of the parent of +// this tag. +var Parent = []uint16{ // 754 elements + // Entry 0 - 3F + 0x0000, 0x0053, 0x00e5, 0x0000, 0x0003, 0x0003, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x0000, 0x000c, 0x000c, 0x000c, + 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, + 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, + 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, + 0x000c, 0x0000, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x002e, + 0x0000, 0x0000, 0x0031, 0x0030, 0x0030, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x003d, 0x0000, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0000, 0x0042, 0x0042, 0x0000, 0x0045, 0x0045, + 0x0000, 0x0048, 0x0000, 0x004a, 0x0000, 0x0000, 0x004d, 0x004c, + 0x004c, 0x0000, 0x0051, 0x0051, 0x0051, 0x0051, 0x0000, 0x0056, + 0x0000, 0x0058, 0x0000, 0x005a, 0x0000, 0x005c, 0x005c, 0x0000, + 0x005f, 0x0000, 0x0061, 0x0000, 0x0063, 0x0000, 0x0065, 0x0065, + 0x0000, 0x0068, 0x0000, 0x006a, 0x006a, 0x006a, 0x006a, 0x006a, + 0x006a, 0x006a, 0x0000, 0x0072, 0x0000, 0x0074, 0x0000, 0x0076, + 0x0000, 0x0000, 0x0079, 0x0000, 0x007b, 0x0000, 0x007d, 0x0000, + // Entry 80 - BF + 0x007f, 0x007f, 0x0000, 0x0082, 0x0082, 0x0000, 0x0085, 0x0086, + 0x0086, 0x0086, 0x0085, 0x0087, 0x0086, 0x0086, 0x0086, 0x0085, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0087, 0x0086, + 0x0086, 0x0086, 0x0086, 0x0087, 0x0086, 0x0087, 0x0086, 0x0086, + 0x0087, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, + 0x0086, 0x0086, 0x0085, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0085, 0x0086, 0x0085, 0x0086, + // Entry C0 - FF + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0087, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0085, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0087, 0x0086, 0x0086, + 0x0087, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0085, 0x0085, 0x0086, 0x0086, + 0x0085, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0000, 0x00ee, + 0x0000, 0x00f0, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f1, + 0x00f1, 0x00f1, 0x00f1, 0x00f0, 0x00f1, 0x00f0, 0x00f0, 0x00f1, + // Entry 100 - 13F + 0x00f1, 0x00f0, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f0, 0x00f1, + 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x0000, 0x010d, 0x0000, + 0x010f, 0x0000, 0x0111, 0x0000, 0x0113, 0x0113, 0x0000, 0x0116, + 0x0116, 0x0116, 0x0116, 0x0000, 0x011b, 0x0000, 0x011d, 0x0000, + 0x011f, 0x011f, 0x0000, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, + 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, + 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, + 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, + // Entry 140 - 17F + 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, + 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, + 0x0122, 0x0000, 0x0151, 0x0000, 0x0153, 0x0000, 0x0155, 0x0000, + 0x0157, 0x0000, 0x0159, 0x0000, 0x015b, 0x015b, 0x015b, 0x0000, + 0x015f, 0x0000, 0x0000, 0x0162, 0x0000, 0x0164, 0x0000, 0x0166, + 0x0166, 0x0166, 0x0000, 0x016a, 0x0000, 0x016c, 0x0000, 0x016e, + 0x0000, 0x0170, 0x0170, 0x0000, 0x0173, 0x0000, 0x0175, 0x0000, + 0x0177, 0x0000, 0x0179, 0x0000, 0x017b, 0x0000, 0x017d, 0x0000, + // Entry 180 - 1BF + 0x017f, 0x0000, 0x0181, 0x0181, 0x0181, 0x0181, 0x0000, 0x0000, + 0x0187, 0x0000, 0x0000, 0x018a, 0x0000, 0x018c, 0x0000, 0x0000, + 0x018f, 0x0000, 0x0191, 0x0000, 0x0000, 0x0194, 0x0000, 0x0000, + 0x0197, 0x0000, 0x0199, 0x0000, 0x019b, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x01ab, 0x0000, 0x01ae, + 0x0000, 0x01b0, 0x0000, 0x01b2, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x0000, 0x01b9, 0x0000, 0x01bb, 0x0000, 0x01bd, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x01c5, + 0x01c5, 0x01c5, 0x0000, 0x01ca, 0x0000, 0x01cc, 0x01cc, 0x0000, + 0x01cf, 0x0000, 0x01d1, 0x0000, 0x01d3, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x01d9, 0x0000, 0x01dc, 0x0000, 0x01de, + 0x0000, 0x01e0, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x01ee, 0x01ee, 0x0000, 0x01f2, 0x0000, 0x01f4, 0x0000, 0x01f6, + 0x0000, 0x01f8, 0x0000, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x01fd, + // Entry 200 - 23F + 0x0000, 0x0200, 0x0000, 0x0202, 0x0202, 0x0000, 0x0205, 0x0205, + 0x0000, 0x0208, 0x0208, 0x0208, 0x0208, 0x0208, 0x0208, 0x0208, + 0x0000, 0x0210, 0x0000, 0x0212, 0x0000, 0x0214, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x021a, 0x0000, 0x0000, 0x021d, 0x0000, + 0x021f, 0x021f, 0x0000, 0x0222, 0x0000, 0x0224, 0x0224, 0x0000, + 0x0000, 0x0228, 0x0227, 0x0227, 0x0000, 0x0000, 0x022d, 0x0000, + 0x022f, 0x0000, 0x0231, 0x0000, 0x023d, 0x0233, 0x023d, 0x023d, + 0x023d, 0x023d, 0x023d, 0x023d, 0x023d, 0x0233, 0x023d, 0x023d, + // Entry 240 - 27F + 0x0000, 0x0240, 0x0240, 0x0240, 0x0000, 0x0244, 0x0000, 0x0246, + 0x0000, 0x0248, 0x0248, 0x0000, 0x024b, 0x0000, 0x024d, 0x024d, + 0x024d, 0x024d, 0x024d, 0x024d, 0x0000, 0x0254, 0x0000, 0x0256, + 0x0000, 0x0258, 0x0000, 0x025a, 0x0000, 0x025c, 0x0000, 0x0000, + 0x025f, 0x025f, 0x025f, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0267, 0x0000, 0x0000, 0x026a, 0x0269, 0x0269, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0272, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0277, 0x0000, 0x0000, 0x027a, 0x0000, 0x027c, 0x027c, 0x027c, + // Entry 280 - 2BF + 0x027c, 0x0000, 0x0281, 0x0281, 0x0281, 0x0000, 0x0285, 0x0285, + 0x0285, 0x0285, 0x0285, 0x0000, 0x028b, 0x028b, 0x028b, 0x028b, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0293, 0x0293, 0x0293, 0x0000, + 0x0297, 0x0297, 0x0297, 0x0297, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x029d, 0x0000, 0x02a2, 0x0000, 0x02a4, 0x02a4, 0x0000, + 0x02a7, 0x0000, 0x02a9, 0x02a9, 0x0000, 0x0000, 0x02ad, 0x0000, + 0x0000, 0x02b0, 0x0000, 0x02b2, 0x02b2, 0x0000, 0x0000, 0x02b6, + 0x0000, 0x02b8, 0x0000, 0x02ba, 0x0000, 0x02bc, 0x0000, 0x02be, + // Entry 2C0 - 2FF + 0x02be, 0x0000, 0x0000, 0x02c2, 0x0000, 0x02c4, 0x02c1, 0x02c1, + 0x0000, 0x0000, 0x02c9, 0x02c8, 0x02c8, 0x0000, 0x0000, 0x02ce, + 0x0000, 0x02d0, 0x0000, 0x02d2, 0x0000, 0x0000, 0x02d5, 0x0000, + 0x0000, 0x0000, 0x02d9, 0x0000, 0x02db, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x02df, 0x0000, 0x02e2, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x02e6, 0x02e6, 0x02e6, 0x02e6, 0x0000, 0x02ec, 0x02ed, 0x02ec, + 0x0000, 0x02f0, +} // Size: 1532 bytes + +// Total table size 1532 bytes (1KiB); checksum: 90718A2 diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/language/common.go index a255bb0a502..9d86e185543 100644 --- a/vendor/golang.org/x/text/language/common.go +++ b/vendor/golang.org/x/text/language/common.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package language diff --git a/vendor/golang.org/x/text/language/maketables.go b/vendor/golang.org/x/text/language/gen.go similarity index 91% rename from vendor/golang.org/x/text/language/maketables.go rename to vendor/golang.org/x/text/language/gen.go index 2cc995b379e..153269bc100 100644 --- a/vendor/golang.org/x/text/language/maketables.go +++ b/vendor/golang.org/x/text/language/gen.go @@ -678,6 +678,8 @@ func (b *builder) parseIndices() { b.locale.parse(meta.DefaultContent.Locales) } +// TODO: region inclusion data will probably not be use used in future matchers. + func (b *builder) computeRegionGroups() { b.groups = make(map[int]index) @@ -686,6 +688,11 @@ func (b *builder) computeRegionGroups() { b.groups[i] = index(len(b.groups)) } for _, g := range b.supp.TerritoryContainment.Group { + // Skip UN and EURO zone as they are flattening the containment + // relationship. + if g.Type == "EZ" || g.Type == "UN" { + continue + } group := b.region.index(g.Type) if _, ok := b.groups[group]; !ok { b.groups[group] = index(len(b.groups)) @@ -782,6 +789,7 @@ func (b *builder) writeLanguage() { lang.updateLater("tw", "twi") lang.updateLater("nb", "nob") lang.updateLater("ak", "aka") + lang.updateLater("bh", "bih") // Ensure that each 2-letter code is matched with a 3-letter code. for _, v := range lang.s[1:] { @@ -798,10 +806,10 @@ func (b *builder) writeLanguage() { } } - // Complete canonialized language tags. + // Complete canonicalized language tags. lang.freeze() for i, v := range lang.s { - // We can avoid these manual entries by using the IANI registry directly. + // We can avoid these manual entries by using the IANA registry directly. // Seems easier to update the list manually, as changes are rare. // The panic in this loop will trigger if we miss an entry. add := "" @@ -908,7 +916,7 @@ func (b *builder) writeRegion() { i := b.region.index(s) for _, d := range e.description { if strings.Contains(d, "Private use") { - regionTypes[i] = iso3166UserAssgined + regionTypes[i] = iso3166UserAssigned } } regionTypes[i] |= bcp47Region @@ -1065,7 +1073,7 @@ const ( ) const ( - iso3166UserAssgined = 1 << iota + iso3166UserAssigned = 1 << iota ccTLD bcp47Region ) @@ -1355,42 +1363,23 @@ func (b *builder) writeLikelyData() { type mutualIntelligibility struct { want, have uint16 - conf uint8 + distance uint8 oneway bool } type scriptIntelligibility struct { - lang uint16 // langID or 0 if * - want, have uint8 - conf uint8 + wantLang, haveLang uint16 + wantScript, haveScript uint8 + distance uint8 + // Always oneway } -type sortByConf []mutualIntelligibility - -func (l sortByConf) Less(a, b int) bool { - return l[a].conf > l[b].conf -} - -func (l sortByConf) Swap(a, b int) { - l[a], l[b] = l[b], l[a] -} - -func (l sortByConf) Len() int { - return len(l) -} - -// toConf converts a percentage value [0, 100] to a confidence class. -func toConf(pct uint8) uint8 { - switch { - case pct == 100: - return 3 // Exact - case pct >= 90: - return 2 // High - case pct > 50: - return 1 // Low - default: - return 0 // No - } +type regionIntelligibility struct { + lang uint16 // compact language id + script uint8 // 0 means any + group uint8 // 0 means any; if bit 7 is set it means inverse + distance uint8 + // Always twoway. } // writeMatchData writes tables with languages and scripts for which there is @@ -1400,13 +1389,50 @@ func toConf(pct uint8) uint8 { // We also drop all region-related data as we use a different algorithm to // determine region equivalence. func (b *builder) writeMatchData() { + lm := b.supp.LanguageMatching.LanguageMatches + cldr.MakeSlice(&lm).SelectAnyOf("type", "written_new") + + regionHierarchy := map[string][]string{} + for _, g := range b.supp.TerritoryContainment.Group { + regions := strings.Split(g.Contains, " ") + regionHierarchy[g.Type] = append(regionHierarchy[g.Type], regions...) + } + regionToGroups := make([]uint8, len(b.region.s)) + + idToIndex := map[string]uint8{} + for i, mv := range lm[0].MatchVariable { + if i > 6 { + log.Fatalf("Too many groups: %d", i) + } + idToIndex[mv.Id] = uint8(i + 1) + // TODO: also handle '-' + for _, r := range strings.Split(mv.Value, "+") { + todo := []string{r} + for k := 0; k < len(todo); k++ { + r := todo[k] + regionToGroups[b.region.index(r)] |= 1 << uint8(i) + todo = append(todo, regionHierarchy[r]...) + } + } + } + b.writeSlice("regionToGroups", regionToGroups) + b.writeType(mutualIntelligibility{}) b.writeType(scriptIntelligibility{}) - lm := b.supp.LanguageMatching.LanguageMatches - cldr.MakeSlice(&lm).SelectAnyOf("type", "written") + b.writeType(regionIntelligibility{}) - matchLang := []mutualIntelligibility{} + matchLang := []mutualIntelligibility{{ + // TODO: remove once CLDR is fixed. + want: uint16(b.langIndex("sr")), + have: uint16(b.langIndex("hr")), + distance: uint8(5), + }, { + want: uint16(b.langIndex("sr")), + have: uint16(b.langIndex("bs")), + distance: uint8(5), + }} matchScript := []scriptIntelligibility{} + matchRegion := []regionIntelligibility{} // Convert the languageMatch entries in lists keyed by desired language. for _, m := range lm[0].LanguageMatch { // Different versions of CLDR use different separators. @@ -1414,33 +1440,38 @@ func (b *builder) writeMatchData() { supported := strings.Replace(m.Supported, "-", "_", -1) d := strings.Split(desired, "_") s := strings.Split(supported, "_") - if len(d) != len(s) || len(d) > 2 { - // Skip all entries with regions and work around CLDR bug. + if len(d) != len(s) { + log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) continue } - pct, _ := strconv.ParseInt(m.Percent, 10, 8) - if len(d) == 2 && d[0] == s[0] && len(d[1]) == 4 { - // language-script pair. - lang := uint16(0) - if d[0] != "*" { - lang = uint16(b.langIndex(d[0])) + distance, _ := strconv.ParseInt(m.Distance, 10, 8) + switch len(d) { + case 2: + if desired == supported && desired == "*_*" { + continue } + // language-script pair. matchScript = append(matchScript, scriptIntelligibility{ - lang: lang, - want: uint8(b.script.index(d[1])), - have: uint8(b.script.index(s[1])), - conf: toConf(uint8(pct)), + wantLang: uint16(b.langIndex(d[0])), + haveLang: uint16(b.langIndex(s[0])), + wantScript: uint8(b.script.index(d[1])), + haveScript: uint8(b.script.index(s[1])), + distance: uint8(distance), }) if m.Oneway != "true" { matchScript = append(matchScript, scriptIntelligibility{ - lang: lang, - want: uint8(b.script.index(s[1])), - have: uint8(b.script.index(d[1])), - conf: toConf(uint8(pct)), + wantLang: uint16(b.langIndex(s[0])), + haveLang: uint16(b.langIndex(d[0])), + wantScript: uint8(b.script.index(s[1])), + haveScript: uint8(b.script.index(d[1])), + distance: uint8(distance), }) } - } else if len(d) == 1 && d[0] != "*" { - if pct == 100 { + case 1: + if desired == supported && desired == "*" { + continue + } + if distance == 1 { // nb == no is already handled by macro mapping. Check there // really is only this case. if d[0] != "no" || s[0] != "nb" { @@ -1448,28 +1479,57 @@ func (b *builder) writeMatchData() { } continue } + // TODO: consider dropping oneway field and just doubling the entry. matchLang = append(matchLang, mutualIntelligibility{ - want: uint16(b.langIndex(d[0])), - have: uint16(b.langIndex(s[0])), - conf: uint8(pct), - oneway: m.Oneway == "true", + want: uint16(b.langIndex(d[0])), + have: uint16(b.langIndex(s[0])), + distance: uint8(distance), + oneway: m.Oneway == "true", }) - } else { - // TODO: Handle other mappings. - a := []string{"*;*", "*_*;*_*", "es_MX;es_419"} - s := strings.Join([]string{desired, supported}, ";") - if i := sort.SearchStrings(a, s); i == len(a) || a[i] != s { - log.Printf("%q not handled", s) + case 3: + if desired == supported && desired == "*_*_*" { + continue } + if desired != supported { // (Weird but correct.) + log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) + continue + } + ri := regionIntelligibility{ + lang: b.langIndex(d[0]), + distance: uint8(distance), + } + if d[1] != "*" { + ri.script = uint8(b.script.index(d[1])) + } + switch { + case d[2] == "*": + ri.group = 0x80 // not contained in anything + case strings.HasPrefix(d[2], "$!"): + ri.group = 0x80 + d[2] = "$" + d[2][len("$!"):] + fallthrough + case strings.HasPrefix(d[2], "$"): + ri.group |= idToIndex[d[2]] + } + matchRegion = append(matchRegion, ri) + default: + log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) } } - sort.Stable(sortByConf(matchLang)) - // collapse percentage into confidence classes - for i, m := range matchLang { - matchLang[i].conf = toConf(m.conf) - } + sort.SliceStable(matchLang, func(i, j int) bool { + return matchLang[i].distance < matchLang[j].distance + }) b.writeSlice("matchLang", matchLang) + + sort.SliceStable(matchScript, func(i, j int) bool { + return matchScript[i].distance < matchScript[j].distance + }) b.writeSlice("matchScript", matchScript) + + sort.SliceStable(matchRegion, func(i, j int) bool { + return matchRegion[i].distance < matchRegion[j].distance + }) + b.writeSlice("matchRegion", matchRegion) } func (b *builder) writeRegionInclusionData() { @@ -1482,6 +1542,11 @@ func (b *builder) writeRegionInclusionData() { containment = make(map[index][]index) ) for _, g := range b.supp.TerritoryContainment.Group { + // Skip UN and EURO zone as they are flattening the containment + // relationship. + if g.Type == "EZ" || g.Type == "UN" { + continue + } group := b.region.index(g.Type) groupIdx := b.groups[group] for _, mem := range strings.Split(g.Contains, " ") { @@ -1508,7 +1573,6 @@ func (b *builder) writeRegionInclusionData() { for _, v := range l { regionContainment[g] |= 1 << v } - // log.Printf("%d: %X", g, regionContainment[g]) } b.writeSlice("regionContainment", regionContainment) diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go index 7fa9cc82d1d..973db9fd54f 100644 --- a/vendor/golang.org/x/text/language/index.go +++ b/vendor/golang.org/x/text/language/index.go @@ -1,762 +1,769 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package language // NumCompactTags is the number of common tags. The maximum tag is // NumCompactTags-1. -const NumCompactTags = 747 +const NumCompactTags = 754 var specialTags = []Tag{ // 2 elements - 0: {lang: 0x61, region: 0x6d, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"}, - 1: {lang: 0x9b, region: 0x132, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"}, + 0: {lang: 0xd7, region: 0x6d, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"}, + 1: {lang: 0x138, region: 0x134, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"}, } // Size: 72 bytes var coreTags = map[uint32]uint16{ 0x0: 0, // und - 0x00a00000: 3, // af - 0x00a000d0: 4, // af-NA - 0x00a0015e: 5, // af-ZA - 0x00b00000: 6, // agq - 0x00b00051: 7, // agq-CM - 0x00d00000: 8, // ak - 0x00d0007e: 9, // ak-GH - 0x01100000: 10, // am - 0x0110006e: 11, // am-ET - 0x01500000: 12, // ar - 0x01500001: 13, // ar-001 - 0x01500022: 14, // ar-AE - 0x01500038: 15, // ar-BH - 0x01500061: 16, // ar-DJ - 0x01500066: 17, // ar-DZ - 0x0150006a: 18, // ar-EG - 0x0150006b: 19, // ar-EH - 0x0150006c: 20, // ar-ER - 0x01500095: 21, // ar-IL - 0x01500099: 22, // ar-IQ - 0x0150009f: 23, // ar-JO - 0x015000a6: 24, // ar-KM - 0x015000aa: 25, // ar-KW - 0x015000ae: 26, // ar-LB - 0x015000b7: 27, // ar-LY - 0x015000b8: 28, // ar-MA - 0x015000c7: 29, // ar-MR - 0x015000df: 30, // ar-OM - 0x015000eb: 31, // ar-PS - 0x015000f1: 32, // ar-QA - 0x01500106: 33, // ar-SA - 0x01500109: 34, // ar-SD - 0x01500113: 35, // ar-SO - 0x01500115: 36, // ar-SS - 0x0150011a: 37, // ar-SY - 0x0150011e: 38, // ar-TD - 0x01500126: 39, // ar-TN - 0x0150015b: 40, // ar-YE - 0x01c00000: 41, // as - 0x01c00097: 42, // as-IN - 0x01d00000: 43, // asa - 0x01d0012d: 44, // asa-TZ - 0x01f00000: 45, // ast - 0x01f0006d: 46, // ast-ES - 0x02400000: 47, // az - 0x0241e000: 48, // az-Cyrl - 0x0241e031: 49, // az-Cyrl-AZ - 0x02452000: 50, // az-Latn - 0x02452031: 51, // az-Latn-AZ - 0x02a00000: 52, // bas - 0x02a00051: 53, // bas-CM - 0x02f00000: 54, // be - 0x02f00046: 55, // be-BY - 0x03100000: 56, // bem - 0x0310015f: 57, // bem-ZM - 0x03300000: 58, // bez - 0x0330012d: 59, // bez-TZ - 0x03800000: 60, // bg - 0x03800037: 61, // bg-BG - 0x03c00000: 62, // bh - 0x04900000: 63, // bm - 0x049000c1: 64, // bm-ML - 0x04b00000: 65, // bn - 0x04b00034: 66, // bn-BD - 0x04b00097: 67, // bn-IN - 0x04c00000: 68, // bo - 0x04c00052: 69, // bo-CN - 0x04c00097: 70, // bo-IN - 0x05000000: 71, // br - 0x05000076: 72, // br-FR - 0x05300000: 73, // brx - 0x05300097: 74, // brx-IN - 0x05400000: 75, // bs - 0x0541e000: 76, // bs-Cyrl - 0x0541e032: 77, // bs-Cyrl-BA - 0x05452000: 78, // bs-Latn - 0x05452032: 79, // bs-Latn-BA - 0x06100000: 80, // ca - 0x06100021: 81, // ca-AD - 0x0610006d: 82, // ca-ES - 0x06100076: 83, // ca-FR - 0x0610009c: 84, // ca-IT - 0x06400000: 85, // ce - 0x06400104: 86, // ce-RU - 0x06600000: 87, // cgg - 0x0660012f: 88, // cgg-UG - 0x06c00000: 89, // chr - 0x06c00132: 90, // chr-US - 0x06f00000: 91, // ckb - 0x06f00099: 92, // ckb-IQ - 0x06f0009a: 93, // ckb-IR - 0x07900000: 94, // cs - 0x0790005d: 95, // cs-CZ - 0x07d00000: 96, // cu - 0x07d00104: 97, // cu-RU - 0x07f00000: 98, // cy - 0x07f00079: 99, // cy-GB - 0x08000000: 100, // da - 0x08000062: 101, // da-DK - 0x08000080: 102, // da-GL - 0x08300000: 103, // dav - 0x083000a2: 104, // dav-KE - 0x08500000: 105, // de - 0x0850002d: 106, // de-AT - 0x08500035: 107, // de-BE - 0x0850004d: 108, // de-CH - 0x0850005f: 109, // de-DE - 0x085000b0: 110, // de-LI - 0x085000b5: 111, // de-LU - 0x08800000: 112, // dje - 0x088000d2: 113, // dje-NE - 0x08b00000: 114, // dsb - 0x08b0005f: 115, // dsb-DE - 0x08f00000: 116, // dua - 0x08f00051: 117, // dua-CM - 0x09000000: 118, // dv - 0x09100000: 119, // dyo - 0x09100112: 120, // dyo-SN - 0x09300000: 121, // dz - 0x09300042: 122, // dz-BT - 0x09400000: 123, // ebu - 0x094000a2: 124, // ebu-KE - 0x09500000: 125, // ee - 0x0950007e: 126, // ee-GH - 0x09500120: 127, // ee-TG - 0x09a00000: 128, // el - 0x09a0005c: 129, // el-CY - 0x09a00085: 130, // el-GR - 0x09b00000: 131, // en - 0x09b00001: 132, // en-001 - 0x09b0001a: 133, // en-150 - 0x09b00024: 134, // en-AG - 0x09b00025: 135, // en-AI - 0x09b0002c: 136, // en-AS - 0x09b0002d: 137, // en-AT - 0x09b0002e: 138, // en-AU - 0x09b00033: 139, // en-BB - 0x09b00035: 140, // en-BE - 0x09b00039: 141, // en-BI - 0x09b0003c: 142, // en-BM - 0x09b00041: 143, // en-BS - 0x09b00045: 144, // en-BW - 0x09b00047: 145, // en-BZ - 0x09b00048: 146, // en-CA - 0x09b00049: 147, // en-CC - 0x09b0004d: 148, // en-CH - 0x09b0004f: 149, // en-CK - 0x09b00051: 150, // en-CM - 0x09b0005b: 151, // en-CX - 0x09b0005c: 152, // en-CY - 0x09b0005f: 153, // en-DE - 0x09b00060: 154, // en-DG - 0x09b00062: 155, // en-DK - 0x09b00063: 156, // en-DM - 0x09b0006c: 157, // en-ER - 0x09b00070: 158, // en-FI - 0x09b00071: 159, // en-FJ - 0x09b00072: 160, // en-FK - 0x09b00073: 161, // en-FM - 0x09b00079: 162, // en-GB - 0x09b0007a: 163, // en-GD - 0x09b0007d: 164, // en-GG - 0x09b0007e: 165, // en-GH - 0x09b0007f: 166, // en-GI - 0x09b00081: 167, // en-GM - 0x09b00088: 168, // en-GU - 0x09b0008a: 169, // en-GY - 0x09b0008b: 170, // en-HK - 0x09b00094: 171, // en-IE - 0x09b00095: 172, // en-IL - 0x09b00096: 173, // en-IM - 0x09b00097: 174, // en-IN - 0x09b00098: 175, // en-IO - 0x09b0009d: 176, // en-JE - 0x09b0009e: 177, // en-JM - 0x09b000a2: 178, // en-KE - 0x09b000a5: 179, // en-KI - 0x09b000a7: 180, // en-KN - 0x09b000ab: 181, // en-KY - 0x09b000af: 182, // en-LC - 0x09b000b2: 183, // en-LR - 0x09b000b3: 184, // en-LS - 0x09b000bd: 185, // en-MG - 0x09b000be: 186, // en-MH - 0x09b000c4: 187, // en-MO - 0x09b000c5: 188, // en-MP - 0x09b000c8: 189, // en-MS - 0x09b000c9: 190, // en-MT - 0x09b000ca: 191, // en-MU - 0x09b000cc: 192, // en-MW - 0x09b000ce: 193, // en-MY - 0x09b000d0: 194, // en-NA - 0x09b000d3: 195, // en-NF - 0x09b000d4: 196, // en-NG - 0x09b000d7: 197, // en-NL - 0x09b000db: 198, // en-NR - 0x09b000dd: 199, // en-NU - 0x09b000de: 200, // en-NZ - 0x09b000e4: 201, // en-PG - 0x09b000e5: 202, // en-PH - 0x09b000e6: 203, // en-PK - 0x09b000e9: 204, // en-PN - 0x09b000ea: 205, // en-PR - 0x09b000ee: 206, // en-PW - 0x09b00105: 207, // en-RW - 0x09b00107: 208, // en-SB - 0x09b00108: 209, // en-SC - 0x09b00109: 210, // en-SD - 0x09b0010a: 211, // en-SE - 0x09b0010b: 212, // en-SG - 0x09b0010c: 213, // en-SH - 0x09b0010d: 214, // en-SI - 0x09b00110: 215, // en-SL - 0x09b00115: 216, // en-SS - 0x09b00119: 217, // en-SX - 0x09b0011b: 218, // en-SZ - 0x09b0011d: 219, // en-TC - 0x09b00123: 220, // en-TK - 0x09b00127: 221, // en-TO - 0x09b0012a: 222, // en-TT - 0x09b0012b: 223, // en-TV - 0x09b0012d: 224, // en-TZ - 0x09b0012f: 225, // en-UG - 0x09b00131: 226, // en-UM - 0x09b00132: 227, // en-US - 0x09b00136: 228, // en-VC - 0x09b00139: 229, // en-VG - 0x09b0013a: 230, // en-VI - 0x09b0013c: 231, // en-VU - 0x09b0013f: 232, // en-WS - 0x09b0015e: 233, // en-ZA - 0x09b0015f: 234, // en-ZM - 0x09b00161: 235, // en-ZW - 0x09c00000: 236, // eo - 0x09c00001: 237, // eo-001 - 0x09d00000: 238, // es - 0x09d0001e: 239, // es-419 - 0x09d0002b: 240, // es-AR - 0x09d0003e: 241, // es-BO - 0x09d00040: 242, // es-BR - 0x09d00050: 243, // es-CL - 0x09d00053: 244, // es-CO - 0x09d00055: 245, // es-CR - 0x09d00058: 246, // es-CU - 0x09d00064: 247, // es-DO - 0x09d00067: 248, // es-EA - 0x09d00068: 249, // es-EC - 0x09d0006d: 250, // es-ES - 0x09d00084: 251, // es-GQ - 0x09d00087: 252, // es-GT - 0x09d0008d: 253, // es-HN - 0x09d00092: 254, // es-IC - 0x09d000cd: 255, // es-MX - 0x09d000d6: 256, // es-NI - 0x09d000e0: 257, // es-PA - 0x09d000e2: 258, // es-PE - 0x09d000e5: 259, // es-PH - 0x09d000ea: 260, // es-PR - 0x09d000ef: 261, // es-PY - 0x09d00118: 262, // es-SV - 0x09d00132: 263, // es-US - 0x09d00133: 264, // es-UY - 0x09d00138: 265, // es-VE - 0x09f00000: 266, // et - 0x09f00069: 267, // et-EE - 0x0a100000: 268, // eu - 0x0a10006d: 269, // eu-ES - 0x0a200000: 270, // ewo - 0x0a200051: 271, // ewo-CM - 0x0a400000: 272, // fa - 0x0a400023: 273, // fa-AF - 0x0a40009a: 274, // fa-IR - 0x0a600000: 275, // ff - 0x0a600051: 276, // ff-CM - 0x0a600082: 277, // ff-GN - 0x0a6000c7: 278, // ff-MR - 0x0a600112: 279, // ff-SN - 0x0a800000: 280, // fi - 0x0a800070: 281, // fi-FI - 0x0aa00000: 282, // fil - 0x0aa000e5: 283, // fil-PH - 0x0ad00000: 284, // fo - 0x0ad00062: 285, // fo-DK - 0x0ad00074: 286, // fo-FO - 0x0af00000: 287, // fr - 0x0af00035: 288, // fr-BE - 0x0af00036: 289, // fr-BF - 0x0af00039: 290, // fr-BI - 0x0af0003a: 291, // fr-BJ - 0x0af0003b: 292, // fr-BL - 0x0af00048: 293, // fr-CA - 0x0af0004a: 294, // fr-CD - 0x0af0004b: 295, // fr-CF - 0x0af0004c: 296, // fr-CG - 0x0af0004d: 297, // fr-CH - 0x0af0004e: 298, // fr-CI - 0x0af00051: 299, // fr-CM - 0x0af00061: 300, // fr-DJ - 0x0af00066: 301, // fr-DZ - 0x0af00076: 302, // fr-FR - 0x0af00078: 303, // fr-GA - 0x0af0007c: 304, // fr-GF - 0x0af00082: 305, // fr-GN - 0x0af00083: 306, // fr-GP - 0x0af00084: 307, // fr-GQ - 0x0af0008f: 308, // fr-HT - 0x0af000a6: 309, // fr-KM - 0x0af000b5: 310, // fr-LU - 0x0af000b8: 311, // fr-MA - 0x0af000b9: 312, // fr-MC - 0x0af000bc: 313, // fr-MF - 0x0af000bd: 314, // fr-MG - 0x0af000c1: 315, // fr-ML - 0x0af000c6: 316, // fr-MQ - 0x0af000c7: 317, // fr-MR - 0x0af000ca: 318, // fr-MU - 0x0af000d1: 319, // fr-NC - 0x0af000d2: 320, // fr-NE - 0x0af000e3: 321, // fr-PF - 0x0af000e8: 322, // fr-PM - 0x0af00100: 323, // fr-RE - 0x0af00105: 324, // fr-RW - 0x0af00108: 325, // fr-SC - 0x0af00112: 326, // fr-SN - 0x0af0011a: 327, // fr-SY - 0x0af0011e: 328, // fr-TD - 0x0af00120: 329, // fr-TG - 0x0af00126: 330, // fr-TN - 0x0af0013c: 331, // fr-VU - 0x0af0013d: 332, // fr-WF - 0x0af0015c: 333, // fr-YT - 0x0b600000: 334, // fur - 0x0b60009c: 335, // fur-IT - 0x0b900000: 336, // fy - 0x0b9000d7: 337, // fy-NL - 0x0ba00000: 338, // ga - 0x0ba00094: 339, // ga-IE - 0x0c200000: 340, // gd - 0x0c200079: 341, // gd-GB - 0x0c800000: 342, // gl - 0x0c80006d: 343, // gl-ES - 0x0d200000: 344, // gsw - 0x0d20004d: 345, // gsw-CH - 0x0d200076: 346, // gsw-FR - 0x0d2000b0: 347, // gsw-LI - 0x0d300000: 348, // gu - 0x0d300097: 349, // gu-IN - 0x0d700000: 350, // guw - 0x0d800000: 351, // guz - 0x0d8000a2: 352, // guz-KE - 0x0d900000: 353, // gv - 0x0d900096: 354, // gv-IM - 0x0dc00000: 355, // ha - 0x0dc0007e: 356, // ha-GH - 0x0dc000d2: 357, // ha-NE - 0x0dc000d4: 358, // ha-NG - 0x0de00000: 359, // haw - 0x0de00132: 360, // haw-US - 0x0e000000: 361, // he - 0x0e000095: 362, // he-IL - 0x0e100000: 363, // hi - 0x0e100097: 364, // hi-IN - 0x0ee00000: 365, // hr - 0x0ee00032: 366, // hr-BA - 0x0ee0008e: 367, // hr-HR - 0x0ef00000: 368, // hsb - 0x0ef0005f: 369, // hsb-DE - 0x0f200000: 370, // hu - 0x0f200090: 371, // hu-HU - 0x0f300000: 372, // hy - 0x0f300027: 373, // hy-AM - 0x0f800000: 374, // id - 0x0f800093: 375, // id-ID - 0x0fa00000: 376, // ig - 0x0fa000d4: 377, // ig-NG - 0x0fb00000: 378, // ii - 0x0fb00052: 379, // ii-CN - 0x10200000: 380, // is - 0x1020009b: 381, // is-IS - 0x10300000: 382, // it - 0x1030004d: 383, // it-CH - 0x1030009c: 384, // it-IT - 0x10300111: 385, // it-SM - 0x10400000: 386, // iu - 0x10700000: 387, // ja - 0x107000a0: 388, // ja-JP - 0x10900000: 389, // jbo - 0x10a00000: 390, // jgo - 0x10a00051: 391, // jgo-CM - 0x10c00000: 392, // jmc - 0x10c0012d: 393, // jmc-TZ - 0x10f00000: 394, // jv - 0x11100000: 395, // ka - 0x1110007b: 396, // ka-GE - 0x11300000: 397, // kab - 0x11300066: 398, // kab-DZ - 0x11500000: 399, // kaj - 0x11600000: 400, // kam - 0x116000a2: 401, // kam-KE - 0x11900000: 402, // kcg - 0x11b00000: 403, // kde - 0x11b0012d: 404, // kde-TZ - 0x11d00000: 405, // kea - 0x11d00059: 406, // kea-CV - 0x12800000: 407, // khq - 0x128000c1: 408, // khq-ML - 0x12b00000: 409, // ki - 0x12b000a2: 410, // ki-KE - 0x12f00000: 411, // kk - 0x12f000ac: 412, // kk-KZ - 0x13000000: 413, // kkj - 0x13000051: 414, // kkj-CM - 0x13100000: 415, // kl - 0x13100080: 416, // kl-GL - 0x13200000: 417, // kln - 0x132000a2: 418, // kln-KE - 0x13300000: 419, // km - 0x133000a4: 420, // km-KH - 0x13500000: 421, // kn - 0x13500097: 422, // kn-IN - 0x13600000: 423, // ko - 0x136000a8: 424, // ko-KP - 0x136000a9: 425, // ko-KR - 0x13800000: 426, // kok - 0x13800097: 427, // kok-IN - 0x14100000: 428, // ks - 0x14100097: 429, // ks-IN - 0x14200000: 430, // ksb - 0x1420012d: 431, // ksb-TZ - 0x14300000: 432, // ksf - 0x14300051: 433, // ksf-CM - 0x14400000: 434, // ksh - 0x1440005f: 435, // ksh-DE - 0x14500000: 436, // ku - 0x14a00000: 437, // kw - 0x14a00079: 438, // kw-GB - 0x14d00000: 439, // ky - 0x14d000a3: 440, // ky-KG - 0x15100000: 441, // lag - 0x1510012d: 442, // lag-TZ - 0x15400000: 443, // lb - 0x154000b5: 444, // lb-LU - 0x15a00000: 445, // lg - 0x15a0012f: 446, // lg-UG - 0x16100000: 447, // lkt - 0x16100132: 448, // lkt-US - 0x16400000: 449, // ln - 0x16400029: 450, // ln-AO - 0x1640004a: 451, // ln-CD - 0x1640004b: 452, // ln-CF - 0x1640004c: 453, // ln-CG - 0x16500000: 454, // lo - 0x165000ad: 455, // lo-LA - 0x16800000: 456, // lrc - 0x16800099: 457, // lrc-IQ - 0x1680009a: 458, // lrc-IR - 0x16900000: 459, // lt - 0x169000b4: 460, // lt-LT - 0x16b00000: 461, // lu - 0x16b0004a: 462, // lu-CD - 0x16d00000: 463, // luo - 0x16d000a2: 464, // luo-KE - 0x16e00000: 465, // luy - 0x16e000a2: 466, // luy-KE - 0x17000000: 467, // lv - 0x170000b6: 468, // lv-LV - 0x17a00000: 469, // mas - 0x17a000a2: 470, // mas-KE - 0x17a0012d: 471, // mas-TZ - 0x18000000: 472, // mer - 0x180000a2: 473, // mer-KE - 0x18200000: 474, // mfe - 0x182000ca: 475, // mfe-MU - 0x18300000: 476, // mg - 0x183000bd: 477, // mg-MG - 0x18400000: 478, // mgh - 0x184000cf: 479, // mgh-MZ - 0x18500000: 480, // mgo - 0x18500051: 481, // mgo-CM - 0x18c00000: 482, // mk - 0x18c000c0: 483, // mk-MK - 0x18d00000: 484, // ml - 0x18d00097: 485, // ml-IN - 0x18f00000: 486, // mn - 0x18f000c3: 487, // mn-MN - 0x19600000: 488, // mr - 0x19600097: 489, // mr-IN - 0x19a00000: 490, // ms - 0x19a0003d: 491, // ms-BN - 0x19a000ce: 492, // ms-MY - 0x19a0010b: 493, // ms-SG - 0x19b00000: 494, // mt - 0x19b000c9: 495, // mt-MT - 0x19d00000: 496, // mua - 0x19d00051: 497, // mua-CM - 0x1a500000: 498, // my - 0x1a5000c2: 499, // my-MM - 0x1a900000: 500, // mzn - 0x1a90009a: 501, // mzn-IR - 0x1ab00000: 502, // nah - 0x1ae00000: 503, // naq - 0x1ae000d0: 504, // naq-NA - 0x1af00000: 505, // nb - 0x1af000d8: 506, // nb-NO - 0x1af0010e: 507, // nb-SJ - 0x1b100000: 508, // nd - 0x1b100161: 509, // nd-ZW - 0x1b400000: 510, // ne - 0x1b400097: 511, // ne-IN - 0x1b4000d9: 512, // ne-NP - 0x1bd00000: 513, // nl - 0x1bd0002f: 514, // nl-AW - 0x1bd00035: 515, // nl-BE - 0x1bd0003f: 516, // nl-BQ - 0x1bd0005a: 517, // nl-CW - 0x1bd000d7: 518, // nl-NL - 0x1bd00114: 519, // nl-SR - 0x1bd00119: 520, // nl-SX - 0x1be00000: 521, // nmg - 0x1be00051: 522, // nmg-CM - 0x1bf00000: 523, // nn - 0x1bf000d8: 524, // nn-NO - 0x1c000000: 525, // nnh - 0x1c000051: 526, // nnh-CM - 0x1c100000: 527, // no - 0x1c500000: 528, // nqo - 0x1c600000: 529, // nr - 0x1c800000: 530, // nso - 0x1c900000: 531, // nus - 0x1c900115: 532, // nus-SS - 0x1cc00000: 533, // ny - 0x1ce00000: 534, // nyn - 0x1ce0012f: 535, // nyn-UG - 0x1d200000: 536, // om - 0x1d20006e: 537, // om-ET - 0x1d2000a2: 538, // om-KE - 0x1d300000: 539, // or - 0x1d300097: 540, // or-IN - 0x1d400000: 541, // os - 0x1d40007b: 542, // os-GE - 0x1d400104: 543, // os-RU - 0x1d700000: 544, // pa - 0x1d705000: 545, // pa-Arab - 0x1d7050e6: 546, // pa-Arab-PK - 0x1d72f000: 547, // pa-Guru - 0x1d72f097: 548, // pa-Guru-IN - 0x1db00000: 549, // pap - 0x1e700000: 550, // pl - 0x1e7000e7: 551, // pl-PL - 0x1ed00000: 552, // prg - 0x1ed00001: 553, // prg-001 - 0x1ee00000: 554, // ps - 0x1ee00023: 555, // ps-AF - 0x1ef00000: 556, // pt - 0x1ef00029: 557, // pt-AO - 0x1ef00040: 558, // pt-BR - 0x1ef0004d: 559, // pt-CH - 0x1ef00059: 560, // pt-CV - 0x1ef00084: 561, // pt-GQ - 0x1ef00089: 562, // pt-GW - 0x1ef000b5: 563, // pt-LU - 0x1ef000c4: 564, // pt-MO - 0x1ef000cf: 565, // pt-MZ - 0x1ef000ec: 566, // pt-PT - 0x1ef00116: 567, // pt-ST - 0x1ef00124: 568, // pt-TL - 0x1f100000: 569, // qu - 0x1f10003e: 570, // qu-BO - 0x1f100068: 571, // qu-EC - 0x1f1000e2: 572, // qu-PE - 0x1fc00000: 573, // rm - 0x1fc0004d: 574, // rm-CH - 0x20100000: 575, // rn - 0x20100039: 576, // rn-BI - 0x20300000: 577, // ro - 0x203000ba: 578, // ro-MD - 0x20300102: 579, // ro-RO - 0x20500000: 580, // rof - 0x2050012d: 581, // rof-TZ - 0x20700000: 582, // ru - 0x20700046: 583, // ru-BY - 0x207000a3: 584, // ru-KG - 0x207000ac: 585, // ru-KZ - 0x207000ba: 586, // ru-MD - 0x20700104: 587, // ru-RU - 0x2070012e: 588, // ru-UA - 0x20a00000: 589, // rw - 0x20a00105: 590, // rw-RW - 0x20b00000: 591, // rwk - 0x20b0012d: 592, // rwk-TZ - 0x20f00000: 593, // sah - 0x20f00104: 594, // sah-RU - 0x21000000: 595, // saq - 0x210000a2: 596, // saq-KE - 0x21400000: 597, // sbp - 0x2140012d: 598, // sbp-TZ - 0x21c00000: 599, // sdh - 0x21d00000: 600, // se - 0x21d00070: 601, // se-FI - 0x21d000d8: 602, // se-NO - 0x21d0010a: 603, // se-SE - 0x21f00000: 604, // seh - 0x21f000cf: 605, // seh-MZ - 0x22100000: 606, // ses - 0x221000c1: 607, // ses-ML - 0x22200000: 608, // sg - 0x2220004b: 609, // sg-CF - 0x22600000: 610, // shi - 0x22652000: 611, // shi-Latn - 0x226520b8: 612, // shi-Latn-MA - 0x226d2000: 613, // shi-Tfng - 0x226d20b8: 614, // shi-Tfng-MA - 0x22800000: 615, // si - 0x228000b1: 616, // si-LK - 0x22a00000: 617, // sk - 0x22a0010f: 618, // sk-SK - 0x22c00000: 619, // sl - 0x22c0010d: 620, // sl-SI - 0x23000000: 621, // sma - 0x23100000: 622, // smi - 0x23200000: 623, // smj - 0x23300000: 624, // smn - 0x23300070: 625, // smn-FI - 0x23500000: 626, // sms - 0x23600000: 627, // sn - 0x23600161: 628, // sn-ZW - 0x23800000: 629, // so - 0x23800061: 630, // so-DJ - 0x2380006e: 631, // so-ET - 0x238000a2: 632, // so-KE - 0x23800113: 633, // so-SO - 0x23a00000: 634, // sq - 0x23a00026: 635, // sq-AL - 0x23a000c0: 636, // sq-MK - 0x23a0014a: 637, // sq-XK - 0x23b00000: 638, // sr - 0x23b1e000: 639, // sr-Cyrl - 0x23b1e032: 640, // sr-Cyrl-BA - 0x23b1e0bb: 641, // sr-Cyrl-ME - 0x23b1e103: 642, // sr-Cyrl-RS - 0x23b1e14a: 643, // sr-Cyrl-XK - 0x23b52000: 644, // sr-Latn - 0x23b52032: 645, // sr-Latn-BA - 0x23b520bb: 646, // sr-Latn-ME - 0x23b52103: 647, // sr-Latn-RS - 0x23b5214a: 648, // sr-Latn-XK - 0x24000000: 649, // ss - 0x24100000: 650, // ssy - 0x24200000: 651, // st - 0x24700000: 652, // sv - 0x24700030: 653, // sv-AX - 0x24700070: 654, // sv-FI - 0x2470010a: 655, // sv-SE - 0x24800000: 656, // sw - 0x2480004a: 657, // sw-CD - 0x248000a2: 658, // sw-KE - 0x2480012d: 659, // sw-TZ - 0x2480012f: 660, // sw-UG - 0x24f00000: 661, // syr - 0x25100000: 662, // ta - 0x25100097: 663, // ta-IN - 0x251000b1: 664, // ta-LK - 0x251000ce: 665, // ta-MY - 0x2510010b: 666, // ta-SG - 0x25800000: 667, // te - 0x25800097: 668, // te-IN - 0x25a00000: 669, // teo - 0x25a000a2: 670, // teo-KE - 0x25a0012f: 671, // teo-UG - 0x25d00000: 672, // th - 0x25d00121: 673, // th-TH - 0x26100000: 674, // ti - 0x2610006c: 675, // ti-ER - 0x2610006e: 676, // ti-ET - 0x26200000: 677, // tig - 0x26400000: 678, // tk - 0x26400125: 679, // tk-TM - 0x26b00000: 680, // tn - 0x26c00000: 681, // to - 0x26c00127: 682, // to-TO - 0x26f00000: 683, // tr - 0x26f0005c: 684, // tr-CY - 0x26f00129: 685, // tr-TR - 0x27200000: 686, // ts - 0x27e00000: 687, // twq - 0x27e000d2: 688, // twq-NE - 0x28200000: 689, // tzm - 0x282000b8: 690, // tzm-MA - 0x28400000: 691, // ug - 0x28400052: 692, // ug-CN - 0x28600000: 693, // uk - 0x2860012e: 694, // uk-UA - 0x28c00000: 695, // ur - 0x28c00097: 696, // ur-IN - 0x28c000e6: 697, // ur-PK - 0x28d00000: 698, // uz - 0x28d05000: 699, // uz-Arab - 0x28d05023: 700, // uz-Arab-AF - 0x28d1e000: 701, // uz-Cyrl - 0x28d1e134: 702, // uz-Cyrl-UZ - 0x28d52000: 703, // uz-Latn - 0x28d52134: 704, // uz-Latn-UZ - 0x28e00000: 705, // vai - 0x28e52000: 706, // vai-Latn - 0x28e520b2: 707, // vai-Latn-LR - 0x28ed9000: 708, // vai-Vaii - 0x28ed90b2: 709, // vai-Vaii-LR - 0x28f00000: 710, // ve - 0x29200000: 711, // vi - 0x2920013b: 712, // vi-VN - 0x29700000: 713, // vo - 0x29700001: 714, // vo-001 - 0x29a00000: 715, // vun - 0x29a0012d: 716, // vun-TZ - 0x29b00000: 717, // wa - 0x29c00000: 718, // wae - 0x29c0004d: 719, // wae-CH - 0x2a400000: 720, // wo - 0x2a900000: 721, // xh - 0x2b100000: 722, // xog - 0x2b10012f: 723, // xog-UG - 0x2b700000: 724, // yav - 0x2b700051: 725, // yav-CM - 0x2b900000: 726, // yi - 0x2b900001: 727, // yi-001 - 0x2ba00000: 728, // yo - 0x2ba0003a: 729, // yo-BJ - 0x2ba000d4: 730, // yo-NG - 0x2bd00000: 731, // yue - 0x2bd0008b: 732, // yue-HK - 0x2c300000: 733, // zgh - 0x2c3000b8: 734, // zgh-MA - 0x2c400000: 735, // zh - 0x2c434000: 736, // zh-Hans - 0x2c434052: 737, // zh-Hans-CN - 0x2c43408b: 738, // zh-Hans-HK - 0x2c4340c4: 739, // zh-Hans-MO - 0x2c43410b: 740, // zh-Hans-SG - 0x2c435000: 741, // zh-Hant - 0x2c43508b: 742, // zh-Hant-HK - 0x2c4350c4: 743, // zh-Hant-MO - 0x2c43512c: 744, // zh-Hant-TW - 0x2c600000: 745, // zu - 0x2c60015e: 746, // zu-ZA + 0x01600000: 3, // af + 0x016000d1: 4, // af-NA + 0x01600160: 5, // af-ZA + 0x01c00000: 6, // agq + 0x01c00051: 7, // agq-CM + 0x02100000: 8, // ak + 0x0210007f: 9, // ak-GH + 0x02700000: 10, // am + 0x0270006e: 11, // am-ET + 0x03a00000: 12, // ar + 0x03a00001: 13, // ar-001 + 0x03a00022: 14, // ar-AE + 0x03a00038: 15, // ar-BH + 0x03a00061: 16, // ar-DJ + 0x03a00066: 17, // ar-DZ + 0x03a0006a: 18, // ar-EG + 0x03a0006b: 19, // ar-EH + 0x03a0006c: 20, // ar-ER + 0x03a00096: 21, // ar-IL + 0x03a0009a: 22, // ar-IQ + 0x03a000a0: 23, // ar-JO + 0x03a000a7: 24, // ar-KM + 0x03a000ab: 25, // ar-KW + 0x03a000af: 26, // ar-LB + 0x03a000b8: 27, // ar-LY + 0x03a000b9: 28, // ar-MA + 0x03a000c8: 29, // ar-MR + 0x03a000e0: 30, // ar-OM + 0x03a000ec: 31, // ar-PS + 0x03a000f2: 32, // ar-QA + 0x03a00107: 33, // ar-SA + 0x03a0010a: 34, // ar-SD + 0x03a00114: 35, // ar-SO + 0x03a00116: 36, // ar-SS + 0x03a0011b: 37, // ar-SY + 0x03a0011f: 38, // ar-TD + 0x03a00127: 39, // ar-TN + 0x03a0015d: 40, // ar-YE + 0x04000000: 41, // ars + 0x04300000: 42, // as + 0x04300098: 43, // as-IN + 0x04400000: 44, // asa + 0x0440012e: 45, // asa-TZ + 0x04800000: 46, // ast + 0x0480006d: 47, // ast-ES + 0x05800000: 48, // az + 0x0581e000: 49, // az-Cyrl + 0x0581e031: 50, // az-Cyrl-AZ + 0x05852000: 51, // az-Latn + 0x05852031: 52, // az-Latn-AZ + 0x05e00000: 53, // bas + 0x05e00051: 54, // bas-CM + 0x07100000: 55, // be + 0x07100046: 56, // be-BY + 0x07500000: 57, // bem + 0x07500161: 58, // bem-ZM + 0x07900000: 59, // bez + 0x0790012e: 60, // bez-TZ + 0x07e00000: 61, // bg + 0x07e00037: 62, // bg-BG + 0x08200000: 63, // bh + 0x0a000000: 64, // bm + 0x0a0000c2: 65, // bm-ML + 0x0a500000: 66, // bn + 0x0a500034: 67, // bn-BD + 0x0a500098: 68, // bn-IN + 0x0a900000: 69, // bo + 0x0a900052: 70, // bo-CN + 0x0a900098: 71, // bo-IN + 0x0b200000: 72, // br + 0x0b200077: 73, // br-FR + 0x0b500000: 74, // brx + 0x0b500098: 75, // brx-IN + 0x0b700000: 76, // bs + 0x0b71e000: 77, // bs-Cyrl + 0x0b71e032: 78, // bs-Cyrl-BA + 0x0b752000: 79, // bs-Latn + 0x0b752032: 80, // bs-Latn-BA + 0x0d700000: 81, // ca + 0x0d700021: 82, // ca-AD + 0x0d70006d: 83, // ca-ES + 0x0d700077: 84, // ca-FR + 0x0d70009d: 85, // ca-IT + 0x0dc00000: 86, // ce + 0x0dc00105: 87, // ce-RU + 0x0df00000: 88, // cgg + 0x0df00130: 89, // cgg-UG + 0x0e500000: 90, // chr + 0x0e500134: 91, // chr-US + 0x0e900000: 92, // ckb + 0x0e90009a: 93, // ckb-IQ + 0x0e90009b: 94, // ckb-IR + 0x0f900000: 95, // cs + 0x0f90005d: 96, // cs-CZ + 0x0fd00000: 97, // cu + 0x0fd00105: 98, // cu-RU + 0x0ff00000: 99, // cy + 0x0ff0007a: 100, // cy-GB + 0x10000000: 101, // da + 0x10000062: 102, // da-DK + 0x10000081: 103, // da-GL + 0x10700000: 104, // dav + 0x107000a3: 105, // dav-KE + 0x10c00000: 106, // de + 0x10c0002d: 107, // de-AT + 0x10c00035: 108, // de-BE + 0x10c0004d: 109, // de-CH + 0x10c0005f: 110, // de-DE + 0x10c0009d: 111, // de-IT + 0x10c000b1: 112, // de-LI + 0x10c000b6: 113, // de-LU + 0x11600000: 114, // dje + 0x116000d3: 115, // dje-NE + 0x11e00000: 116, // dsb + 0x11e0005f: 117, // dsb-DE + 0x12300000: 118, // dua + 0x12300051: 119, // dua-CM + 0x12700000: 120, // dv + 0x12a00000: 121, // dyo + 0x12a00113: 122, // dyo-SN + 0x12c00000: 123, // dz + 0x12c00042: 124, // dz-BT + 0x12e00000: 125, // ebu + 0x12e000a3: 126, // ebu-KE + 0x12f00000: 127, // ee + 0x12f0007f: 128, // ee-GH + 0x12f00121: 129, // ee-TG + 0x13500000: 130, // el + 0x1350005c: 131, // el-CY + 0x13500086: 132, // el-GR + 0x13800000: 133, // en + 0x13800001: 134, // en-001 + 0x1380001a: 135, // en-150 + 0x13800024: 136, // en-AG + 0x13800025: 137, // en-AI + 0x1380002c: 138, // en-AS + 0x1380002d: 139, // en-AT + 0x1380002e: 140, // en-AU + 0x13800033: 141, // en-BB + 0x13800035: 142, // en-BE + 0x13800039: 143, // en-BI + 0x1380003c: 144, // en-BM + 0x13800041: 145, // en-BS + 0x13800045: 146, // en-BW + 0x13800047: 147, // en-BZ + 0x13800048: 148, // en-CA + 0x13800049: 149, // en-CC + 0x1380004d: 150, // en-CH + 0x1380004f: 151, // en-CK + 0x13800051: 152, // en-CM + 0x1380005b: 153, // en-CX + 0x1380005c: 154, // en-CY + 0x1380005f: 155, // en-DE + 0x13800060: 156, // en-DG + 0x13800062: 157, // en-DK + 0x13800063: 158, // en-DM + 0x1380006c: 159, // en-ER + 0x13800071: 160, // en-FI + 0x13800072: 161, // en-FJ + 0x13800073: 162, // en-FK + 0x13800074: 163, // en-FM + 0x1380007a: 164, // en-GB + 0x1380007b: 165, // en-GD + 0x1380007e: 166, // en-GG + 0x1380007f: 167, // en-GH + 0x13800080: 168, // en-GI + 0x13800082: 169, // en-GM + 0x13800089: 170, // en-GU + 0x1380008b: 171, // en-GY + 0x1380008c: 172, // en-HK + 0x13800095: 173, // en-IE + 0x13800096: 174, // en-IL + 0x13800097: 175, // en-IM + 0x13800098: 176, // en-IN + 0x13800099: 177, // en-IO + 0x1380009e: 178, // en-JE + 0x1380009f: 179, // en-JM + 0x138000a3: 180, // en-KE + 0x138000a6: 181, // en-KI + 0x138000a8: 182, // en-KN + 0x138000ac: 183, // en-KY + 0x138000b0: 184, // en-LC + 0x138000b3: 185, // en-LR + 0x138000b4: 186, // en-LS + 0x138000be: 187, // en-MG + 0x138000bf: 188, // en-MH + 0x138000c5: 189, // en-MO + 0x138000c6: 190, // en-MP + 0x138000c9: 191, // en-MS + 0x138000ca: 192, // en-MT + 0x138000cb: 193, // en-MU + 0x138000cd: 194, // en-MW + 0x138000cf: 195, // en-MY + 0x138000d1: 196, // en-NA + 0x138000d4: 197, // en-NF + 0x138000d5: 198, // en-NG + 0x138000d8: 199, // en-NL + 0x138000dc: 200, // en-NR + 0x138000de: 201, // en-NU + 0x138000df: 202, // en-NZ + 0x138000e5: 203, // en-PG + 0x138000e6: 204, // en-PH + 0x138000e7: 205, // en-PK + 0x138000ea: 206, // en-PN + 0x138000eb: 207, // en-PR + 0x138000ef: 208, // en-PW + 0x13800106: 209, // en-RW + 0x13800108: 210, // en-SB + 0x13800109: 211, // en-SC + 0x1380010a: 212, // en-SD + 0x1380010b: 213, // en-SE + 0x1380010c: 214, // en-SG + 0x1380010d: 215, // en-SH + 0x1380010e: 216, // en-SI + 0x13800111: 217, // en-SL + 0x13800116: 218, // en-SS + 0x1380011a: 219, // en-SX + 0x1380011c: 220, // en-SZ + 0x1380011e: 221, // en-TC + 0x13800124: 222, // en-TK + 0x13800128: 223, // en-TO + 0x1380012b: 224, // en-TT + 0x1380012c: 225, // en-TV + 0x1380012e: 226, // en-TZ + 0x13800130: 227, // en-UG + 0x13800132: 228, // en-UM + 0x13800134: 229, // en-US + 0x13800138: 230, // en-VC + 0x1380013b: 231, // en-VG + 0x1380013c: 232, // en-VI + 0x1380013e: 233, // en-VU + 0x13800141: 234, // en-WS + 0x13800160: 235, // en-ZA + 0x13800161: 236, // en-ZM + 0x13800163: 237, // en-ZW + 0x13b00000: 238, // eo + 0x13b00001: 239, // eo-001 + 0x13d00000: 240, // es + 0x13d0001e: 241, // es-419 + 0x13d0002b: 242, // es-AR + 0x13d0003e: 243, // es-BO + 0x13d00040: 244, // es-BR + 0x13d00047: 245, // es-BZ + 0x13d00050: 246, // es-CL + 0x13d00053: 247, // es-CO + 0x13d00055: 248, // es-CR + 0x13d00058: 249, // es-CU + 0x13d00064: 250, // es-DO + 0x13d00067: 251, // es-EA + 0x13d00068: 252, // es-EC + 0x13d0006d: 253, // es-ES + 0x13d00085: 254, // es-GQ + 0x13d00088: 255, // es-GT + 0x13d0008e: 256, // es-HN + 0x13d00093: 257, // es-IC + 0x13d000ce: 258, // es-MX + 0x13d000d7: 259, // es-NI + 0x13d000e1: 260, // es-PA + 0x13d000e3: 261, // es-PE + 0x13d000e6: 262, // es-PH + 0x13d000eb: 263, // es-PR + 0x13d000f0: 264, // es-PY + 0x13d00119: 265, // es-SV + 0x13d00134: 266, // es-US + 0x13d00135: 267, // es-UY + 0x13d0013a: 268, // es-VE + 0x13f00000: 269, // et + 0x13f00069: 270, // et-EE + 0x14400000: 271, // eu + 0x1440006d: 272, // eu-ES + 0x14500000: 273, // ewo + 0x14500051: 274, // ewo-CM + 0x14700000: 275, // fa + 0x14700023: 276, // fa-AF + 0x1470009b: 277, // fa-IR + 0x14d00000: 278, // ff + 0x14d00051: 279, // ff-CM + 0x14d00083: 280, // ff-GN + 0x14d000c8: 281, // ff-MR + 0x14d00113: 282, // ff-SN + 0x15000000: 283, // fi + 0x15000071: 284, // fi-FI + 0x15200000: 285, // fil + 0x152000e6: 286, // fil-PH + 0x15700000: 287, // fo + 0x15700062: 288, // fo-DK + 0x15700075: 289, // fo-FO + 0x15d00000: 290, // fr + 0x15d00035: 291, // fr-BE + 0x15d00036: 292, // fr-BF + 0x15d00039: 293, // fr-BI + 0x15d0003a: 294, // fr-BJ + 0x15d0003b: 295, // fr-BL + 0x15d00048: 296, // fr-CA + 0x15d0004a: 297, // fr-CD + 0x15d0004b: 298, // fr-CF + 0x15d0004c: 299, // fr-CG + 0x15d0004d: 300, // fr-CH + 0x15d0004e: 301, // fr-CI + 0x15d00051: 302, // fr-CM + 0x15d00061: 303, // fr-DJ + 0x15d00066: 304, // fr-DZ + 0x15d00077: 305, // fr-FR + 0x15d00079: 306, // fr-GA + 0x15d0007d: 307, // fr-GF + 0x15d00083: 308, // fr-GN + 0x15d00084: 309, // fr-GP + 0x15d00085: 310, // fr-GQ + 0x15d00090: 311, // fr-HT + 0x15d000a7: 312, // fr-KM + 0x15d000b6: 313, // fr-LU + 0x15d000b9: 314, // fr-MA + 0x15d000ba: 315, // fr-MC + 0x15d000bd: 316, // fr-MF + 0x15d000be: 317, // fr-MG + 0x15d000c2: 318, // fr-ML + 0x15d000c7: 319, // fr-MQ + 0x15d000c8: 320, // fr-MR + 0x15d000cb: 321, // fr-MU + 0x15d000d2: 322, // fr-NC + 0x15d000d3: 323, // fr-NE + 0x15d000e4: 324, // fr-PF + 0x15d000e9: 325, // fr-PM + 0x15d00101: 326, // fr-RE + 0x15d00106: 327, // fr-RW + 0x15d00109: 328, // fr-SC + 0x15d00113: 329, // fr-SN + 0x15d0011b: 330, // fr-SY + 0x15d0011f: 331, // fr-TD + 0x15d00121: 332, // fr-TG + 0x15d00127: 333, // fr-TN + 0x15d0013e: 334, // fr-VU + 0x15d0013f: 335, // fr-WF + 0x15d0015e: 336, // fr-YT + 0x16800000: 337, // fur + 0x1680009d: 338, // fur-IT + 0x16c00000: 339, // fy + 0x16c000d8: 340, // fy-NL + 0x16d00000: 341, // ga + 0x16d00095: 342, // ga-IE + 0x17c00000: 343, // gd + 0x17c0007a: 344, // gd-GB + 0x18e00000: 345, // gl + 0x18e0006d: 346, // gl-ES + 0x1a100000: 347, // gsw + 0x1a10004d: 348, // gsw-CH + 0x1a100077: 349, // gsw-FR + 0x1a1000b1: 350, // gsw-LI + 0x1a200000: 351, // gu + 0x1a200098: 352, // gu-IN + 0x1a700000: 353, // guw + 0x1a900000: 354, // guz + 0x1a9000a3: 355, // guz-KE + 0x1aa00000: 356, // gv + 0x1aa00097: 357, // gv-IM + 0x1b200000: 358, // ha + 0x1b20007f: 359, // ha-GH + 0x1b2000d3: 360, // ha-NE + 0x1b2000d5: 361, // ha-NG + 0x1b600000: 362, // haw + 0x1b600134: 363, // haw-US + 0x1ba00000: 364, // he + 0x1ba00096: 365, // he-IL + 0x1bc00000: 366, // hi + 0x1bc00098: 367, // hi-IN + 0x1cf00000: 368, // hr + 0x1cf00032: 369, // hr-BA + 0x1cf0008f: 370, // hr-HR + 0x1d000000: 371, // hsb + 0x1d00005f: 372, // hsb-DE + 0x1d300000: 373, // hu + 0x1d300091: 374, // hu-HU + 0x1d500000: 375, // hy + 0x1d500027: 376, // hy-AM + 0x1df00000: 377, // id + 0x1df00094: 378, // id-ID + 0x1e500000: 379, // ig + 0x1e5000d5: 380, // ig-NG + 0x1e800000: 381, // ii + 0x1e800052: 382, // ii-CN + 0x1f600000: 383, // is + 0x1f60009c: 384, // is-IS + 0x1f700000: 385, // it + 0x1f70004d: 386, // it-CH + 0x1f70009d: 387, // it-IT + 0x1f700112: 388, // it-SM + 0x1f700137: 389, // it-VA + 0x1f800000: 390, // iu + 0x1fe00000: 391, // ja + 0x1fe000a1: 392, // ja-JP + 0x20100000: 393, // jbo + 0x20500000: 394, // jgo + 0x20500051: 395, // jgo-CM + 0x20800000: 396, // jmc + 0x2080012e: 397, // jmc-TZ + 0x20c00000: 398, // jv + 0x20e00000: 399, // ka + 0x20e0007c: 400, // ka-GE + 0x21000000: 401, // kab + 0x21000066: 402, // kab-DZ + 0x21400000: 403, // kaj + 0x21500000: 404, // kam + 0x215000a3: 405, // kam-KE + 0x21d00000: 406, // kcg + 0x22100000: 407, // kde + 0x2210012e: 408, // kde-TZ + 0x22500000: 409, // kea + 0x22500059: 410, // kea-CV + 0x23200000: 411, // khq + 0x232000c2: 412, // khq-ML + 0x23700000: 413, // ki + 0x237000a3: 414, // ki-KE + 0x24000000: 415, // kk + 0x240000ad: 416, // kk-KZ + 0x24200000: 417, // kkj + 0x24200051: 418, // kkj-CM + 0x24300000: 419, // kl + 0x24300081: 420, // kl-GL + 0x24400000: 421, // kln + 0x244000a3: 422, // kln-KE + 0x24800000: 423, // km + 0x248000a5: 424, // km-KH + 0x24f00000: 425, // kn + 0x24f00098: 426, // kn-IN + 0x25200000: 427, // ko + 0x252000a9: 428, // ko-KP + 0x252000aa: 429, // ko-KR + 0x25400000: 430, // kok + 0x25400098: 431, // kok-IN + 0x26800000: 432, // ks + 0x26800098: 433, // ks-IN + 0x26900000: 434, // ksb + 0x2690012e: 435, // ksb-TZ + 0x26b00000: 436, // ksf + 0x26b00051: 437, // ksf-CM + 0x26c00000: 438, // ksh + 0x26c0005f: 439, // ksh-DE + 0x27200000: 440, // ku + 0x27f00000: 441, // kw + 0x27f0007a: 442, // kw-GB + 0x28800000: 443, // ky + 0x288000a4: 444, // ky-KG + 0x28f00000: 445, // lag + 0x28f0012e: 446, // lag-TZ + 0x29300000: 447, // lb + 0x293000b6: 448, // lb-LU + 0x2a100000: 449, // lg + 0x2a100130: 450, // lg-UG + 0x2ad00000: 451, // lkt + 0x2ad00134: 452, // lkt-US + 0x2b300000: 453, // ln + 0x2b300029: 454, // ln-AO + 0x2b30004a: 455, // ln-CD + 0x2b30004b: 456, // ln-CF + 0x2b30004c: 457, // ln-CG + 0x2b600000: 458, // lo + 0x2b6000ae: 459, // lo-LA + 0x2bd00000: 460, // lrc + 0x2bd0009a: 461, // lrc-IQ + 0x2bd0009b: 462, // lrc-IR + 0x2be00000: 463, // lt + 0x2be000b5: 464, // lt-LT + 0x2c000000: 465, // lu + 0x2c00004a: 466, // lu-CD + 0x2c200000: 467, // luo + 0x2c2000a3: 468, // luo-KE + 0x2c300000: 469, // luy + 0x2c3000a3: 470, // luy-KE + 0x2c500000: 471, // lv + 0x2c5000b7: 472, // lv-LV + 0x2cf00000: 473, // mas + 0x2cf000a3: 474, // mas-KE + 0x2cf0012e: 475, // mas-TZ + 0x2e700000: 476, // mer + 0x2e7000a3: 477, // mer-KE + 0x2eb00000: 478, // mfe + 0x2eb000cb: 479, // mfe-MU + 0x2ef00000: 480, // mg + 0x2ef000be: 481, // mg-MG + 0x2f000000: 482, // mgh + 0x2f0000d0: 483, // mgh-MZ + 0x2f200000: 484, // mgo + 0x2f200051: 485, // mgo-CM + 0x2fd00000: 486, // mk + 0x2fd000c1: 487, // mk-MK + 0x30200000: 488, // ml + 0x30200098: 489, // ml-IN + 0x30900000: 490, // mn + 0x309000c4: 491, // mn-MN + 0x31900000: 492, // mr + 0x31900098: 493, // mr-IN + 0x31d00000: 494, // ms + 0x31d0003d: 495, // ms-BN + 0x31d000cf: 496, // ms-MY + 0x31d0010c: 497, // ms-SG + 0x31e00000: 498, // mt + 0x31e000ca: 499, // mt-MT + 0x32300000: 500, // mua + 0x32300051: 501, // mua-CM + 0x32f00000: 502, // my + 0x32f000c3: 503, // my-MM + 0x33800000: 504, // mzn + 0x3380009b: 505, // mzn-IR + 0x33f00000: 506, // nah + 0x34300000: 507, // naq + 0x343000d1: 508, // naq-NA + 0x34500000: 509, // nb + 0x345000d9: 510, // nb-NO + 0x3450010f: 511, // nb-SJ + 0x34c00000: 512, // nd + 0x34c00163: 513, // nd-ZW + 0x34e00000: 514, // nds + 0x34e0005f: 515, // nds-DE + 0x34e000d8: 516, // nds-NL + 0x34f00000: 517, // ne + 0x34f00098: 518, // ne-IN + 0x34f000da: 519, // ne-NP + 0x36500000: 520, // nl + 0x3650002f: 521, // nl-AW + 0x36500035: 522, // nl-BE + 0x3650003f: 523, // nl-BQ + 0x3650005a: 524, // nl-CW + 0x365000d8: 525, // nl-NL + 0x36500115: 526, // nl-SR + 0x3650011a: 527, // nl-SX + 0x36600000: 528, // nmg + 0x36600051: 529, // nmg-CM + 0x36800000: 530, // nn + 0x368000d9: 531, // nn-NO + 0x36a00000: 532, // nnh + 0x36a00051: 533, // nnh-CM + 0x36d00000: 534, // no + 0x37300000: 535, // nqo + 0x37400000: 536, // nr + 0x37800000: 537, // nso + 0x37e00000: 538, // nus + 0x37e00116: 539, // nus-SS + 0x38500000: 540, // ny + 0x38700000: 541, // nyn + 0x38700130: 542, // nyn-UG + 0x38e00000: 543, // om + 0x38e0006e: 544, // om-ET + 0x38e000a3: 545, // om-KE + 0x39300000: 546, // or + 0x39300098: 547, // or-IN + 0x39600000: 548, // os + 0x3960007c: 549, // os-GE + 0x39600105: 550, // os-RU + 0x39b00000: 551, // pa + 0x39b05000: 552, // pa-Arab + 0x39b050e7: 553, // pa-Arab-PK + 0x39b2f000: 554, // pa-Guru + 0x39b2f098: 555, // pa-Guru-IN + 0x39f00000: 556, // pap + 0x3b100000: 557, // pl + 0x3b1000e8: 558, // pl-PL + 0x3bb00000: 559, // prg + 0x3bb00001: 560, // prg-001 + 0x3bc00000: 561, // ps + 0x3bc00023: 562, // ps-AF + 0x3be00000: 563, // pt + 0x3be00029: 564, // pt-AO + 0x3be00040: 565, // pt-BR + 0x3be0004d: 566, // pt-CH + 0x3be00059: 567, // pt-CV + 0x3be00085: 568, // pt-GQ + 0x3be0008a: 569, // pt-GW + 0x3be000b6: 570, // pt-LU + 0x3be000c5: 571, // pt-MO + 0x3be000d0: 572, // pt-MZ + 0x3be000ed: 573, // pt-PT + 0x3be00117: 574, // pt-ST + 0x3be00125: 575, // pt-TL + 0x3c200000: 576, // qu + 0x3c20003e: 577, // qu-BO + 0x3c200068: 578, // qu-EC + 0x3c2000e3: 579, // qu-PE + 0x3d200000: 580, // rm + 0x3d20004d: 581, // rm-CH + 0x3d700000: 582, // rn + 0x3d700039: 583, // rn-BI + 0x3da00000: 584, // ro + 0x3da000bb: 585, // ro-MD + 0x3da00103: 586, // ro-RO + 0x3dc00000: 587, // rof + 0x3dc0012e: 588, // rof-TZ + 0x3e000000: 589, // ru + 0x3e000046: 590, // ru-BY + 0x3e0000a4: 591, // ru-KG + 0x3e0000ad: 592, // ru-KZ + 0x3e0000bb: 593, // ru-MD + 0x3e000105: 594, // ru-RU + 0x3e00012f: 595, // ru-UA + 0x3e300000: 596, // rw + 0x3e300106: 597, // rw-RW + 0x3e400000: 598, // rwk + 0x3e40012e: 599, // rwk-TZ + 0x3e900000: 600, // sah + 0x3e900105: 601, // sah-RU + 0x3ea00000: 602, // saq + 0x3ea000a3: 603, // saq-KE + 0x3f100000: 604, // sbp + 0x3f10012e: 605, // sbp-TZ + 0x3fa00000: 606, // sdh + 0x3fb00000: 607, // se + 0x3fb00071: 608, // se-FI + 0x3fb000d9: 609, // se-NO + 0x3fb0010b: 610, // se-SE + 0x3fd00000: 611, // seh + 0x3fd000d0: 612, // seh-MZ + 0x3ff00000: 613, // ses + 0x3ff000c2: 614, // ses-ML + 0x40000000: 615, // sg + 0x4000004b: 616, // sg-CF + 0x40600000: 617, // shi + 0x40652000: 618, // shi-Latn + 0x406520b9: 619, // shi-Latn-MA + 0x406d2000: 620, // shi-Tfng + 0x406d20b9: 621, // shi-Tfng-MA + 0x40a00000: 622, // si + 0x40a000b2: 623, // si-LK + 0x41000000: 624, // sk + 0x41000110: 625, // sk-SK + 0x41400000: 626, // sl + 0x4140010e: 627, // sl-SI + 0x41a00000: 628, // sma + 0x41b00000: 629, // smi + 0x41c00000: 630, // smj + 0x41d00000: 631, // smn + 0x41d00071: 632, // smn-FI + 0x42000000: 633, // sms + 0x42100000: 634, // sn + 0x42100163: 635, // sn-ZW + 0x42700000: 636, // so + 0x42700061: 637, // so-DJ + 0x4270006e: 638, // so-ET + 0x427000a3: 639, // so-KE + 0x42700114: 640, // so-SO + 0x42f00000: 641, // sq + 0x42f00026: 642, // sq-AL + 0x42f000c1: 643, // sq-MK + 0x42f0014c: 644, // sq-XK + 0x43000000: 645, // sr + 0x4301e000: 646, // sr-Cyrl + 0x4301e032: 647, // sr-Cyrl-BA + 0x4301e0bc: 648, // sr-Cyrl-ME + 0x4301e104: 649, // sr-Cyrl-RS + 0x4301e14c: 650, // sr-Cyrl-XK + 0x43052000: 651, // sr-Latn + 0x43052032: 652, // sr-Latn-BA + 0x430520bc: 653, // sr-Latn-ME + 0x43052104: 654, // sr-Latn-RS + 0x4305214c: 655, // sr-Latn-XK + 0x43500000: 656, // ss + 0x43800000: 657, // ssy + 0x43900000: 658, // st + 0x44200000: 659, // sv + 0x44200030: 660, // sv-AX + 0x44200071: 661, // sv-FI + 0x4420010b: 662, // sv-SE + 0x44300000: 663, // sw + 0x4430004a: 664, // sw-CD + 0x443000a3: 665, // sw-KE + 0x4430012e: 666, // sw-TZ + 0x44300130: 667, // sw-UG + 0x44c00000: 668, // syr + 0x44e00000: 669, // ta + 0x44e00098: 670, // ta-IN + 0x44e000b2: 671, // ta-LK + 0x44e000cf: 672, // ta-MY + 0x44e0010c: 673, // ta-SG + 0x45f00000: 674, // te + 0x45f00098: 675, // te-IN + 0x46200000: 676, // teo + 0x462000a3: 677, // teo-KE + 0x46200130: 678, // teo-UG + 0x46900000: 679, // th + 0x46900122: 680, // th-TH + 0x46d00000: 681, // ti + 0x46d0006c: 682, // ti-ER + 0x46d0006e: 683, // ti-ET + 0x46f00000: 684, // tig + 0x47400000: 685, // tk + 0x47400126: 686, // tk-TM + 0x47e00000: 687, // tn + 0x48000000: 688, // to + 0x48000128: 689, // to-TO + 0x48800000: 690, // tr + 0x4880005c: 691, // tr-CY + 0x4880012a: 692, // tr-TR + 0x48c00000: 693, // ts + 0x4a200000: 694, // twq + 0x4a2000d3: 695, // twq-NE + 0x4a700000: 696, // tzm + 0x4a7000b9: 697, // tzm-MA + 0x4aa00000: 698, // ug + 0x4aa00052: 699, // ug-CN + 0x4ac00000: 700, // uk + 0x4ac0012f: 701, // uk-UA + 0x4b200000: 702, // ur + 0x4b200098: 703, // ur-IN + 0x4b2000e7: 704, // ur-PK + 0x4ba00000: 705, // uz + 0x4ba05000: 706, // uz-Arab + 0x4ba05023: 707, // uz-Arab-AF + 0x4ba1e000: 708, // uz-Cyrl + 0x4ba1e136: 709, // uz-Cyrl-UZ + 0x4ba52000: 710, // uz-Latn + 0x4ba52136: 711, // uz-Latn-UZ + 0x4bc00000: 712, // vai + 0x4bc52000: 713, // vai-Latn + 0x4bc520b3: 714, // vai-Latn-LR + 0x4bcd9000: 715, // vai-Vaii + 0x4bcd90b3: 716, // vai-Vaii-LR + 0x4be00000: 717, // ve + 0x4c100000: 718, // vi + 0x4c10013d: 719, // vi-VN + 0x4c700000: 720, // vo + 0x4c700001: 721, // vo-001 + 0x4ca00000: 722, // vun + 0x4ca0012e: 723, // vun-TZ + 0x4cc00000: 724, // wa + 0x4cd00000: 725, // wae + 0x4cd0004d: 726, // wae-CH + 0x4e300000: 727, // wo + 0x4f000000: 728, // xh + 0x4f900000: 729, // xog + 0x4f900130: 730, // xog-UG + 0x50700000: 731, // yav + 0x50700051: 732, // yav-CM + 0x51000000: 733, // yi + 0x51000001: 734, // yi-001 + 0x51600000: 735, // yo + 0x5160003a: 736, // yo-BJ + 0x516000d5: 737, // yo-NG + 0x51d00000: 738, // yue + 0x51d0008c: 739, // yue-HK + 0x52600000: 740, // zgh + 0x526000b9: 741, // zgh-MA + 0x52700000: 742, // zh + 0x52734000: 743, // zh-Hans + 0x52734052: 744, // zh-Hans-CN + 0x5273408c: 745, // zh-Hans-HK + 0x527340c5: 746, // zh-Hans-MO + 0x5273410c: 747, // zh-Hans-SG + 0x52735000: 748, // zh-Hant + 0x5273508c: 749, // zh-Hant-HK + 0x527350c5: 750, // zh-Hant-MO + 0x5273512d: 751, // zh-Hant-TW + 0x52c00000: 752, // zu + 0x52c00160: 753, // zu-ZA } -// Total table size 4550 bytes (4KiB); checksum: B6D49547 +// Total table size 4592 bytes (4KiB); checksum: C25F8AFF diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go index 5c6dcbd94d4..e2da1ab1796 100644 --- a/vendor/golang.org/x/text/language/language.go +++ b/vendor/golang.org/x/text/language/language.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:generate go run maketables.go gen_common.go -output tables.go +//go:generate go run gen.go gen_common.go -output tables.go //go:generate go run gen_index.go // Package language implements BCP 47 language tags and related functionality. @@ -129,8 +129,15 @@ const ( // specific language or locale. All language tag values are guaranteed to be // well-formed. type Tag struct { - lang langID - region regionID + lang langID + region regionID + // TODO: we will soon run out of positions for script. Idea: instead of + // storing lang, region, and script codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. script scriptID pVariant byte // offset in str, includes preceding '-' pExt uint16 // offset of first extension, includes preceding '-' @@ -593,7 +600,7 @@ func (t Tag) Extension(x byte) (ext Extension, ok bool) { return Extension{ext}, true } } - return Extension{string(x)}, false + return Extension{}, false } // Extensions returns all extensions of t. diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index eec72bcc1f0..63bc744a39e 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -6,6 +6,16 @@ package language import "errors" +// A MatchOption configures a Matcher. +type MatchOption func(*matcher) + +// PreferSameScript will, in the absence of a match, result in the first +// preferred tag with the same script as a supported tag to match this supported +// tag. The default is currently true, but this may change in the future. +func PreferSameScript(preferSame bool) MatchOption { + return func(m *matcher) { m.preferSameScript = preferSame } +} + // Matcher is the interface that wraps the Match method. // // Match returns the best match for any of the given tags, along with @@ -36,23 +46,44 @@ func Comprehends(speaker, alternative Tag) Confidence { // matched tag in t, but is augmented with the Unicode extension ('u')of the // corresponding preferred tag. This allows user locale options to be passed // transparently. -func NewMatcher(t []Tag) Matcher { - return newMatcher(t) +func NewMatcher(t []Tag, options ...MatchOption) Matcher { + return newMatcher(t, options) } func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { match, w, c := m.getBest(want...) - if match == nil { - t = m.default_.tag - } else { + if match != nil { t, index = match.tag, match.index + } else { + // TODO: this should be an option + t = m.default_.tag + if m.preferSameScript { + outer: + for _, w := range want { + script, _ := w.Script() + if script.scriptID == 0 { + // Don't do anything if there is no script, such as with + // private subtags. + continue + } + for i, h := range m.supported { + if script.scriptID == h.maxScript { + t, index = h.tag, i + break outer + } + } + } + } + // TODO: select first language tag based on script. + } + if w.region != 0 && t.region != 0 && t.region.contains(w.region) { + t, _ = Raw.Compose(t, Region{w.region}) } // Copy options from the user-provided tag into the result tag. This is hard // to do after the fact, so we do it here. - // TODO: consider also adding in variants that are compatible with the - // matched language. - // TODO: Add back region if it is non-ambiguous? Or create another tag to - // preserve the region? + // TODO: add in alternative variants to -u-va-. + // TODO: add preferred region to -u-rg-. + // TODO: add other extensions. Merge with existing extensions. if u, ok := w.Extension('u'); ok { t, _ = Raw.Compose(t, u) } @@ -388,16 +419,18 @@ func minimizeTags(t Tag) (Tag, error) { // matcher keeps a set of supported language tags, indexed by language. type matcher struct { - default_ *haveTag - index map[langID]*matchHeader - passSettings bool + default_ *haveTag + supported []*haveTag + index map[langID]*matchHeader + passSettings bool + preferSameScript bool } // matchHeader has the lists of tags for exact matches and matches based on // maximized and canonicalized tags for a given language. type matchHeader struct { - exact []haveTag - max []haveTag + exact []*haveTag + max []*haveTag } // haveTag holds a supported Tag and its maximized script and region. The maximized @@ -440,8 +473,10 @@ func makeHaveTag(tag Tag, index int) (haveTag, langID) { // script to map to another and we rely on this to keep the code simple. func altScript(l langID, s scriptID) scriptID { for _, alt := range matchScript { - if (alt.lang == 0 || langID(alt.lang) == l) && scriptID(alt.have) == s { - return scriptID(alt.want) + // TODO: also match cases where language is not the same. + if (langID(alt.wantLang) == l || langID(alt.haveLang) == l) && + scriptID(alt.haveScript) == s { + return scriptID(alt.wantScript) } } return 0 @@ -457,7 +492,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) { } } if exact { - h.exact = append(h.exact, n) + h.exact = append(h.exact, &n) } // Allow duplicate maximized tags, but create a linked list to allow quickly // comparing the equivalents and bail out. @@ -472,7 +507,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) { break } } - h.max = append(h.max, n) + h.max = append(h.max, &n) } // header returns the matchHeader for the given language. It creates one if @@ -486,12 +521,26 @@ func (m *matcher) header(l langID) *matchHeader { return h } +func toConf(d uint8) Confidence { + if d <= 10 { + return High + } + if d < 30 { + return Low + } + return No +} + // newMatcher builds an index for the given supported tags and returns it as // a matcher. It also expands the index by considering various equivalence classes // for a given tag. -func newMatcher(supported []Tag) *matcher { +func newMatcher(supported []Tag, options []MatchOption) *matcher { m := &matcher{ - index: make(map[langID]*matchHeader), + index: make(map[langID]*matchHeader), + preferSameScript: true, + } + for _, o := range options { + o(m) } if len(supported) == 0 { m.default_ = &haveTag{} @@ -502,8 +551,9 @@ func newMatcher(supported []Tag) *matcher { for i, tag := range supported { pair, _ := makeHaveTag(tag, i) m.header(tag.lang).addIfNew(pair, true) + m.supported = append(m.supported, &pair) } - m.default_ = &m.header(supported[0].lang).exact[0] + m.default_ = m.header(supported[0].lang).exact[0] for i, tag := range supported { pair, max := makeHaveTag(tag, i) if max != tag.lang { @@ -511,6 +561,9 @@ func newMatcher(supported []Tag) *matcher { } } + // TODO: include alt script. + // - don't replace regions, but allow regions to be made more specific. + // update is used to add indexes in the map for equivalent languages. // If force is true, the update will also apply to derived entries. To // avoid applying a "transitive closure", use false. @@ -520,7 +573,8 @@ func newMatcher(supported []Tag) *matcher { return } hw := m.header(langID(want)) - for _, v := range hh.max { + for _, ht := range hh.max { + v := *ht if conf < v.conf { v.conf = conf } @@ -536,9 +590,9 @@ func newMatcher(supported []Tag) *matcher { // Add entries for languages with mutual intelligibility as defined by CLDR's // languageMatch data. for _, ml := range matchLang { - update(ml.want, ml.have, Confidence(ml.conf), false) + update(ml.want, ml.have, toConf(ml.distance), false) if !ml.oneway { - update(ml.have, ml.want, Confidence(ml.conf), false) + update(ml.have, ml.want, toConf(ml.distance), false) } } @@ -580,7 +634,7 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { continue } for i := range h.exact { - have := &h.exact[i] + have := h.exact[i] if have.tag.equalsRest(w) { return have, w, Exact } @@ -591,7 +645,7 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { // Base language is not defined. if h != nil { for i := range h.exact { - have := &h.exact[i] + have := h.exact[i] if have.tag.equalsRest(w) { return have, w, Exact } @@ -609,11 +663,11 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { } // Check for match based on maximized tag. for i := range h.max { - have := &h.max[i] + have := h.max[i] best.update(have, w, max.script, max.region) if best.conf == Exact { for have.nextMax != 0 { - have = &h.max[have.nextMax] + have = h.max[have.nextMax] best.update(have, w, max.script, max.region) } return best.have, best.want, High @@ -635,11 +689,12 @@ type bestMatch struct { want Tag conf Confidence // Cached results from applying tie-breaking rules. - origLang bool - origReg bool - regDist uint8 - origScript bool - parentDist uint8 // 255 if have is not an ancestor of want tag. + origLang bool + origReg bool + regGroupDist uint8 + regDist uint8 + origScript bool + parentDist uint8 // 255 if have is not an ancestor of want tag. } // update updates the existing best match if the new pair is considered to be a @@ -693,6 +748,14 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion beaten = true } + regGroupDist := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang) + if !beaten && m.regGroupDist != regGroupDist { + if regGroupDist > m.regGroupDist { + return + } + beaten = true + } + // We prefer if the pre-maximized region was specified and identical. origReg := have.tag.region == tag.region && tag.region != 0 if !beaten && m.origReg != origReg { @@ -702,8 +765,22 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion beaten = true } - // Next we prefer smaller distances between regions, as defined by regionDist. - regDist := regionDist(have.maxRegion, maxRegion, tag.lang) + // TODO: remove the region distance rule. Region distance has been replaced + // by the region grouping rule. For now we leave it as it still seems to + // have a net positive effect when applied after the grouping rule. + // Possible solutions: + // - apply the primary locale rule first to effectively disable region + // region distance if groups are defined. + // - express the following errors in terms of grouping (if possible) + // - find another method of handling the following cases. + // maximization of legacy: find mo in + // "sr-Cyrl, sr-Latn, ro, ro-MD": have ro; want ro-MD (High) + // region distance French: find fr-US in + // "en, fr, fr-CA, fr-CH": have fr; want fr-CA (High) + + // Next we prefer smaller distances between regions, as defined by + // regionDist. + regDist := uint8(regionDistance(have.maxRegion, maxRegion)) if !beaten && m.regDist != regDist { if regDist > m.regDist { return @@ -721,6 +798,9 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion } // Finally we prefer tags which have a closer parent relationship. + // TODO: the parent relationship no longer seems necessary. It doesn't hurt + // to leave it in as the final tie-breaker, though, especially until the + // grouping data has further matured. parentDist := parentDistance(have.tag.region, tag) if !beaten && m.parentDist != parentDist { if parentDist > m.parentDist { @@ -737,6 +817,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion m.origLang = origLang m.origReg = origReg m.origScript = origScript + m.regGroupDist = regGroupDist m.regDist = regDist m.parentDist = parentDist } @@ -759,15 +840,27 @@ func parentDistance(haveRegion regionID, tag Tag) uint8 { return d } -// regionDist wraps regionDistance with some exceptions to the algorithmic distance. -func regionDist(a, b regionID, lang langID) uint8 { - if lang == _en { - // Two variants of non-US English are close to each other, regardless of distance. - if a != _US && b != _US { - return 2 +// regionGroupDist computes the distance between two regions based on their +// CLDR grouping. +func regionGroupDist(a, b regionID, script scriptID, lang langID) uint8 { + aGroup := uint(regionToGroups[a]) << 1 + bGroup := uint(regionToGroups[b]) << 1 + for _, ri := range matchRegion { + if langID(ri.lang) == lang && (ri.script == 0 || scriptID(ri.script) == script) { + group := uint(1 << (ri.group &^ 0x80)) + if 0x80&ri.group == 0 { + if aGroup&bGroup&group != 0 { // Both regions are in the group. + return ri.distance + } + } else { + if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. + return ri.distance + } + } } } - return uint8(regionDistance(a, b)) + const defaultDistance = 4 + return defaultDistance } // regionDistance computes the distance between two regions based on the diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 5de0f856af3..a108554a410 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -1,122 +1,122 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package language import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "29" +const CLDRVersion = "31" const numLanguages = 8654 const numScripts = 230 -const numRegions = 354 +const numRegions = 356 type fromTo struct { from uint16 to uint16 } -const nonCanonicalUnd = 649 +const nonCanonicalUnd = 1199 const ( - _af = 10 - _am = 17 - _ar = 21 - _az = 36 - _bg = 56 - _bn = 75 - _ca = 97 - _cs = 121 - _da = 128 - _de = 133 - _el = 154 - _en = 155 - _es = 157 - _et = 159 - _fa = 164 - _fi = 168 - _fil = 170 - _fr = 175 - _gu = 211 - _he = 224 - _hi = 225 - _hr = 238 - _hu = 242 - _hy = 243 - _id = 248 - _is = 258 - _it = 259 - _ja = 263 - _ka = 273 - _kk = 303 - _km = 307 - _kn = 309 - _ko = 310 - _ky = 333 - _lo = 357 - _lt = 361 - _lv = 368 - _mk = 396 - _ml = 397 - _mn = 399 - _mo = 402 - _mr = 406 - _ms = 410 - _mul = 414 - _my = 421 - _nb = 431 - _ne = 436 - _nl = 445 - _no = 449 - _pa = 471 - _pl = 487 - _pt = 495 - _ro = 515 - _ru = 519 - _sh = 549 - _si = 552 - _sk = 554 - _sl = 556 - _sq = 570 - _sr = 571 - _sv = 583 - _sw = 584 - _ta = 593 - _te = 600 - _th = 605 - _tl = 616 - _tn = 619 - _tr = 623 - _uk = 646 - _ur = 652 - _uz = 653 - _vi = 658 - _zh = 708 - _zu = 710 - _jbo = 265 - _ami = 1033 - _bnn = 1740 - _hak = 221 - _tlh = 13850 - _lb = 340 - _nv = 458 - _pwn = 11438 - _tao = 13571 - _tay = 13581 - _tsu = 14045 - _nn = 447 - _sfb = 13012 - _vgt = 15084 - _sgg = 13043 - _cmn = 2390 - _nan = 428 - _hsn = 240 + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 249 + _da = 256 + _de = 268 + _el = 309 + _en = 312 + _es = 317 + _et = 319 + _fa = 327 + _fi = 336 + _fil = 338 + _fr = 349 + _gu = 418 + _he = 442 + _hi = 444 + _hr = 463 + _hu = 467 + _hy = 469 + _id = 479 + _is = 502 + _it = 503 + _ja = 510 + _ka = 526 + _kk = 576 + _km = 584 + _kn = 591 + _ko = 594 + _ky = 648 + _lo = 694 + _lt = 702 + _lv = 709 + _mk = 765 + _ml = 770 + _mn = 777 + _mo = 782 + _mr = 793 + _ms = 797 + _mul = 804 + _my = 815 + _nb = 837 + _ne = 847 + _nl = 869 + _no = 877 + _pa = 923 + _pl = 945 + _pt = 958 + _ro = 986 + _ru = 992 + _sh = 1029 + _si = 1034 + _sk = 1040 + _sl = 1044 + _sq = 1071 + _sr = 1072 + _sv = 1090 + _sw = 1091 + _ta = 1102 + _te = 1119 + _th = 1129 + _tl = 1144 + _tn = 1150 + _tr = 1160 + _uk = 1196 + _ur = 1202 + _uz = 1210 + _vi = 1217 + _zh = 1319 + _zu = 1324 + _jbo = 513 + _ami = 1647 + _bnn = 2354 + _hak = 436 + _tlh = 14464 + _lb = 659 + _nv = 897 + _pwn = 12052 + _tao = 14185 + _tay = 14195 + _tsu = 14659 + _nn = 872 + _sfb = 13626 + _vgt = 15698 + _sgg = 13657 + _cmn = 3004 + _nan = 833 + _hsn = 465 ) -const langPrivateStart = 0x2d09 +const langPrivateStart = 0x2f6f -const langPrivateEnd = 0x2f10 +const langPrivateEnd = 0x3176 // lang holds an alphabetically sorted list of ISO-639 language identifiers. // All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. @@ -125,72 +125,133 @@ const langPrivateEnd = 0x2f10 // the second and third letter of the 3-letter ISO code. // - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. // For 3-byte language identifiers the 4th byte is 0. -var lang tag.Index = "" + // Size: 2856 bytes - "---\x00aaarabbkabr\x00ace\x00ach\x00ada\x00ady\x00aeveaeb\x00affragq\x00" + - "aho\x00akkaakk\x00aln\x00alt\x00ammhamo\x00anrgaoz\x00arraarc\x00arn\x00" + - "aro\x00arq\x00ary\x00arz\x00assmasa\x00ase\x00ast\x00atj\x00avvaawa\x00a" + - "yymazzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bax\x00bbc\x00bbj\x00bci" + - "\x00beelbej\x00bem\x00bew\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc" + - "\x00bgn\x00bgx\x00bhihbhb\x00bhi\x00bhk\x00bho\x00biisbik\x00bin\x00bjj" + - "\x00bjn\x00bkm\x00bku\x00blt\x00bmambmq\x00bnenboodbpy\x00bqi\x00bqv\x00" + - "brrebra\x00brh\x00brx\x00bsosbsq\x00bss\x00bto\x00btv\x00bua\x00buc\x00b" + - "ug\x00bum\x00bvb\x00byn\x00byv\x00bze\x00caatcch\x00ccp\x00ceheceb\x00cg" + - "g\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00ckb\x00cooscop" + - "\x00cps\x00crrecrj\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd" + - "\x00cuhucvhvcyymdaandak\x00dar\x00dav\x00dcc\x00deeuden\x00dgr\x00dje" + - "\x00dnj\x00doi\x00dsb\x00dtm\x00dtp\x00dty\x00dua\x00dvivdyo\x00dyu\x00d" + - "zzoebu\x00eeweefi\x00egl\x00egy\x00eky\x00elllenngeopoes\x00\x05esu\x00e" + - "tstett\x00euusewo\x00ext\x00faasfan\x00ffulffm\x00fiinfia\x00fil\x00fit" + - "\x00fjijfoaofon\x00frrafrc\x00frp\x00frr\x00frs\x00fud\x00fuq\x00fur\x00" + - "fuv\x00fvr\x00fyrygalegaa\x00gag\x00gan\x00gay\x00gbm\x00gbz\x00gcr\x00g" + - "dlagez\x00ggn\x00gil\x00gjk\x00gju\x00gllgglk\x00gnrngom\x00gon\x00gor" + - "\x00gos\x00got\x00grc\x00grt\x00gsw\x00guujgub\x00guc\x00gur\x00guw\x00g" + - "uz\x00gvlvgvr\x00gwi\x00haauhak\x00haw\x00haz\x00heebhiinhif\x00hil\x00h" + - "lu\x00hmd\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homohoc\x00hoj\x00hrrvhs" + - "b\x00hsn\x00htathuunhyyehzerianaiba\x00ibb\x00idndieleigboiiiiikpkikt" + - "\x00ilo\x00inndinh\x00iodoisslittaiukuiw\x00\x03izh\x00japnjam\x00jbo" + - "\x00jgo\x00ji\x00\x06jmc\x00jml\x00jut\x00jvavjwavkaatkaa\x00kab\x00kac" + - "\x00kaj\x00kam\x00kao\x00kbd\x00kcg\x00kck\x00kde\x00kdt\x00kea\x00ken" + - "\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgp\x00kha\x00khb\x00khn\x00khq\x00k" + - "ht\x00khw\x00kiikkiu\x00kjuakjg\x00kkazkkj\x00klalkln\x00kmhmkmb\x00knan" + - "koorkoi\x00kok\x00kos\x00kpe\x00kraukrc\x00kri\x00krj\x00krl\x00kru\x00k" + - "sasksb\x00ksf\x00ksh\x00kuurkum\x00kvomkvr\x00kvx\x00kw\x00\x01kxm\x00kx" + - "p\x00kyirlaatlab\x00lad\x00lag\x00lah\x00laj\x00lbtzlbe\x00lbw\x00lcp" + - "\x00lep\x00lez\x00lgugliimlif\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lmn" + - "\x00lmo\x00lninloaolol\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy" + - "\x00luz\x00lvavlwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00m" + - "an\x00mas\x00maz\x00mdf\x00mdh\x00mdr\x00men\x00mer\x00mfa\x00mfe\x00mgl" + - "gmgh\x00mgo\x00mgp\x00mgy\x00mhahmirimin\x00mis\x00mkkdmlalmls\x00mnonmn" + - "i\x00mnw\x00moolmoe\x00moh\x00mos\x00mrarmrd\x00mrj\x00mro\x00mssamtltmt" + - "r\x00mua\x00mul\x00mus\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00myyamyv\x00" + - "myx\x00myz\x00mzn\x00naaunah\x00nan\x00nap\x00naq\x00nbobnch\x00nddendc" + - "\x00nds\x00neepnew\x00ngdongl\x00nhe\x00nhw\x00nij\x00niu\x00njo\x00nlld" + - "nmg\x00nnnonnh\x00noornod\x00noe\x00non\x00nqo\x00nrblnsk\x00nso\x00nus" + - "\x00nvavnxq\x00nyyanym\x00nyn\x00nzi\x00occiojjiomrmorriosssosa\x00otk" + - "\x00paanpag\x00pal\x00pam\x00pap\x00pau\x00pcd\x00pcm\x00pdc\x00pdt\x00p" + - "eo\x00pfl\x00phn\x00pilipka\x00pko\x00plolpms\x00pnt\x00pon\x00pra\x00pr" + - "d\x00prg\x00psusptorpuu\x00quuequc\x00qug\x00raj\x00rcf\x00rej\x00rgn" + - "\x00ria\x00rif\x00rjs\x00rkt\x00rmohrmf\x00rmo\x00rmt\x00rmu\x00rnunrng" + - "\x00roonrob\x00rof\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00ryu\x00s" + - "aansaf\x00sah\x00saq\x00sas\x00sat\x00saz\x00sbp\x00scrdsck\x00scn\x00sc" + - "o\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00sei\x00ses\x00sgagsga" + - "\x00sgs\x00sh\x00\x02shi\x00shn\x00siinsid\x00sklkskr\x00sllvsli\x00sly" + - "\x00smmosma\x00smi\x00smj\x00smn\x00smp\x00sms\x00snnasnk\x00soomsou\x00" + - "sqqisrrpsrb\x00srn\x00srr\x00srx\x00ssswssy\x00stotstq\x00suunsuk\x00sus" + - "\x00svweswwaswb\x00swc\x00swg\x00swv\x00sxn\x00syl\x00syr\x00szl\x00taam" + - "taj\x00tbw\x00tcy\x00tdd\x00tdg\x00tdh\x00teeltem\x00teo\x00tet\x00tggkt" + - "hhathl\x00thq\x00thr\x00tiirtig\x00tiv\x00tkuktkl\x00tkr\x00tkt\x00tlglt" + - "ly\x00tmh\x00tnsntoontog\x00tpi\x00trurtru\x00trv\x00tssotsd\x00tsf\x00t" + - "sg\x00tsj\x00ttatttj\x00tts\x00ttt\x00tum\x00tvl\x00twwitwq\x00txg\x00ty" + - "ahtyv\x00tzm\x00udm\x00ugiguga\x00ukkruli\x00umb\x00und\x00unr\x00unx" + - "\x00urrduzzbvai\x00veenvec\x00vep\x00viievic\x00vls\x00vmf\x00vmw\x00voo" + - "lvot\x00vro\x00vun\x00walnwae\x00wal\x00war\x00wbp\x00wbq\x00wbr\x00wls" + - "\x00wni\x00woolwtm\x00wuu\x00xav\x00xcr\x00xhhoxlc\x00xld\x00xmf\x00xmn" + - "\x00xmr\x00xna\x00xnr\x00xog\x00xpr\x00xsa\x00xsr\x00yao\x00yap\x00yav" + - "\x00ybb\x00yiidyooryrl\x00yua\x00yue\x00zahazag\x00zbl\x00zdj\x00zea\x00" + - "zgh\x00zhhozmi\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" +const lang tag.Index = "" + // Size: 5312 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cooscop\x00cps\x00crrecrh\x00crj\x00cr" + + "k\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymdaandad" + + "\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00ddn" + + "\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia\x00d" + + "je\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm\x00dtp" + + "\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00dyo\x00d" + + "yu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00elllema" + + "\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr\x00ett" + + "\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai\x00fan" + + "\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00foaofod" + + "\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00fub\x00f" + + "ud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyrygalega" + + "a\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gbf\x00gbm" + + "\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00gej\x00gel\x00g" + + "ez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju\x00gkn\x00gkp" + + "\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof\x00goi\x00gom" + + "\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw\x00gsw\x00guujg" + + "ub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf\x00gvr\x00gvs" + + "\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00haw\x00haz\x00h" + + "bb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hil\x00hla\x00hl" + + "u\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homohoc\x00hoj\x00" + + "hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian\x00iar\x00iba" + + "\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00ieleife\x00igbo" + + "igb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00ilo\x00imo\x00i" + + "nndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00iws\x00izh\x00i" + + "zi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo\x00ji\x00\x06jib" + + "\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab\x00kac\x00kad\x00" + + "kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq\x00kbx\x00kby\x00kc" + + "g\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt\x00kea\x00ken\x00kez" + + "\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00kha\x00khb\x00khn\x00k" + + "hq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu\x00kiw\x00kjuakjd\x00kj" + + "g\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00klq\x00klt\x00klx\x00kmh" + + "mkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knanknf\x00knp\x00koorkoi\x00" + + "kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo\x00kpr\x00kpx\x00kqb\x00kq" + + "f\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00krl\x00krs\x00kru\x00ksasksb" + + "\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb\x00ktm\x00kto\x00kuurkub\x00k" + + "ud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00kus\x00kvomkvg\x00kvr\x00kvx" + + "\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm\x00kxp\x00kxw\x00kxz\x00ky" + + "irkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag\x00lah\x00laj\x00las\x00lbt" + + "zlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00led\x00lee\x00lem\x00lep\x00l" + + "eq\x00leu\x00lez\x00lguglgg\x00liimlia\x00lid\x00lif\x00lig\x00lih\x00li" + + "j\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln\x00lmn\x00lmo\x00lmp\x00lnin" + + "lns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor\x00los\x00loz\x00lrc\x00ltitl" + + "tg\x00luublua\x00luo\x00luy\x00luz\x00lvavlwl\x00lzh\x00lzz\x00mad\x00ma" + + "f\x00mag\x00mai\x00mak\x00man\x00mas\x00maw\x00maz\x00mbh\x00mbo\x00mbq" + + "\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr\x00mcu\x00mda\x00mde\x00mdf" + + "\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee\x00mek\x00men\x00mer\x00met" + + "\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq\x00mglgmgh\x00mgl\x00mgo\x00m" + + "gp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00min\x00mis\x00miw\x00mkkdmki" + + "\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00mls\x00mmo\x00mmu\x00mmx\x00m" + + "nonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00moe\x00moh\x00mos\x00mox\x00mp" + + "p\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00mrj\x00mro\x00mssamtltmtc" + + "\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00mus\x00mva\x00mvn\x00mvy" + + "\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk\x00mym\x00myv\x00myw\x00m" + + "yx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw\x00mzz\x00naaunac\x00naf" + + "\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00nbobnca\x00nce\x00ncf\x00n" + + "ch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb\x00new\x00nex\x00nfr\x00ng" + + "donga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00nif\x00nii\x00nij\x00nin\x00" + + "niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nlldnmg\x00nmz\x00nnnonnf\x00n" + + "nh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00nop\x00nou\x00nqo\x00nrblnr" + + "b\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr\x00nui\x00nup\x00nus\x00nuv" + + "\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym\x00nyn\x00nzi\x00occiogc\x00" + + "ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00opm\x00orrioro\x00oru\x00osss" + + "osa\x00ota\x00otk\x00ozm\x00paanpag\x00pal\x00pam\x00pap\x00pau\x00pbi" + + "\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo\x00pex\x00pfl\x00phl\x00phn" + + "\x00pilipil\x00pip\x00pka\x00pko\x00plolpla\x00pms\x00png\x00pnn\x00pnt" + + "\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psuspss\x00ptorptp\x00puu\x00pwa" + + "\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rcf\x00rej\x00rel\x00res\x00r" + + "gn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmohrmf\x00rmo\x00rmt\x00rmu" + + "\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00rro\x00rtm\x00ruusrue\x00" + + "rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf\x00sah\x00saq\x00sas\x00sa" + + "t\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrdsck\x00scl\x00scn\x00sco\x00" + + "scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00sei\x00ses\x00sgagsga\x00sgs" + + "\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn\x00shu\x00siinsid\x00sig" + + "\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks\x00sllvsld\x00sli\x00sll" + + "\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp\x00smq\x00sms\x00snnasnc" + + "\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq\x00sou\x00soy\x00spd\x00s" + + "pl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx\x00ssswssd\x00ssg\x00ssy" + + "\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00sur\x00sus\x00svweswwaswb" + + "\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00syl\x00syr\x00szl\x00taamt" + + "aj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf\x00tbg\x00tbo\x00tbw\x00tbz" + + "\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelted\x00tem\x00teo\x00tet\x00t" + + "fi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00thq\x00thr\x00tiirtif\x00tig" + + "\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr\x00tkt\x00tlgltlf\x00tlx" + + "\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00tog\x00toq\x00tpi\x00tpm" + + "\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssotsd\x00tsf\x00tsg\x00tsj" + + "\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts\x00ttt\x00tuh\x00tul\x00t" + + "um\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00twq\x00txg\x00tyahtya\x00ty" + + "v\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli\x00umb\x00und\x00unr\x00unx" + + "\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00uvh\x00uvl\x00uzzbvag\x00vai" + + "\x00van\x00veenvec\x00vep\x00viievic\x00viv\x00vls\x00vmf\x00vmw\x00vool" + + "vot\x00vro\x00vun\x00vut\x00walnwae\x00waj\x00wal\x00wan\x00war\x00wbp" + + "\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg\x00wib\x00wiu\x00wiv\x00wja" + + "\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu\x00woolwob\x00wos\x00wrs\x00w" + + "sk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00xbi\x00xcr\x00xes\x00xhhoxla" + + "\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna\x00xnr\x00xog\x00xon\x00xpr" + + "\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe\x00yam\x00yao\x00yap\x00yas" + + "\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb\x00yby\x00yer\x00ygr\x00ygw" + + "\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00yooryon\x00yrb\x00yre\x00yrl" + + "\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw\x00zahazag\x00zbl\x00zdj\x00z" + + "ea\x00zgh\x00zhhozia\x00zlm\x00zmi\x00zne\x00zuulzxx\x00zza\x00\xff\xff" + + "\xff\xff" -const langNoIndexOffset = 713 +const langNoIndexOffset = 1327 // langNoIndex is a bit vector of all 3-letter language codes that are not used as an index // in lookup tables. The language ids for these language codes are derived directly @@ -198,194 +259,194 @@ const langNoIndexOffset = 713 // Size: 2197 bytes, 2197 elements var langNoIndex = [2197]uint8{ // Entry 0 - 3F - 0xff, 0xfd, 0xfd, 0xfe, 0xef, 0xf7, 0xbf, 0xd2, - 0xfb, 0xbf, 0xfe, 0xfa, 0xb7, 0x1d, 0x3c, 0x57, - 0x6f, 0x97, 0x73, 0xf8, 0xff, 0xef, 0xff, 0x70, - 0xaf, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x85, 0x62, - 0xe9, 0xbf, 0xfd, 0xff, 0xff, 0xf7, 0xfd, 0x77, - 0xbf, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xe3, - 0xc9, 0xff, 0xff, 0xff, 0x4d, 0xb8, 0x0a, 0x6a, - 0x7e, 0xfa, 0xe3, 0xfe, 0x7e, 0xff, 0x77, 0xff, + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, // Entry 40 - 7F - 0xff, 0xff, 0xff, 0xdf, 0x2b, 0xf4, 0xf1, 0xe0, - 0x5d, 0xe7, 0x9f, 0x14, 0x07, 0x20, 0xdf, 0xed, - 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0xf7, - 0x7e, 0xff, 0xff, 0xff, 0xfe, 0x7f, 0xff, 0xff, - 0xff, 0xff, 0x5f, 0xfc, 0xdb, 0xfd, 0xbf, 0xb5, - 0x7b, 0xdf, 0x7f, 0xf7, 0xeb, 0xfe, 0xff, 0xa7, - 0xbd, 0xff, 0x7f, 0xf7, 0xff, 0xef, 0xef, 0xef, - 0xff, 0xff, 0x9f, 0xff, 0xff, 0xef, 0xff, 0xdf, + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xff, 0xff, 0xf3, 0xff, 0xfb, 0x2f, 0xff, 0xff, - 0xfb, 0xee, 0xff, 0xbd, 0xdb, 0xff, 0xdf, 0xf7, - 0xff, 0xfa, 0xfd, 0xff, 0x7e, 0xaf, 0x7b, 0xfe, - 0x7f, 0xff, 0xff, 0xfe, 0xff, 0xff, 0xdf, 0xff, - 0xff, 0xdf, 0xfb, 0xff, 0xfd, 0xfc, 0xfb, 0xff, - 0xff, 0xff, 0xff, 0xf7, 0x7f, 0xbf, 0xfd, 0xd5, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, - 0x08, 0x24, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, - 0x9b, 0x14, 0x88, 0xf6, 0x7b, 0xe7, 0x17, 0x56, - 0x55, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, + 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, + 0x45, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x87, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x40, 0x00, 0x40, 0x92, 0x21, 0xd0, 0xbf, 0x5d, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F - 0xfd, 0xde, 0xfe, 0x5e, 0x00, 0x00, 0x02, 0x64, - 0x8d, 0x19, 0xc1, 0xdf, 0x79, 0x22, 0x00, 0x00, - 0x00, 0xdf, 0x6d, 0xdc, 0x26, 0xe5, 0xd9, 0xf3, + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, - 0x56, 0x89, 0x5e, 0xb7, 0xec, 0xef, 0x03, 0x00, - 0x02, 0x00, 0x00, 0x00, 0xc0, 0x77, 0xda, 0x57, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x79, 0xe0, 0xff, + 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F - 0xff, 0x7f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x56, - 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x16, + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, + 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, - 0x00, 0x00, 0x50, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x53, 0xf5, 0xd4, 0xbd, 0xe2, 0xcd, 0x03, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x17, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x98, 0xa5, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0xb0, 0xfe, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x40, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, // Entry 1C0 - 1FF 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x20, 0x04, 0xa6, 0x08, 0x04, 0x00, 0x08, - 0x81, 0x50, 0x00, 0x00, 0x08, 0x11, 0x86, 0x40, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x06, 0x55, - 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x60, - 0x3b, 0x83, 0x11, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xbe, 0xdf, 0xff, 0xfe, 0xbf, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7e, 0xbf, // Entry 200 - 23F - 0xdf, 0xc7, 0x83, 0x82, 0xc0, 0xff, 0xdf, 0x27, - 0xcf, 0x5f, 0xe7, 0x01, 0x10, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x03, 0xcf, 0xf0, 0xdf, - 0x03, 0xc4, 0x08, 0x10, 0x01, 0x0e, 0x01, 0xe3, - 0x92, 0x54, 0xdb, 0x38, 0xf1, 0x7f, 0xf7, 0x6d, - 0xf9, 0xff, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, - 0x21, 0x12, 0x6c, 0x5f, 0xdd, 0x0f, 0x85, 0x4f, - 0x40, 0x40, 0x00, 0x04, 0xf9, 0xfd, 0xbd, 0xd4, + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xcf, 0xe0, 0xdf, + 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, + 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F - 0xe8, 0x13, 0xf4, 0x27, 0xa3, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x39, 0x02, 0x05, 0x84, 0x00, 0xf0, - 0xbf, 0x7f, 0xda, 0x00, 0x18, 0x04, 0x81, 0x00, - 0x00, 0x00, 0x80, 0x10, 0x94, 0x1c, 0x01, 0x00, + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, - 0x08, 0xb4, 0x7c, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x11, 0x04, 0x04, 0x6c, 0x00, 0x20, 0x70, 0xff, - 0xfb, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x6e, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, // Entry 280 - 2BF 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, - 0xe2, 0xff, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x00, 0xa1, 0x02, 0x60, - 0xe5, 0x48, 0x14, 0x89, 0x20, 0xc0, 0x47, 0x80, - 0x07, 0x00, 0x00, 0x00, 0xcc, 0x50, 0x40, 0x24, - 0x85, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe5, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x88, 0x11, 0x00, 0xd1, 0x6c, 0xee, - 0x50, 0x27, 0x1d, 0x11, 0x69, 0x06, 0x59, 0xe9, - 0x33, 0x08, 0x00, 0x20, 0x05, 0x40, 0x10, 0x00, - 0x00, 0x00, 0x50, 0x44, 0x96, 0x49, 0xd6, 0x5d, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, - 0x08, 0x00, 0x80, 0x00, 0x40, 0x45, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x04, 0x08, - 0xf8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x16, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, // Entry 300 - 33F - 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa2, - 0x01, 0x00, 0x00, 0x00, 0x12, 0x04, 0x00, 0x00, - 0x04, 0x10, 0xf0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, - 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0xc0, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, // Entry 340 - 37F 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, - 0x00, 0x10, 0x00, 0x00, 0x00, 0xf8, 0x85, 0xe3, - 0xdd, 0xff, 0xff, 0xff, 0xbb, 0xff, 0x7f, 0xfb, - 0xff, 0xfc, 0xfe, 0xdf, 0xff, 0xff, 0xff, 0xf6, - 0xfb, 0xfe, 0xf7, 0x1f, 0xff, 0xb3, 0xed, 0xff, - 0xdb, 0xed, 0xff, 0xfe, 0xff, 0xfe, 0xdf, 0xff, - 0xff, 0xff, 0xf7, 0xff, 0xfd, 0xff, 0xff, 0xff, - 0xfd, 0xff, 0xdf, 0xaf, 0x9c, 0xff, 0xfb, 0xff, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, // Entry 380 - 3BF - 0xff, 0xff, 0xff, 0xff, 0xef, 0xd2, 0xbb, 0xdf, - 0xf5, 0xff, 0xff, 0xff, 0xff, 0xff, 0xfe, 0xef, - 0xfd, 0xff, 0xff, 0xf7, 0xfd, 0xff, 0xff, 0xff, - 0xef, 0xdb, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x5f, 0xd3, 0x7b, 0xfd, 0xd9, 0xdf, 0xef, - 0xbc, 0x18, 0x05, 0x2c, 0xff, 0x07, 0xf0, 0xff, - 0xf7, 0x5f, 0x00, 0x08, 0x00, 0xc3, 0x3d, 0x1b, - 0x06, 0xe6, 0x72, 0xf0, 0xdd, 0x3c, 0x7f, 0x44, + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF - 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xfd, 0xff, 0x57, - 0xf2, 0xff, 0x39, 0xff, 0xf2, 0x1e, 0x95, 0xf7, - 0xf7, 0xff, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, 0x84, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, - 0xf9, 0xfd, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, // Entry 400 - 43F - 0xd7, 0x6f, 0xff, 0xff, 0xdf, 0x7d, 0xbb, 0xff, - 0xff, 0xff, 0xf7, 0xf3, 0xef, 0xff, 0xff, 0xf7, - 0xff, 0xdf, 0xdb, 0x7f, 0xff, 0xff, 0x7f, 0xff, - 0xff, 0xff, 0xef, 0xff, 0xbc, 0xff, 0xff, 0xfb, - 0xff, 0xfb, 0xff, 0xde, 0x76, 0xbd, 0xff, 0xf7, - 0xff, 0xff, 0xf7, 0xff, 0xff, 0xdf, 0xf3, 0xfe, - 0xef, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x7f, 0xde, - 0xf7, 0xbb, 0xef, 0xf7, 0xff, 0xfb, 0xbf, 0xdf, + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, // Entry 440 - 47F - 0xfd, 0xfe, 0xff, 0xff, 0xfe, 0xff, 0x5f, 0x7d, - 0x7f, 0xff, 0xff, 0xf7, 0xe5, 0xfc, 0xff, 0xfd, - 0x7f, 0x7f, 0xff, 0x9e, 0xae, 0xff, 0xee, 0xff, - 0x7f, 0xf7, 0x7b, 0x02, 0x82, 0x04, 0xff, 0xf7, - 0xff, 0xbf, 0xd7, 0xef, 0xfe, 0xdf, 0xf7, 0xfe, - 0xe2, 0x8e, 0xe7, 0xff, 0xf7, 0xff, 0x56, 0xbd, - 0xcd, 0xff, 0xfb, 0xff, 0xff, 0xdf, 0xef, 0xff, - 0xe5, 0xdf, 0x7d, 0x0f, 0xa7, 0x51, 0x04, 0x44, + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8e, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x04, 0x44, // Entry 480 - 4BF - 0x13, 0xd0, 0x5d, 0xaf, 0xa6, 0xfd, 0xb9, 0xff, - 0x63, 0x5d, 0x5b, 0xff, 0xff, 0xbf, 0x3f, 0x20, - 0x14, 0x00, 0x57, 0x51, 0x82, 0x65, 0xf5, 0x49, + 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x51, 0x60, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, // Entry 4C0 - 4FF - 0xfd, 0x67, 0x4b, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4c, 0x9d, 0x7b, 0x83, 0x04, 0x62, 0x40, - 0x00, 0x15, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xf9, 0x4f, 0x10, 0x8c, 0xc9, 0x46, 0xde, 0xf7, + 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, - 0x01, 0x40, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x7d, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F - 0xb0, 0xff, 0x79, 0x7a, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x77, 0xed, 0xf1, 0xbf, 0xef, - 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xfc, - 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xf5, 0xff, - 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7f, 0x10, + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, - 0x5f, 0x05, 0x86, 0xef, 0xf5, 0x77, 0xbd, 0x3c, - 0x00, 0x00, 0x00, 0x43, 0x71, 0x42, 0x00, 0x40, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -399,43 +460,43 @@ var langNoIndex = [2197]uint8{ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, - 0x00, 0x00, 0x00, 0x00, 0xf0, 0xde, 0xff, 0xbf, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, - 0x00, 0x30, 0x95, 0xe3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x01, 0x02, 0x00, 0x81, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x7e, 0x02, - 0xaa, 0x10, 0x5d, 0xd8, 0x52, 0x00, 0x80, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x10, 0x02, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x50, 0x02, 0x20, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, - 0x00, 0x1f, 0xdf, 0xf2, 0xfd, 0xff, 0xfd, 0x3f, - 0x9f, 0x18, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x18, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, // Entry 600 - 63F - 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xfd, - 0xb7, 0xf7, 0xff, 0xf3, 0xdf, 0xff, 0x6f, 0xf1, - 0x7b, 0xf1, 0x7f, 0xdf, 0x7f, 0xbf, 0xfe, 0xb7, - 0xee, 0x1c, 0xfb, 0xdb, 0xef, 0xdf, 0xff, 0xfd, - 0x7e, 0xbe, 0x57, 0xff, 0x6f, 0x81, 0x76, 0x1f, - 0xd4, 0x77, 0xf5, 0xfd, 0xff, 0xff, 0xeb, 0xfe, - 0xbf, 0x5f, 0x57, 0x1b, 0xeb, 0x5f, 0x50, 0x18, - 0x02, 0xfa, 0xff, 0x9d, 0x15, 0x97, 0x15, 0x0f, + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, // Entry 640 - 67F - 0x75, 0xc4, 0x7d, 0x81, 0x82, 0xf1, 0xd7, 0x7e, - 0xff, 0xff, 0xff, 0xef, 0xff, 0xfd, 0xdd, 0xde, - 0xfc, 0xfd, 0xf6, 0x5f, 0x7a, 0x1f, 0x40, 0x98, - 0x02, 0xff, 0xe3, 0xff, 0xf3, 0xd6, 0xf2, 0xff, - 0xfb, 0xdf, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, - 0xf5, 0xbe, 0xff, 0xff, 0xf3, 0xf7, 0xff, 0xf7, - 0x7f, 0xff, 0xff, 0xbe, 0xdb, 0xf7, 0xd7, 0xf9, - 0xef, 0x2f, 0x80, 0xbf, 0xc5, 0xff, 0xff, 0xf3, + 0x75, 0xc4, 0x7d, 0x81, 0x82, 0xf1, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF - 0x97, 0x9d, 0xff, 0xff, 0xf7, 0xcf, 0xfd, 0xbf, - 0xde, 0x7f, 0x06, 0x1d, 0x57, 0xff, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x16, 0xb9, 0xea, 0x69, 0xa0, - 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x48, + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, @@ -443,64 +504,64 @@ var langNoIndex = [2197]uint8{ // Entry 6C0 - 6FF 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, - 0x00, 0xdc, 0xff, 0xeb, 0x1f, 0x58, 0x08, 0x41, - 0x04, 0xa0, 0x04, 0x00, 0x30, 0x12, 0x40, 0x22, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, + 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xaf, - 0x6f, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x02, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x81, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F - 0x00, 0x00, 0x00, 0xef, 0xf7, 0xfd, 0xcf, 0x7e, - 0xa0, 0x11, 0x10, 0x00, 0x00, 0x92, 0x01, 0x44, - 0xcd, 0xf9, 0x5e, 0x00, 0x01, 0x00, 0x30, 0x14, - 0x04, 0x55, 0x10, 0x01, 0x04, 0xf6, 0x3f, 0x7a, - 0x05, 0x04, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, - 0x97, 0x7c, 0x9f, 0x71, 0xcc, 0x78, 0xd1, 0x43, - 0xf5, 0x57, 0x67, 0x14, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2c, 0xf7, 0xdb, 0x1f, 0x54, 0x60, + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xa0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, + 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0xaa, 0x01, - 0x00, 0x00, 0x30, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, - 0xf5, 0xff, 0xd5, 0xd7, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x00, 0xa4, 0x84, 0xe9, 0x41, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x00, 0xa4, 0x84, 0xa9, 0x41, 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, - 0xff, 0xef, 0xff, 0x4f, 0x85, 0x53, 0xf4, 0xed, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF - 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xf5, 0x42, - 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0xc0, 0x56, - 0xcc, 0x16, 0x9e, 0xfb, 0x35, 0x7d, 0xef, 0xff, - 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x5d, + 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, + 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, - 0x10, 0x20, 0x24, 0x00, 0xff, 0x3f, 0xdf, 0x67, - 0xfe, 0x01, 0x06, 0x88, 0x0a, 0x40, 0x16, 0x01, - 0x01, 0x15, 0x2b, 0x3e, 0x01, 0x00, 0x00, 0x10, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F - 0x90, 0x69, 0x45, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa7, 0xd1, - 0x54, 0x9e, 0x44, 0xdf, 0xfd, 0x8f, 0x66, 0xb3, - 0x55, 0x20, 0xd4, 0xc3, 0xd8, 0x30, 0x3d, 0x80, - 0x00, 0x00, 0x00, 0x4c, 0xd4, 0x11, 0xc5, 0x84, - 0x6e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbf, 0xdb, + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, - 0x84, 0x00, 0x33, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0xc8, 0x14, 0xf1, - 0xef, 0xff, 0x7f, 0x16, 0x01, 0x01, 0x84, 0x50, + 0x84, 0x00, 0x23, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, // Entry 880 - 8BF @@ -512,194 +573,196 @@ var langNoIndex = [2197]uint8{ // altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives // to 2-letter language codes that cannot be derived using the method described above. // Each 3-letter code is followed by its 1-byte langID. -var altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" // altLangIndex is used to convert indexes in altLangISO3 to langIDs. // Size: 12 bytes, 6 elements var altLangIndex = [6]uint16{ - 0x014a, 0x0225, 0x0105, 0x020a, 0x009d, 0x010b, + 0x027f, 0x0405, 0x01f9, 0x03e3, 0x013d, 0x0206, } // langAliasMap maps langIDs to their suggested replacements. -// Size: 640 bytes, 160 elements -var langAliasMap = [160]fromTo{ - 0: {from: 0xc4, to: 0xda}, - 1: {from: 0xff, to: 0xf8}, - 2: {from: 0x105, to: 0xe0}, - 3: {from: 0x10b, to: 0x2b9}, - 4: {from: 0x110, to: 0x10f}, - 5: {from: 0x192, to: 0x203}, - 6: {from: 0x1af, to: 0x1c1}, - 7: {from: 0x225, to: 0x23b}, - 8: {from: 0x268, to: 0xaa}, - 9: {from: 0x274, to: 0x252}, - 10: {from: 0x27d, to: 0xd}, - 11: {from: 0x2d5, to: 0x2db}, - 12: {from: 0x326, to: 0x93}, - 13: {from: 0x3c7, to: 0x1c48}, - 14: {from: 0x3e8, to: 0x23a}, - 15: {from: 0x3f9, to: 0x23a}, - 16: {from: 0x484, to: 0x15}, - 17: {from: 0x48f, to: 0xf3}, - 18: {from: 0x4d5, to: 0x1f38}, - 19: {from: 0x54a, to: 0x23}, - 20: {from: 0x550, to: 0x2732}, - 21: {from: 0x55c, to: 0x24}, - 22: {from: 0x57d, to: 0xa1}, - 23: {from: 0x5a3, to: 0x26}, - 24: {from: 0x5ac, to: 0x42}, - 25: {from: 0x615, to: 0x5a7}, - 26: {from: 0x65a, to: 0xc7a}, - 27: {from: 0x786, to: 0x1a5}, - 28: {from: 0x7cd, to: 0x16e}, - 29: {from: 0x7d4, to: 0x59}, - 30: {from: 0x855, to: 0x30b9}, - 31: {from: 0x8cf, to: 0x2c4}, - 32: {from: 0x90c, to: 0x23f1}, - 33: {from: 0x915, to: 0x95a}, - 34: {from: 0x932, to: 0x24f}, - 35: {from: 0x953, to: 0x3fc0}, - 36: {from: 0x956, to: 0x2c4}, - 37: {from: 0x995, to: 0x2b3e}, - 38: {from: 0x9c5, to: 0x2f18}, - 39: {from: 0xa50, to: 0x73}, - 40: {from: 0xa9f, to: 0x79}, - 41: {from: 0xb5f, to: 0x8a}, - 42: {from: 0xb6e, to: 0x1a2}, - 43: {from: 0xb8f, to: 0xb92}, - 44: {from: 0xb95, to: 0x2c8}, - 45: {from: 0xc76, to: 0x1df1}, - 46: {from: 0xc85, to: 0x2c31}, - 47: {from: 0xcd0, to: 0x1bd}, - 48: {from: 0xe67, to: 0x9f}, - 49: {from: 0xe9b, to: 0x179}, - 50: {from: 0xf37, to: 0xfc}, - 51: {from: 0x1010, to: 0xd}, - 52: {from: 0x11bb, to: 0xaf}, - 53: {from: 0x1207, to: 0xa6}, - 54: {from: 0x12b6, to: 0xb32}, - 55: {from: 0x12ba, to: 0x1d2}, - 56: {from: 0x12c9, to: 0x145c}, - 57: {from: 0x1317, to: 0x111}, - 58: {from: 0x131a, to: 0x85}, - 59: {from: 0x133a, to: 0x3a46}, - 60: {from: 0x1401, to: 0xcc}, - 61: {from: 0x145f, to: 0x9a}, - 62: {from: 0x1497, to: 0x278f}, - 63: {from: 0x14af, to: 0xca}, - 64: {from: 0x14be, to: 0xcd6}, - 65: {from: 0x1511, to: 0x12bb}, - 66: {from: 0x15a0, to: 0x154d}, - 67: {from: 0x15ad, to: 0x168a}, - 68: {from: 0x1621, to: 0x23f}, - 69: {from: 0x1710, to: 0x1a98}, - 70: {from: 0x180b, to: 0x2947}, - 71: {from: 0x1821, to: 0x102}, - 72: {from: 0x18f1, to: 0x104}, - 73: {from: 0x191d, to: 0x12ac}, - 74: {from: 0x1dcf, to: 0x3548}, - 75: {from: 0x1dd4, to: 0x1e74}, - 76: {from: 0x1df1, to: 0x18f}, - 77: {from: 0x1e7a, to: 0x145}, - 78: {from: 0x1e85, to: 0x13b}, - 79: {from: 0x1e89, to: 0x122}, - 80: {from: 0x1e90, to: 0x138}, - 81: {from: 0x1ea6, to: 0x1f82}, - 82: {from: 0x1ecc, to: 0x147}, - 83: {from: 0x1f30, to: 0x8d}, - 84: {from: 0x1f65, to: 0x12f8}, - 85: {from: 0x1f7d, to: 0x4235}, - 86: {from: 0x1f8b, to: 0x371a}, - 87: {from: 0x1fc4, to: 0x8d}, - 88: {from: 0x1fce, to: 0x8d}, - 89: {from: 0x1ff9, to: 0x6c1}, - 90: {from: 0x20ad, to: 0x2fbd}, - 91: {from: 0x2119, to: 0x30fc}, - 92: {from: 0x2209, to: 0x170}, - 93: {from: 0x227b, to: 0x18c}, - 94: {from: 0x2287, to: 0x189}, - 95: {from: 0x2291, to: 0x19a}, - 96: {from: 0x22e7, to: 0x8f2}, - 97: {from: 0x2340, to: 0x69}, - 98: {from: 0x23d5, to: 0x179}, - 99: {from: 0x2460, to: 0x244b}, - 100: {from: 0x2490, to: 0x1f4}, - 101: {from: 0x24be, to: 0x3a46}, - 102: {from: 0x24fc, to: 0x244b}, - 103: {from: 0x2520, to: 0x40ef}, - 104: {from: 0x2686, to: 0x25ce}, - 105: {from: 0x26ab, to: 0x1b4}, - 106: {from: 0x271d, to: 0x2b3e}, - 107: {from: 0x28b1, to: 0x1d1}, - 108: {from: 0x2993, to: 0x1d3}, - 109: {from: 0x29d6, to: 0x3a46}, - 110: {from: 0x2a93, to: 0x1ee}, - 111: {from: 0x2aaa, to: 0x32e}, - 112: {from: 0x2ade, to: 0xa4}, - 113: {from: 0x2adf, to: 0xa4}, - 114: {from: 0x2b96, to: 0x183}, - 115: {from: 0x2b9f, to: 0x1763}, - 116: {from: 0x2bb1, to: 0x2b2c}, - 117: {from: 0x2bb8, to: 0x152}, - 118: {from: 0x2beb, to: 0x37}, - 119: {from: 0x2bfc, to: 0x2019}, - 120: {from: 0x2c37, to: 0x2c32}, - 121: {from: 0x2c86, to: 0x2c6e}, - 122: {from: 0x2f2a, to: 0x1f1}, - 123: {from: 0x30fd, to: 0x3125}, - 124: {from: 0x31c1, to: 0x203}, - 125: {from: 0x3285, to: 0x1667}, - 126: {from: 0x337d, to: 0x22a}, - 127: {from: 0x33ef, to: 0x132}, - 128: {from: 0x340d, to: 0x215}, - 129: {from: 0x3494, to: 0x248}, - 130: {from: 0x3557, to: 0x8d}, - 131: {from: 0x35ad, to: 0x3689}, - 132: {from: 0x35c2, to: 0x2a32}, - 133: {from: 0x35c6, to: 0x4c}, - 134: {from: 0x35c9, to: 0x2fbf}, - 135: {from: 0x3603, to: 0x373d}, - 136: {from: 0x3629, to: 0x3d57}, - 137: {from: 0x363c, to: 0x376e}, - 138: {from: 0x364b, to: 0x1d3b}, - 139: {from: 0x364c, to: 0x2c31}, - 140: {from: 0x36f3, to: 0x26a}, - 141: {from: 0x38e5, to: 0xb28}, - 142: {from: 0x390f, to: 0xe91}, - 143: {from: 0x3a30, to: 0x28d}, - 144: {from: 0x3d54, to: 0x7f}, - 145: {from: 0x3f9f, to: 0x828}, - 146: {from: 0x4055, to: 0x30a}, - 147: {from: 0x4090, to: 0x3cf7}, - 148: {from: 0x410f, to: 0x13a}, - 149: {from: 0x4162, to: 0x3462}, - 150: {from: 0x4164, to: 0x86}, - 151: {from: 0x4246, to: 0x30b9}, - 152: {from: 0x427a, to: 0x2b9}, - 153: {from: 0x4361, to: 0x21a0}, - 154: {from: 0x4374, to: 0x2473}, - 155: {from: 0x43a7, to: 0x4645}, - 156: {from: 0x4445, to: 0x4437}, - 157: {from: 0x44d5, to: 0x44dc}, - 158: {from: 0x46ad, to: 0x19a}, - 159: {from: 0x473e, to: 0x2be}, +// Size: 644 bytes, 161 elements +var langAliasMap = [161]fromTo{ + 0: {from: 0x82, to: 0x88}, + 1: {from: 0x185, to: 0x1ac}, + 2: {from: 0x1f1, to: 0x1df}, + 3: {from: 0x1f9, to: 0x1ba}, + 4: {from: 0x206, to: 0x510}, + 5: {from: 0x20d, to: 0x20c}, + 6: {from: 0x30e, to: 0x3da}, + 7: {from: 0x345, to: 0x36d}, + 8: {from: 0x405, to: 0x430}, + 9: {from: 0x478, to: 0x152}, + 10: {from: 0x48e, to: 0x44f}, + 11: {from: 0x4a0, to: 0x21}, + 12: {from: 0x53b, to: 0x541}, + 13: {from: 0x58c, to: 0x12c}, + 14: {from: 0x62d, to: 0x1eae}, + 15: {from: 0x64e, to: 0x42f}, + 16: {from: 0x65f, to: 0x42f}, + 17: {from: 0x6ea, to: 0x3a}, + 18: {from: 0x6f5, to: 0x1d5}, + 19: {from: 0x73b, to: 0x219e}, + 20: {from: 0x7b0, to: 0x56}, + 21: {from: 0x7b6, to: 0x2998}, + 22: {from: 0x7c2, to: 0x58}, + 23: {from: 0x7e3, to: 0x144}, + 24: {from: 0x809, to: 0x5a}, + 25: {from: 0x812, to: 0x8d}, + 26: {from: 0x87b, to: 0x80d}, + 27: {from: 0x8c0, to: 0xee0}, + 28: {from: 0x9ec, to: 0x32f}, + 29: {from: 0xa33, to: 0x2c3}, + 30: {from: 0xa3a, to: 0xbf}, + 31: {from: 0xabb, to: 0x331f}, + 32: {from: 0xb35, to: 0x527}, + 33: {from: 0xb72, to: 0x2657}, + 34: {from: 0xb7b, to: 0xbc0}, + 35: {from: 0xb98, to: 0x44c}, + 36: {from: 0xbb9, to: 0x4226}, + 37: {from: 0xbbc, to: 0x527}, + 38: {from: 0xbfb, to: 0x2da4}, + 39: {from: 0xc2b, to: 0x317e}, + 40: {from: 0xcb6, to: 0xf2}, + 41: {from: 0xd05, to: 0xf9}, + 42: {from: 0xdc5, to: 0x119}, + 43: {from: 0xdd4, to: 0x32b}, + 44: {from: 0xdf5, to: 0xdf8}, + 45: {from: 0xdfb, to: 0x52e}, + 46: {from: 0xedc, to: 0x2057}, + 47: {from: 0xeeb, to: 0x2e97}, + 48: {from: 0xf36, to: 0x365}, + 49: {from: 0x10cd, to: 0x13f}, + 50: {from: 0x1101, to: 0x2ce}, + 51: {from: 0x119d, to: 0x1ea}, + 52: {from: 0x1276, to: 0x21}, + 53: {from: 0x1421, to: 0x15d}, + 54: {from: 0x146d, to: 0x14d}, + 55: {from: 0x151c, to: 0xd98}, + 56: {from: 0x1520, to: 0x38e}, + 57: {from: 0x152f, to: 0x19d}, + 58: {from: 0x157d, to: 0x20e}, + 59: {from: 0x1580, to: 0x10c}, + 60: {from: 0x15a0, to: 0x3cac}, + 61: {from: 0x1667, to: 0x199}, + 62: {from: 0x16c5, to: 0x135}, + 63: {from: 0x16fd, to: 0x29f5}, + 64: {from: 0x1715, to: 0x192}, + 65: {from: 0x1724, to: 0xf3c}, + 66: {from: 0x1777, to: 0x1521}, + 67: {from: 0x1806, to: 0x17b3}, + 68: {from: 0x1813, to: 0x18f0}, + 69: {from: 0x1887, to: 0x434}, + 70: {from: 0x1976, to: 0x1cfe}, + 71: {from: 0x1a71, to: 0x2bad}, + 72: {from: 0x1a87, to: 0x1f6}, + 73: {from: 0x1b57, to: 0x1f8}, + 74: {from: 0x1b83, to: 0x1512}, + 75: {from: 0x2035, to: 0x37ae}, + 76: {from: 0x203a, to: 0x20da}, + 77: {from: 0x2057, to: 0x309}, + 78: {from: 0x20e0, to: 0x272}, + 79: {from: 0x20eb, to: 0x261}, + 80: {from: 0x20ef, to: 0x22b}, + 81: {from: 0x20f6, to: 0x254}, + 82: {from: 0x210c, to: 0x21e8}, + 83: {from: 0x2132, to: 0x27b}, + 84: {from: 0x2196, to: 0x120}, + 85: {from: 0x21cb, to: 0x155e}, + 86: {from: 0x21e3, to: 0x502}, + 87: {from: 0x21f1, to: 0x49d}, + 88: {from: 0x222a, to: 0x120}, + 89: {from: 0x2234, to: 0x120}, + 90: {from: 0x225f, to: 0x927}, + 91: {from: 0x2313, to: 0x3223}, + 92: {from: 0x237f, to: 0x3362}, + 93: {from: 0x246f, to: 0x2c5}, + 94: {from: 0x24e1, to: 0x2fd}, + 95: {from: 0x24ed, to: 0x2f8}, + 96: {from: 0x24f7, to: 0x31d}, + 97: {from: 0x254d, to: 0xb58}, + 98: {from: 0x25a6, to: 0xe2}, + 99: {from: 0x263b, to: 0x2ce}, + 100: {from: 0x26c6, to: 0x26b1}, + 101: {from: 0x26f6, to: 0x3c6}, + 102: {from: 0x2724, to: 0x3cac}, + 103: {from: 0x2762, to: 0x26b1}, + 104: {from: 0x2786, to: 0x4355}, + 105: {from: 0x28ec, to: 0x2834}, + 106: {from: 0x2911, to: 0x34f}, + 107: {from: 0x2983, to: 0x2da4}, + 108: {from: 0x2b17, to: 0x38b}, + 109: {from: 0x2bf9, to: 0x393}, + 110: {from: 0x2c3c, to: 0x3cac}, + 111: {from: 0x2cf9, to: 0x3bc}, + 112: {from: 0x2d10, to: 0x594}, + 113: {from: 0x2d44, to: 0x147}, + 114: {from: 0x2d45, to: 0x147}, + 115: {from: 0x2dfc, to: 0x2ef}, + 116: {from: 0x2e05, to: 0x19c9}, + 117: {from: 0x2e17, to: 0x2d92}, + 118: {from: 0x2e1e, to: 0x290}, + 119: {from: 0x2e51, to: 0x7d}, + 120: {from: 0x2e62, to: 0x227f}, + 121: {from: 0x2e9d, to: 0x2e98}, + 122: {from: 0x2eec, to: 0x2ed4}, + 123: {from: 0x3190, to: 0x3c2}, + 124: {from: 0x3363, to: 0x338b}, + 125: {from: 0x3427, to: 0x3da}, + 126: {from: 0x34eb, to: 0x18cd}, + 127: {from: 0x35e3, to: 0x410}, + 128: {from: 0x3655, to: 0x244}, + 129: {from: 0x3673, to: 0x3f2}, + 130: {from: 0x36fa, to: 0x443}, + 131: {from: 0x37bd, to: 0x120}, + 132: {from: 0x3813, to: 0x38ef}, + 133: {from: 0x3828, to: 0x2c98}, + 134: {from: 0x382c, to: 0xa9}, + 135: {from: 0x382f, to: 0x3225}, + 136: {from: 0x3869, to: 0x39a3}, + 137: {from: 0x388f, to: 0x3fbd}, + 138: {from: 0x38a2, to: 0x39d4}, + 139: {from: 0x38b1, to: 0x1fa1}, + 140: {from: 0x38b2, to: 0x2e97}, + 141: {from: 0x3959, to: 0x47c}, + 142: {from: 0x3b4b, to: 0xd8e}, + 143: {from: 0x3b75, to: 0x136}, + 144: {from: 0x3c96, to: 0x4ba}, + 145: {from: 0x3fba, to: 0xff}, + 146: {from: 0x4205, to: 0xa8e}, + 147: {from: 0x42bb, to: 0x570}, + 148: {from: 0x42f6, to: 0x3f5d}, + 149: {from: 0x4375, to: 0x258}, + 150: {from: 0x43c8, to: 0x36c8}, + 151: {from: 0x43ca, to: 0x10e}, + 152: {from: 0x44ac, to: 0x331f}, + 153: {from: 0x44e0, to: 0x510}, + 154: {from: 0x45c7, to: 0x2406}, + 155: {from: 0x45da, to: 0x26d9}, + 156: {from: 0x460d, to: 0x48ab}, + 157: {from: 0x46ab, to: 0x469d}, + 158: {from: 0x473b, to: 0x4742}, + 159: {from: 0x4913, to: 0x31d}, + 160: {from: 0x49a4, to: 0x521}, } -// Size: 160 bytes, 160 elements -var langAliasTypes = [160]langAliasType{ +// Size: 161 bytes, 161 elements +var langAliasTypes = [161]langAliasType{ // Entry 0 - 3F - 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, 1, - 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, 2, - 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, 2, - 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, 1, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, + 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, + 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, + 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, // Entry 40 - 7F - 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 1, 1, 1, 1, - 1, 0, 1, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 2, 2, 2, - 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1, 0, - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 2, 1, + 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 1, 1, 1, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 2, 2, + 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1, + 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 2, // Entry 80 - BF - 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, - 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 1, 1, + 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0, + 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 1, + 1, } const ( @@ -717,7 +780,7 @@ const ( // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -var script tag.Index = "" + // Size: 928 bytes +const script tag.Index = "" + // Size: 928 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCprtCyrlCyrsDevaDsrtDuplEgyd" + "EgyhEgypElbaEthiGeokGeorGlagGothGranGrekGujrGuruHanbHangHaniHanoHansHant" + @@ -735,110 +798,195 @@ var script tag.Index = "" + // Size: 928 bytes // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. -// Size: 713 bytes, 713 elements -var suppressScript = [713]uint8{ +// Size: 1327 bytes, 1327 elements +var suppressScript = [1327]uint8{ // Entry 0 - 3F - 0x00, 0x00, 0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x27, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 40 - 7F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - // Entry 80 - BF - 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, - 0xd4, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2d, 0x52, 0x52, 0x52, 0x00, 0x52, - 0x00, 0x52, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, 0x52, - 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry C0 - FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x2e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x37, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x52, - 0x00, 0x52, 0x52, 0x08, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - // Entry 100 - 13F - 0x00, 0x00, 0x52, 0x52, 0x00, 0x37, 0x00, 0x41, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x29, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, - 0x00, 0x52, 0x00, 0x46, 0x00, 0x4a, 0x4b, 0x00, - 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x4f, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - // Entry 180 - 1BF - 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x1e, 0x64, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x20, 0x00, - 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x52, 0x00, 0x52, 0x20, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00, 0x52, - // Entry 1C0 - 1FF - 0x00, 0x52, 0x00, 0x00, 0x00, 0x70, 0x52, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x75, 0x00, 0x00, 0x00, 0x2f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x52, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - // Entry 200 - 23F - 0x00, 0x52, 0x00, 0x52, 0x00, 0x00, 0x00, 0x1e, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x27, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc1, 0x00, 0x52, 0x00, 0x52, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 240 - 27F - 0x52, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xcd, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xd0, 0x52, 0x00, 0x00, 0x00, 0xd5, 0x00, 0x00, - 0x00, 0x27, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x52, 0x00, 0x52, 0x52, 0x52, 0x00, 0x52, 0x52, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x52, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + // Entry 100 - 13F + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd4, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x2d, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00, 0x52, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x05, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x37, 0x00, 0x20, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x52, 0x00, 0x52, 0x52, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x52, + 0x00, 0x37, 0x00, 0x00, 0x00, 0x00, 0x41, 0x00, + // Entry 200 - 23F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4a, + 0x00, 0x00, 0x4b, 0x00, 0x20, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x4f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + // Entry 2C0 - 2FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, + // Entry 300 - 33F + 0x00, 0x00, 0x64, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x20, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x6b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x70, 0x52, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x2f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x52, 0x00, + // Entry 3C0 - 3FF + 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x37, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 2C0 - 2FF - 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, + 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xcd, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd0, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xd5, 0x00, 0x00, 0x00, 0x27, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00, + // Entry 480 - 4BF + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + // Entry 4C0 - 4FF + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x37, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, } const ( @@ -847,15 +995,15 @@ const ( _BR = 64 _CA = 72 _ES = 109 - _GB = 121 - _MD = 186 - _PT = 236 - _UK = 304 - _US = 306 - _ZZ = 354 - _XA = 320 - _XC = 322 - _XK = 330 + _GB = 122 + _MD = 187 + _PT = 237 + _UK = 305 + _US = 308 + _ZZ = 356 + _XA = 322 + _XC = 324 + _XK = 332 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -864,8 +1012,8 @@ const ( const isoRegionOffset = 31 // regionTypes defines the status of a region for various standards. -// Size: 355 bytes, 355 elements -var regionTypes = [355]uint8{ +// Size: 357 bytes, 357 elements +var regionTypes = [357]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -882,41 +1030,41 @@ var regionTypes = [355]uint8{ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, // Entry C0 - FF + 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, - 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F + 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x02, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, // Entry 140 - 17F + 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x04, 0x06, 0x06, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, 0x04, + 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -924,68 +1072,68 @@ var regionTypes = [355]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -var regionISO tag.Index = "" + // Size: 1300 bytes +const regionISO tag.Index = "" + // Size: 1308 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03FIINFJJIFKLKFMSMFOROFQ" + - "\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGRRC" + - "GS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSRIM" + - "MNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00\x09" + - "KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTULUUX" + - "LVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQMRRT" + - "MSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOORNPPL" + - "NQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00\x12" + - "PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTTQU" + - "\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYCSD" + - "DNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYRSZ" + - "WZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTVUV" + - "TWWNTZZAUAKRUGGAUK UMMIUSSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVUUTWFLF" + - "WKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXOOOXPPP" + - "XQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAFZMMBZR" + - "ARZWWEZZZZ\xff\xff\xff\xff" + "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + + "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + + "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + + "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + + "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + + "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + + "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + + "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + + "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + + "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + + "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + + "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + + "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + + "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + + "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + + "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. -var altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // altRegionIDs holds a list of regionIDs the positions of which match those // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0056, 0x006f, 0x0086, 0x00a6, 0x00a8, 0x00ab, 0x00e8, 0x0103, - 0x011f, 0x015c, 0x00da, + 0x0056, 0x006f, 0x0087, 0x00a7, 0x00a9, 0x00ac, 0x00e9, 0x0104, + 0x0120, 0x015e, 0x00db, } // Size: 80 bytes, 20 elements var regionOldMap = [20]fromTo{ - 0: {from: 0x43, to: 0xc2}, - 1: {from: 0x57, to: 0xa5}, + 0: {from: 0x43, to: 0xc3}, + 1: {from: 0x57, to: 0xa6}, 2: {from: 0x5e, to: 0x5f}, 3: {from: 0x65, to: 0x3a}, - 4: {from: 0x77, to: 0x76}, - 5: {from: 0x91, to: 0x36}, - 6: {from: 0xa1, to: 0x131}, - 7: {from: 0xbf, to: 0x131}, - 8: {from: 0xd5, to: 0x13c}, - 9: {from: 0xda, to: 0x2a}, - 10: {from: 0xed, to: 0x131}, - 11: {from: 0xf0, to: 0xe0}, - 12: {from: 0xfa, to: 0x6f}, - 13: {from: 0x101, to: 0x161}, - 14: {from: 0x128, to: 0x124}, - 15: {from: 0x130, to: 0x79}, - 16: {from: 0x137, to: 0x13b}, - 17: {from: 0x13e, to: 0x131}, - 18: {from: 0x15a, to: 0x15b}, - 19: {from: 0x160, to: 0x4a}, + 4: {from: 0x78, to: 0x77}, + 5: {from: 0x92, to: 0x36}, + 6: {from: 0xa2, to: 0x132}, + 7: {from: 0xc0, to: 0x132}, + 8: {from: 0xd6, to: 0x13e}, + 9: {from: 0xdb, to: 0x2a}, + 10: {from: 0xee, to: 0x132}, + 11: {from: 0xf1, to: 0xe1}, + 12: {from: 0xfb, to: 0x6f}, + 13: {from: 0x102, to: 0x163}, + 14: {from: 0x129, to: 0x125}, + 15: {from: 0x131, to: 0x7a}, + 16: {from: 0x139, to: 0x13d}, + 17: {from: 0x140, to: 0x132}, + 18: {from: 0x15c, to: 0x15d}, + 19: {from: 0x162, to: 0x4a}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 710 bytes, 355 elements -var m49 = [355]int16{ +// Size: 714 bytes, 357 elements +var m49 = [357]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1002,41 +1150,41 @@ var m49 = [355]int16{ 192, 132, 531, 162, 196, 203, 278, 276, 0, 262, 208, 212, 214, 204, 12, 0, 218, 233, 818, 732, 232, 724, 231, 967, - 246, 242, 238, 583, 234, 0, 250, 249, - 266, 826, 308, 268, 254, 831, 288, 292, + 0, 246, 242, 238, 583, 234, 0, 250, + 249, 266, 826, 308, 268, 254, 831, 288, // Entry 80 - BF - 304, 270, 324, 312, 226, 300, 239, 320, - 316, 624, 328, 344, 334, 340, 191, 332, - 348, 854, 0, 360, 372, 376, 833, 356, - 86, 368, 364, 352, 380, 832, 388, 400, - 392, 581, 404, 417, 116, 296, 174, 659, - 408, 410, 414, 136, 398, 418, 422, 662, - 438, 144, 430, 426, 440, 442, 428, 434, - 504, 492, 498, 499, 663, 450, 584, 581, + 292, 304, 270, 324, 312, 226, 300, 239, + 320, 316, 624, 328, 344, 334, 340, 191, + 332, 348, 854, 0, 360, 372, 376, 833, + 356, 86, 368, 364, 352, 380, 832, 388, + 400, 392, 581, 404, 417, 116, 296, 174, + 659, 408, 410, 414, 136, 398, 418, 422, + 662, 438, 144, 430, 426, 440, 442, 428, + 434, 504, 492, 498, 499, 663, 450, 584, // Entry C0 - FF - 807, 466, 104, 496, 446, 580, 474, 478, - 500, 470, 480, 462, 454, 484, 458, 508, - 516, 540, 562, 574, 566, 548, 558, 528, - 578, 524, 10, 520, 536, 570, 554, 512, - 591, 0, 604, 258, 598, 608, 586, 616, - 666, 612, 630, 275, 620, 581, 585, 600, - 591, 634, 959, 960, 961, 962, 963, 964, - 965, 966, 967, 968, 969, 970, 971, 972, + 581, 807, 466, 104, 496, 446, 580, 474, + 478, 500, 470, 480, 462, 454, 484, 458, + 508, 516, 540, 562, 574, 566, 548, 558, + 528, 578, 524, 10, 520, 536, 570, 554, + 512, 591, 0, 604, 258, 598, 608, 586, + 616, 666, 612, 630, 275, 620, 581, 585, + 600, 591, 634, 959, 960, 961, 962, 963, + 964, 965, 966, 967, 968, 969, 970, 971, // Entry 100 - 13F - 638, 716, 642, 688, 643, 646, 682, 90, - 690, 729, 752, 702, 654, 705, 744, 703, - 694, 674, 686, 706, 740, 728, 678, 810, - 222, 534, 760, 748, 0, 796, 148, 260, - 768, 764, 762, 772, 626, 795, 788, 776, - 626, 792, 780, 798, 158, 834, 804, 800, - 826, 581, 840, 858, 860, 336, 670, 704, - 862, 92, 850, 704, 548, 876, 581, 882, + 972, 638, 716, 642, 688, 643, 646, 682, + 90, 690, 729, 752, 702, 654, 705, 744, + 703, 694, 674, 686, 706, 740, 728, 678, + 810, 222, 534, 760, 748, 0, 796, 148, + 260, 768, 764, 762, 772, 626, 795, 788, + 776, 626, 792, 780, 798, 158, 834, 804, + 800, 826, 581, 0, 840, 858, 860, 336, + 670, 704, 862, 92, 850, 704, 548, 876, // Entry 140 - 17F - 973, 974, 975, 976, 977, 978, 979, 980, - 981, 982, 983, 984, 985, 986, 987, 988, - 989, 990, 991, 992, 993, 994, 995, 996, - 997, 998, 720, 887, 175, 891, 710, 894, - 180, 716, 999, + 581, 882, 973, 974, 975, 976, 977, 978, + 979, 980, 981, 982, 983, 984, 985, 986, + 987, 988, 989, 990, 991, 992, 993, 994, + 995, 996, 997, 998, 720, 887, 175, 891, + 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1060,50 +1208,50 @@ var fromM49 = [332]uint16{ 0x402b, 0x4410, 0x4611, 0x482e, 0x4e12, 0x502d, 0x5841, 0x6038, 0x6434, 0x6627, 0x6833, 0x6a13, 0x6c14, 0x7035, 0x7215, 0x783c, 0x7a16, 0x8042, 0x883e, 0x8c32, 0x9045, 0x9444, 0x9840, 0xa847, - 0xac98, 0xb507, 0xb939, 0xc03d, 0xc837, 0xd0c2, 0xd839, 0xe046, - 0xe8a4, 0xf051, 0xf848, 0x0859, 0x10ab, 0x184b, 0x1c17, 0x1e18, + 0xac99, 0xb508, 0xb93b, 0xc03d, 0xc837, 0xd0c3, 0xd839, 0xe046, + 0xe8a5, 0xf051, 0xf848, 0x0859, 0x10ac, 0x184b, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b1, 0x2219, 0x291e, 0x2c1a, 0x2e1b, 0x3050, 0x341c, 0x361d, - 0x3852, 0x3d2c, 0x445b, 0x4c49, 0x5453, 0x5ca6, 0x5f5c, 0x644c, - 0x684a, 0x704f, 0x7855, 0x7e8e, 0x8058, 0x885c, 0x965d, 0x983a, - 0xa062, 0xa863, 0xac64, 0xb468, 0xbd18, 0xc484, 0xcc6e, 0xce6e, - 0xd06c, 0xd269, 0xd474, 0xdc72, 0xde86, 0xe471, 0xec70, 0xf030, - 0xf277, 0xf476, 0xfc7c, 0x04e3, 0x091f, 0x0c61, 0x1478, 0x187b, - 0x1c81, 0x26eb, 0x285f, 0x2c5e, 0x305f, 0x407e, 0x487f, 0x50a5, - 0x5885, 0x6080, 0x687a, 0x7083, 0x7888, 0x8087, 0x8882, 0x908a, + 0x20b2, 0x2219, 0x291f, 0x2c1a, 0x2e1b, 0x3050, 0x341c, 0x361d, + 0x3852, 0x3d2d, 0x445b, 0x4c49, 0x5453, 0x5ca7, 0x5f5e, 0x644c, + 0x684a, 0x704f, 0x7855, 0x7e8f, 0x8058, 0x885c, 0x965d, 0x983a, + 0xa062, 0xa863, 0xac64, 0xb468, 0xbd19, 0xc485, 0xcc6e, 0xce6e, + 0xd06c, 0xd269, 0xd475, 0xdc73, 0xde87, 0xe472, 0xec71, 0xf030, + 0xf278, 0xf477, 0xfc7d, 0x04e4, 0x0920, 0x0c61, 0x1479, 0x187c, + 0x1c82, 0x26ec, 0x285f, 0x2c5e, 0x305f, 0x407f, 0x4880, 0x50a6, + 0x5886, 0x6081, 0x687b, 0x7084, 0x7889, 0x8088, 0x8883, 0x908b, // Entry 80 - BF - 0x988f, 0x9c8c, 0xa135, 0xa88d, 0xb08b, 0xb890, 0xc09b, 0xc897, - 0xd093, 0xd89a, 0xe099, 0xe894, 0xf095, 0xf89c, 0x004e, 0x089e, - 0x10a0, 0x1cac, 0x209f, 0x28a2, 0x30a8, 0x34a9, 0x3caa, 0x42a3, - 0x44ad, 0x461e, 0x4cae, 0x54b3, 0x58b6, 0x5cb2, 0x64b7, 0x6cb0, - 0x70b4, 0x74b5, 0x7cc4, 0x84bd, 0x8ccc, 0x94ce, 0x9ccb, 0xa4c1, - 0xacc9, 0xb4c6, 0xbcc7, 0xc0ca, 0xc8cd, 0xd8b9, 0xe0c3, 0xe4ba, - 0xe6bb, 0xe8c8, 0xf0b8, 0xf8cf, 0x00df, 0x08d0, 0x10db, 0x18d9, - 0x20d7, 0x2428, 0x265a, 0x2a2f, 0x2d19, 0x2e3f, 0x30dc, 0x38d1, + 0x9890, 0x9c8d, 0xa137, 0xa88e, 0xb08c, 0xb891, 0xc09c, 0xc898, + 0xd094, 0xd89b, 0xe09a, 0xe895, 0xf096, 0xf89d, 0x004e, 0x089f, + 0x10a1, 0x1cad, 0x20a0, 0x28a3, 0x30a9, 0x34aa, 0x3cab, 0x42a4, + 0x44ae, 0x461e, 0x4caf, 0x54b4, 0x58b7, 0x5cb3, 0x64b8, 0x6cb1, + 0x70b5, 0x74b6, 0x7cc5, 0x84be, 0x8ccd, 0x94cf, 0x9ccc, 0xa4c2, + 0xacca, 0xb4c7, 0xbcc8, 0xc0cb, 0xc8ce, 0xd8ba, 0xe0c4, 0xe4bb, + 0xe6bc, 0xe8c9, 0xf0b9, 0xf8d0, 0x00e0, 0x08d1, 0x10dc, 0x18da, + 0x20d8, 0x2428, 0x265a, 0x2a2f, 0x2d1a, 0x2e3f, 0x30dd, 0x38d2, // Entry C0 - FF - 0x493c, 0x54de, 0x5cd6, 0x64d2, 0x6cd4, 0x74dd, 0x7cd3, 0x84d8, - 0x88c5, 0x8b31, 0x8e73, 0x90be, 0x92ee, 0x94e6, 0x9ee0, 0xace4, - 0xb0ef, 0xb8e2, 0xc0e5, 0xc8e9, 0xd0e7, 0xd8ec, 0xe089, 0xe524, - 0xecea, 0xf4f1, 0xfd00, 0x0502, 0x0704, 0x0d05, 0x183b, 0x1d0c, - 0x26a7, 0x2825, 0x2caf, 0x2ebc, 0x34e8, 0x3d36, 0x4511, 0x4d16, - 0x5506, 0x5d12, 0x6103, 0x6508, 0x6d10, 0x7d0b, 0x7f0f, 0x813b, - 0x830d, 0x8513, 0x8d5e, 0x9961, 0xa15a, 0xa86d, 0xb115, 0xb309, - 0xb86b, 0xc109, 0xc914, 0xd10e, 0xd91b, 0xe10a, 0xe84d, 0xf11a, + 0x493e, 0x54df, 0x5cd7, 0x64d3, 0x6cd5, 0x74de, 0x7cd4, 0x84d9, + 0x88c6, 0x8b32, 0x8e74, 0x90bf, 0x92ef, 0x94e7, 0x9ee1, 0xace5, + 0xb0f0, 0xb8e3, 0xc0e6, 0xc8ea, 0xd0e8, 0xd8ed, 0xe08a, 0xe525, + 0xeceb, 0xf4f2, 0xfd01, 0x0503, 0x0705, 0x0d06, 0x183b, 0x1d0d, + 0x26a8, 0x2825, 0x2cb0, 0x2ebd, 0x34e9, 0x3d38, 0x4512, 0x4d17, + 0x5507, 0x5d13, 0x6104, 0x6509, 0x6d11, 0x7d0c, 0x7f10, 0x813d, + 0x830e, 0x8514, 0x8d60, 0x9963, 0xa15c, 0xa86d, 0xb116, 0xb30a, + 0xb86b, 0xc10a, 0xc915, 0xd10f, 0xd91c, 0xe10b, 0xe84d, 0xf11b, // Entry 100 - 13F - 0xf522, 0xf921, 0x0120, 0x0923, 0x1127, 0x192a, 0x2022, 0x2926, - 0x3129, 0x3725, 0x391d, 0x3d2b, 0x412f, 0x492e, 0x4ec0, 0x5517, - 0x646a, 0x7479, 0x7e7d, 0x809d, 0x8296, 0x852d, 0x9132, 0xa53a, - 0xac36, 0xb533, 0xb934, 0xbd38, 0xd93d, 0xe53f, 0xed5b, 0xef5b, - 0xf656, 0xfd5f, 0x7c1f, 0x7ef2, 0x80f3, 0x82f4, 0x84f5, 0x86f6, - 0x88f7, 0x8af8, 0x8cf9, 0x8e6f, 0x90fb, 0x92fc, 0x94fd, 0x96fe, - 0x98ff, 0x9b40, 0x9d41, 0x9f42, 0xa143, 0xa344, 0xa545, 0xa746, - 0xa947, 0xab48, 0xad49, 0xaf4a, 0xb14b, 0xb34c, 0xb54d, 0xb74e, + 0xf523, 0xf922, 0x0121, 0x0924, 0x1128, 0x192b, 0x2022, 0x2927, + 0x312a, 0x3726, 0x391e, 0x3d2c, 0x4130, 0x492f, 0x4ec1, 0x5518, + 0x646a, 0x747a, 0x7e7e, 0x809e, 0x8297, 0x852e, 0x9134, 0xa53c, + 0xac36, 0xb535, 0xb936, 0xbd3a, 0xd93f, 0xe541, 0xed5d, 0xef5d, + 0xf656, 0xfd61, 0x7c1f, 0x7ef3, 0x80f4, 0x82f5, 0x84f6, 0x86f7, + 0x88f8, 0x8af9, 0x8cfa, 0x8e6f, 0x90fc, 0x92fd, 0x94fe, 0x96ff, + 0x9900, 0x9b42, 0x9d43, 0x9f44, 0xa145, 0xa346, 0xa547, 0xa748, + 0xa949, 0xab4a, 0xad4b, 0xaf4c, 0xb14d, 0xb34e, 0xb54f, 0xb750, // Entry 140 - 17F - 0xb94f, 0xbb50, 0xbd51, 0xbf52, 0xc153, 0xc354, 0xc555, 0xc756, - 0xc957, 0xcb58, 0xcd59, 0xcf62, + 0xb951, 0xbb52, 0xbd53, 0xbf54, 0xc155, 0xc356, 0xc557, 0xc758, + 0xc959, 0xcb5a, 0xcd5b, 0xcf64, } -// Size: 1444 bytes +// Size: 1463 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, @@ -1132,8 +1280,9 @@ var variantIndex = map[string]uint8{ "ekavsk": 0x15, "emodeng": 0x16, "fonipa": 0x48, - "fonupa": 0x49, - "fonxsamp": 0x4a, + "fonnapa": 0x49, + "fonupa": 0x4a, + "fonxsamp": 0x4b, "hepburn": 0x17, "heploc": 0x46, "hognorsk": 0x18, @@ -1166,7 +1315,7 @@ var variantIndex = map[string]uint8{ "rumgr": 0x30, "scotland": 0x31, "scouse": 0x32, - "simple": 0x4b, + "simple": 0x4c, "solba": 0x44, "sotav": 0x33, "surmiran": 0x34, @@ -1198,145 +1347,145 @@ type likelyLangRegion struct { // languages and regions given a script. // Size: 928 bytes, 232 elements var likelyScript = [232]likelyLangRegion{ - 1: {lang: 0xa6, region: 0x82}, - 3: {lang: 0x159, region: 0x104}, - 4: {lang: 0xc, region: 0x97}, - 5: {lang: 0x15, region: 0x6a}, - 7: {lang: 0x16, region: 0x9a}, - 8: {lang: 0xf3, region: 0x27}, - 9: {lang: 0x8, region: 0x9a}, - 10: {lang: 0x27, region: 0x93}, - 11: {lang: 0x2b, region: 0x51}, - 12: {lang: 0x55, region: 0xb2}, - 13: {lang: 0x2c, region: 0x93}, - 14: {lang: 0x4b, region: 0x34}, - 15: {lang: 0x20d, region: 0x97}, - 17: {lang: 0x2c4, region: 0x12c}, - 18: {lang: 0x1e5, region: 0x97}, - 19: {lang: 0xaf, region: 0x76}, - 20: {lang: 0x5b, region: 0x93}, - 21: {lang: 0x47, region: 0xe5}, - 22: {lang: 0x63, region: 0x34}, - 23: {lang: 0x73, region: 0x48}, - 24: {lang: 0x2a8, region: 0x129}, - 25: {lang: 0x6e, region: 0x13b}, - 26: {lang: 0x6c, region: 0x132}, - 28: {lang: 0x71, region: 0x6a}, - 29: {lang: 0xd0, region: 0x5c}, - 30: {lang: 0x207, region: 0x104}, - 32: {lang: 0xe1, region: 0x97}, - 34: {lang: 0xaf, region: 0x76}, - 37: {lang: 0x98, region: 0x6a}, - 38: {lang: 0x23a, region: 0x26}, - 39: {lang: 0x11, region: 0x6e}, - 41: {lang: 0x111, region: 0x7b}, - 42: {lang: 0x7d, region: 0x37}, - 43: {lang: 0xcf, region: 0x12e}, - 44: {lang: 0x20d, region: 0x97}, - 45: {lang: 0x9a, region: 0x85}, - 46: {lang: 0xd3, region: 0x97}, - 47: {lang: 0x1d7, region: 0x97}, - 48: {lang: 0x2c4, region: 0x12c}, - 49: {lang: 0x136, region: 0xa9}, - 50: {lang: 0x2c4, region: 0x52}, - 51: {lang: 0xe9, region: 0xe5}, - 52: {lang: 0x2c4, region: 0x52}, - 53: {lang: 0x2c4, region: 0x12c}, - 54: {lang: 0x18b, region: 0x99}, - 55: {lang: 0xe0, region: 0x95}, - 56: {lang: 0x107, region: 0xa0}, - 57: {lang: 0xe4, region: 0x129}, - 58: {lang: 0xe8, region: 0xad}, - 60: {lang: 0xf2, region: 0x90}, - 62: {lang: 0xa0, region: 0x9c}, - 63: {lang: 0x136, region: 0xa9}, - 64: {lang: 0x10f, region: 0x93}, - 65: {lang: 0x107, region: 0xa0}, - 67: {lang: 0x99, region: 0xc2}, - 68: {lang: 0x107, region: 0xa0}, - 69: {lang: 0x1eb, region: 0xe6}, - 70: {lang: 0x133, region: 0xa4}, - 71: {lang: 0x21a, region: 0x97}, - 74: {lang: 0x135, region: 0x97}, - 75: {lang: 0x136, region: 0xa9}, - 77: {lang: 0x40, region: 0x97}, - 78: {lang: 0x1c2, region: 0x121}, - 79: {lang: 0x165, region: 0xad}, - 84: {lang: 0x158, region: 0x97}, - 85: {lang: 0x15c, region: 0x97}, - 86: {lang: 0x14f, region: 0x85}, - 87: {lang: 0xd0, region: 0x85}, - 88: {lang: 0x15e, region: 0x52}, - 90: {lang: 0x2aa, region: 0x129}, - 91: {lang: 0x2ab, region: 0x129}, - 92: {lang: 0xe1, region: 0x97}, - 93: {lang: 0x1a8, region: 0x9a}, - 94: {lang: 0x2ad, region: 0x52}, - 95: {lang: 0x4c, region: 0x52}, - 97: {lang: 0x17f, region: 0x110}, - 98: {lang: 0x2ae, region: 0x109}, - 99: {lang: 0x2ae, region: 0x109}, - 100: {lang: 0x18d, region: 0x97}, - 101: {lang: 0x196, region: 0x97}, - 102: {lang: 0x18f, region: 0x52}, - 104: {lang: 0x199, region: 0x34}, - 105: {lang: 0x190, region: 0x97}, - 106: {lang: 0x22b, region: 0xe6}, - 107: {lang: 0x1a5, region: 0xc2}, - 108: {lang: 0x2af, region: 0x106}, - 109: {lang: 0x16, region: 0x9f}, - 110: {lang: 0x1b5, region: 0xd9}, - 112: {lang: 0x179, region: 0x82}, - 114: {lang: 0x223, region: 0x94}, - 115: {lang: 0x212, region: 0x97}, - 116: {lang: 0x1d6, region: 0xc3}, - 117: {lang: 0x1d3, region: 0x97}, - 118: {lang: 0x1d5, region: 0x132}, - 119: {lang: 0x238, region: 0x113}, - 120: {lang: 0x16, region: 0x11a}, - 121: {lang: 0x7c, region: 0xc2}, - 122: {lang: 0x147, region: 0x104}, - 123: {lang: 0x172, region: 0x52}, - 124: {lang: 0x1d9, region: 0x9a}, - 125: {lang: 0x1d9, region: 0x52}, - 127: {lang: 0x1e3, region: 0xae}, - 129: {lang: 0xe5, region: 0x52}, - 130: {lang: 0x2b2, region: 0x9a}, - 181: {lang: 0x1f6, region: 0x93}, - 183: {lang: 0x1c4, region: 0x10a}, - 184: {lang: 0x234, region: 0x95}, - 186: {lang: 0x2b3, region: 0x15b}, - 187: {lang: 0x213, region: 0x97}, - 188: {lang: 0x1e, region: 0x132}, - 189: {lang: 0x9b, region: 0x79}, - 190: {lang: 0x20d, region: 0x97}, - 191: {lang: 0x20d, region: 0x97}, - 192: {lang: 0x21a, region: 0x97}, - 193: {lang: 0x228, region: 0xb1}, - 194: {lang: 0x23c, region: 0x97}, - 195: {lang: 0x244, region: 0x93}, - 196: {lang: 0x24e, region: 0x34}, - 197: {lang: 0x24f, region: 0x99}, - 201: {lang: 0x253, region: 0xe5}, - 202: {lang: 0x8a, region: 0x97}, - 203: {lang: 0x255, region: 0x52}, - 204: {lang: 0x126, region: 0x52}, - 205: {lang: 0x251, region: 0x97}, - 206: {lang: 0x27f, region: 0x52}, - 207: {lang: 0x48, region: 0x13b}, - 208: {lang: 0x258, region: 0x97}, - 210: {lang: 0x2c3, region: 0xb8}, - 211: {lang: 0xaa, region: 0xe5}, - 212: {lang: 0x90, region: 0xcb}, - 213: {lang: 0x25d, region: 0x121}, - 214: {lang: 0x4c, region: 0x52}, - 215: {lang: 0x177, region: 0x97}, - 216: {lang: 0x285, region: 0x11a}, - 217: {lang: 0x28e, region: 0xb2}, - 219: {lang: 0xec, region: 0x97}, - 221: {lang: 0x1e1, region: 0x9a}, - 222: {lang: 0xe, region: 0x99}, - 223: {lang: 0xfb, region: 0x52}, + 1: {lang: 0x14d, region: 0x83}, + 3: {lang: 0x2a0, region: 0x105}, + 4: {lang: 0x1f, region: 0x98}, + 5: {lang: 0x3a, region: 0x6a}, + 7: {lang: 0x3b, region: 0x9b}, + 8: {lang: 0x1d5, region: 0x27}, + 9: {lang: 0x13, region: 0x9b}, + 10: {lang: 0x5b, region: 0x94}, + 11: {lang: 0x60, region: 0x51}, + 12: {lang: 0xb9, region: 0xb3}, + 13: {lang: 0x63, region: 0x94}, + 14: {lang: 0xa5, region: 0x34}, + 15: {lang: 0x3e7, region: 0x98}, + 17: {lang: 0x527, region: 0x12d}, + 18: {lang: 0x3af, region: 0x98}, + 19: {lang: 0x15d, region: 0x77}, + 20: {lang: 0xc2, region: 0x94}, + 21: {lang: 0x9d, region: 0xe6}, + 22: {lang: 0xdb, region: 0x34}, + 23: {lang: 0xf2, region: 0x48}, + 24: {lang: 0x4ee, region: 0x12a}, + 25: {lang: 0xe7, region: 0x13d}, + 26: {lang: 0xe5, region: 0x134}, + 28: {lang: 0xf0, region: 0x6a}, + 29: {lang: 0x19e, region: 0x5c}, + 30: {lang: 0x3e0, region: 0x105}, + 32: {lang: 0x1bc, region: 0x98}, + 34: {lang: 0x15d, region: 0x77}, + 37: {lang: 0x132, region: 0x6a}, + 38: {lang: 0x42f, region: 0x26}, + 39: {lang: 0x27, region: 0x6e}, + 41: {lang: 0x20e, region: 0x7c}, + 42: {lang: 0xfd, region: 0x37}, + 43: {lang: 0x19c, region: 0x12f}, + 44: {lang: 0x3e7, region: 0x98}, + 45: {lang: 0x135, region: 0x86}, + 46: {lang: 0x1a2, region: 0x98}, + 47: {lang: 0x39b, region: 0x98}, + 48: {lang: 0x527, region: 0x12d}, + 49: {lang: 0x252, region: 0xaa}, + 50: {lang: 0x527, region: 0x52}, + 51: {lang: 0x1c9, region: 0xe6}, + 52: {lang: 0x527, region: 0x52}, + 53: {lang: 0x527, region: 0x12d}, + 54: {lang: 0x2fb, region: 0x9a}, + 55: {lang: 0x1ba, region: 0x96}, + 56: {lang: 0x1fe, region: 0xa1}, + 57: {lang: 0x1c3, region: 0x12a}, + 58: {lang: 0x1c8, region: 0xae}, + 60: {lang: 0x1d3, region: 0x91}, + 62: {lang: 0x141, region: 0x9d}, + 63: {lang: 0x252, region: 0xaa}, + 64: {lang: 0x20c, region: 0x94}, + 65: {lang: 0x1fe, region: 0xa1}, + 67: {lang: 0x134, region: 0xc3}, + 68: {lang: 0x1fe, region: 0xa1}, + 69: {lang: 0x3b9, region: 0xe7}, + 70: {lang: 0x248, region: 0xa5}, + 71: {lang: 0x3f8, region: 0x98}, + 74: {lang: 0x24f, region: 0x98}, + 75: {lang: 0x252, region: 0xaa}, + 77: {lang: 0x88, region: 0x98}, + 78: {lang: 0x36e, region: 0x122}, + 79: {lang: 0x2b6, region: 0xae}, + 84: {lang: 0x29d, region: 0x98}, + 85: {lang: 0x2a6, region: 0x98}, + 86: {lang: 0x28d, region: 0x86}, + 87: {lang: 0x19e, region: 0x86}, + 88: {lang: 0x2aa, region: 0x52}, + 90: {lang: 0x4f2, region: 0x12a}, + 91: {lang: 0x4f3, region: 0x12a}, + 92: {lang: 0x1bc, region: 0x98}, + 93: {lang: 0x335, region: 0x9b}, + 94: {lang: 0x4f5, region: 0x52}, + 95: {lang: 0xa9, region: 0x52}, + 97: {lang: 0x2e6, region: 0x111}, + 98: {lang: 0x4f6, region: 0x10a}, + 99: {lang: 0x4f6, region: 0x10a}, + 100: {lang: 0x302, region: 0x98}, + 101: {lang: 0x319, region: 0x98}, + 102: {lang: 0x309, region: 0x52}, + 104: {lang: 0x31c, region: 0x34}, + 105: {lang: 0x30c, region: 0x98}, + 106: {lang: 0x412, region: 0xe7}, + 107: {lang: 0x32f, region: 0xc3}, + 108: {lang: 0x4f7, region: 0x107}, + 109: {lang: 0x3b, region: 0xa0}, + 110: {lang: 0x351, region: 0xda}, + 112: {lang: 0x2ce, region: 0x83}, + 114: {lang: 0x401, region: 0x95}, + 115: {lang: 0x3ec, region: 0x98}, + 116: {lang: 0x399, region: 0xc4}, + 117: {lang: 0x393, region: 0x98}, + 118: {lang: 0x397, region: 0x134}, + 119: {lang: 0x427, region: 0x114}, + 120: {lang: 0x3b, region: 0x11b}, + 121: {lang: 0xfc, region: 0xc3}, + 122: {lang: 0x27b, region: 0x105}, + 123: {lang: 0x2c7, region: 0x52}, + 124: {lang: 0x39d, region: 0x9b}, + 125: {lang: 0x39d, region: 0x52}, + 127: {lang: 0x3ab, region: 0xaf}, + 129: {lang: 0x1c4, region: 0x52}, + 130: {lang: 0x4fb, region: 0x9b}, + 181: {lang: 0x3c9, region: 0x94}, + 183: {lang: 0x370, region: 0x10b}, + 184: {lang: 0x41e, region: 0x96}, + 186: {lang: 0x4fd, region: 0x15d}, + 187: {lang: 0x3ee, region: 0x98}, + 188: {lang: 0x45, region: 0x134}, + 189: {lang: 0x138, region: 0x7a}, + 190: {lang: 0x3e7, region: 0x98}, + 191: {lang: 0x3e7, region: 0x98}, + 192: {lang: 0x3f8, region: 0x98}, + 193: {lang: 0x40a, region: 0xb2}, + 194: {lang: 0x431, region: 0x98}, + 195: {lang: 0x43c, region: 0x94}, + 196: {lang: 0x44b, region: 0x34}, + 197: {lang: 0x44c, region: 0x9a}, + 201: {lang: 0x458, region: 0xe6}, + 202: {lang: 0x119, region: 0x98}, + 203: {lang: 0x45c, region: 0x52}, + 204: {lang: 0x230, region: 0x52}, + 205: {lang: 0x44e, region: 0x98}, + 206: {lang: 0x4a3, region: 0x52}, + 207: {lang: 0x9f, region: 0x13d}, + 208: {lang: 0x45f, region: 0x98}, + 210: {lang: 0x526, region: 0xb9}, + 211: {lang: 0x152, region: 0xe6}, + 212: {lang: 0x127, region: 0xcc}, + 213: {lang: 0x469, region: 0x122}, + 214: {lang: 0xa9, region: 0x52}, + 215: {lang: 0x2cc, region: 0x98}, + 216: {lang: 0x4ab, region: 0x11b}, + 217: {lang: 0x4bc, region: 0xb3}, + 219: {lang: 0x1cc, region: 0x98}, + 221: {lang: 0x3a7, region: 0x9b}, + 222: {lang: 0x22, region: 0x9a}, + 223: {lang: 0x1e8, region: 0x52}, } type likelyScriptRegion struct { @@ -1349,807 +1498,1419 @@ type likelyScriptRegion struct { // scripts and regions given incomplete information. If more entries exist for a // given language, region and script are the index and size respectively // of the list in likelyLangList. -// Size: 2852 bytes, 713 elements -var likelyLang = [713]likelyScriptRegion{ - 0: {region: 0x132, script: 0x52, flags: 0x0}, - 1: {region: 0x6e, script: 0x52, flags: 0x0}, - 2: {region: 0x7b, script: 0x1e, flags: 0x0}, - 3: {region: 0x7e, script: 0x52, flags: 0x0}, - 4: {region: 0x93, script: 0x52, flags: 0x0}, - 5: {region: 0x12f, script: 0x52, flags: 0x0}, - 6: {region: 0x7e, script: 0x52, flags: 0x0}, - 7: {region: 0x104, script: 0x1e, flags: 0x0}, - 8: {region: 0x9a, script: 0x9, flags: 0x0}, - 9: {region: 0x126, script: 0x5, flags: 0x0}, - 10: {region: 0x15e, script: 0x52, flags: 0x0}, - 11: {region: 0x51, script: 0x52, flags: 0x0}, - 12: {region: 0x97, script: 0x4, flags: 0x0}, - 13: {region: 0x7e, script: 0x52, flags: 0x0}, - 14: {region: 0x99, script: 0xde, flags: 0x0}, - 15: {region: 0x14a, script: 0x52, flags: 0x0}, - 16: {region: 0x104, script: 0x1e, flags: 0x0}, - 17: {region: 0x6e, script: 0x27, flags: 0x0}, - 18: {region: 0xd4, script: 0x52, flags: 0x0}, - 20: {region: 0x93, script: 0x52, flags: 0x0}, - 21: {region: 0x6a, script: 0x5, flags: 0x0}, - 22: {region: 0x0, script: 0x3, flags: 0x1}, - 23: {region: 0x50, script: 0x52, flags: 0x0}, - 24: {region: 0x3e, script: 0x52, flags: 0x0}, - 25: {region: 0x66, script: 0x5, flags: 0x0}, - 26: {region: 0xb8, script: 0x5, flags: 0x0}, - 27: {region: 0x6a, script: 0x5, flags: 0x0}, - 28: {region: 0x97, script: 0xe, flags: 0x0}, - 29: {region: 0x12d, script: 0x52, flags: 0x0}, - 30: {region: 0x132, script: 0xbc, flags: 0x0}, - 31: {region: 0x6d, script: 0x52, flags: 0x0}, - 32: {region: 0x48, script: 0x52, flags: 0x0}, - 33: {region: 0x104, script: 0x1e, flags: 0x0}, - 34: {region: 0x97, script: 0x20, flags: 0x0}, - 35: {region: 0x3e, script: 0x52, flags: 0x0}, - 36: {region: 0x3, script: 0x5, flags: 0x1}, - 37: {region: 0x104, script: 0x1e, flags: 0x0}, - 38: {region: 0xe6, script: 0x5, flags: 0x0}, - 39: {region: 0x93, script: 0x52, flags: 0x0}, - 40: {region: 0xd9, script: 0x20, flags: 0x0}, - 41: {region: 0x2d, script: 0x52, flags: 0x0}, - 42: {region: 0x51, script: 0x52, flags: 0x0}, - 43: {region: 0x51, script: 0xb, flags: 0x0}, - 44: {region: 0x93, script: 0x52, flags: 0x0}, - 45: {region: 0x51, script: 0x52, flags: 0x0}, - 46: {region: 0x4e, script: 0x52, flags: 0x0}, - 47: {region: 0x46, script: 0x1e, flags: 0x0}, - 48: {region: 0x109, script: 0x5, flags: 0x0}, - 49: {region: 0x15f, script: 0x52, flags: 0x0}, - 50: {region: 0x93, script: 0x52, flags: 0x0}, - 51: {region: 0x12d, script: 0x52, flags: 0x0}, - 52: {region: 0x51, script: 0x52, flags: 0x0}, - 53: {region: 0x97, script: 0xcd, flags: 0x0}, - 54: {region: 0xe6, script: 0x5, flags: 0x0}, - 55: {region: 0x97, script: 0x20, flags: 0x0}, - 56: {region: 0x37, script: 0x1e, flags: 0x0}, - 57: {region: 0x97, script: 0x20, flags: 0x0}, - 58: {region: 0xe6, script: 0x5, flags: 0x0}, - 59: {region: 0x129, script: 0x2d, flags: 0x0}, - 61: {region: 0x97, script: 0x20, flags: 0x0}, - 62: {region: 0x97, script: 0x20, flags: 0x0}, - 63: {region: 0xe5, script: 0x52, flags: 0x0}, - 64: {region: 0x97, script: 0x20, flags: 0x0}, - 65: {region: 0x13c, script: 0x52, flags: 0x0}, - 66: {region: 0xe5, script: 0x52, flags: 0x0}, - 67: {region: 0xd4, script: 0x52, flags: 0x0}, - 68: {region: 0x97, script: 0x20, flags: 0x0}, - 69: {region: 0x93, script: 0x52, flags: 0x0}, - 70: {region: 0x51, script: 0x52, flags: 0x0}, - 71: {region: 0xe5, script: 0x52, flags: 0x0}, - 72: {region: 0x13b, script: 0xcf, flags: 0x0}, - 73: {region: 0xc1, script: 0x52, flags: 0x0}, - 74: {region: 0xc1, script: 0x52, flags: 0x0}, - 75: {region: 0x34, script: 0xe, flags: 0x0}, - 76: {region: 0x52, script: 0xd6, flags: 0x0}, - 77: {region: 0x97, script: 0xe, flags: 0x0}, - 78: {region: 0x9a, script: 0x5, flags: 0x0}, - 79: {region: 0x4e, script: 0x52, flags: 0x0}, - 80: {region: 0x76, script: 0x52, flags: 0x0}, - 81: {region: 0x97, script: 0x20, flags: 0x0}, - 82: {region: 0xe6, script: 0x5, flags: 0x0}, - 83: {region: 0x97, script: 0x20, flags: 0x0}, - 84: {region: 0x32, script: 0x52, flags: 0x0}, - 85: {region: 0xb2, script: 0xc, flags: 0x0}, - 86: {region: 0x51, script: 0x52, flags: 0x0}, - 87: {region: 0xe5, script: 0x52, flags: 0x0}, - 88: {region: 0xe6, script: 0x20, flags: 0x0}, - 89: {region: 0x104, script: 0x1e, flags: 0x0}, - 90: {region: 0x15c, script: 0x52, flags: 0x0}, - 91: {region: 0x93, script: 0x52, flags: 0x0}, - 92: {region: 0x51, script: 0x52, flags: 0x0}, - 93: {region: 0x84, script: 0x52, flags: 0x0}, - 94: {region: 0x6c, script: 0x27, flags: 0x0}, - 95: {region: 0x51, script: 0x52, flags: 0x0}, - 96: {region: 0xc1, script: 0x52, flags: 0x0}, - 97: {region: 0x6d, script: 0x52, flags: 0x0}, - 98: {region: 0xd4, script: 0x52, flags: 0x0}, - 99: {region: 0x8, script: 0x2, flags: 0x1}, - 100: {region: 0x104, script: 0x1e, flags: 0x0}, - 101: {region: 0xe5, script: 0x52, flags: 0x0}, - 102: {region: 0x12f, script: 0x52, flags: 0x0}, - 103: {region: 0x88, script: 0x52, flags: 0x0}, - 104: {region: 0x73, script: 0x52, flags: 0x0}, - 105: {region: 0x104, script: 0x1e, flags: 0x0}, - 106: {region: 0x132, script: 0x52, flags: 0x0}, - 107: {region: 0x48, script: 0x52, flags: 0x0}, - 108: {region: 0x132, script: 0x1a, flags: 0x0}, - 109: {region: 0xa4, script: 0x5, flags: 0x0}, - 110: {region: 0x13b, script: 0x19, flags: 0x0}, - 111: {region: 0x99, script: 0x5, flags: 0x0}, - 112: {region: 0x76, script: 0x52, flags: 0x0}, - 113: {region: 0x6a, script: 0x1c, flags: 0x0}, - 114: {region: 0xe5, script: 0x52, flags: 0x0}, - 115: {region: 0x48, script: 0x17, flags: 0x0}, - 116: {region: 0x48, script: 0x17, flags: 0x0}, - 117: {region: 0x48, script: 0x17, flags: 0x0}, - 118: {region: 0x48, script: 0x17, flags: 0x0}, - 119: {region: 0x48, script: 0x17, flags: 0x0}, - 120: {region: 0x108, script: 0x52, flags: 0x0}, - 121: {region: 0x5d, script: 0x52, flags: 0x0}, - 122: {region: 0xe7, script: 0x52, flags: 0x0}, - 123: {region: 0x48, script: 0x17, flags: 0x0}, - 124: {region: 0xc2, script: 0x79, flags: 0x0}, - 125: {region: 0xa, script: 0x2, flags: 0x1}, - 126: {region: 0x104, script: 0x1e, flags: 0x0}, - 127: {region: 0x79, script: 0x52, flags: 0x0}, - 128: {region: 0x62, script: 0x52, flags: 0x0}, - 129: {region: 0x132, script: 0x52, flags: 0x0}, - 130: {region: 0x104, script: 0x1e, flags: 0x0}, - 131: {region: 0xa2, script: 0x52, flags: 0x0}, - 132: {region: 0x97, script: 0x5, flags: 0x0}, - 133: {region: 0x5f, script: 0x52, flags: 0x0}, - 134: {region: 0x48, script: 0x52, flags: 0x0}, - 135: {region: 0x48, script: 0x52, flags: 0x0}, - 136: {region: 0xd2, script: 0x52, flags: 0x0}, - 137: {region: 0x4e, script: 0x52, flags: 0x0}, - 138: {region: 0x97, script: 0x5, flags: 0x0}, - 139: {region: 0x5f, script: 0x52, flags: 0x0}, - 140: {region: 0xc1, script: 0x52, flags: 0x0}, - 141: {region: 0xce, script: 0x52, flags: 0x0}, - 142: {region: 0xd9, script: 0x20, flags: 0x0}, - 143: {region: 0x51, script: 0x52, flags: 0x0}, - 144: {region: 0xcb, script: 0xd4, flags: 0x0}, - 145: {region: 0x112, script: 0x52, flags: 0x0}, - 146: {region: 0x36, script: 0x52, flags: 0x0}, - 147: {region: 0x42, script: 0xd6, flags: 0x0}, - 148: {region: 0xa2, script: 0x52, flags: 0x0}, - 149: {region: 0x7e, script: 0x52, flags: 0x0}, - 150: {region: 0xd4, script: 0x52, flags: 0x0}, - 151: {region: 0x9c, script: 0x52, flags: 0x0}, - 152: {region: 0x6a, script: 0x25, flags: 0x0}, - 153: {region: 0xc2, script: 0x43, flags: 0x0}, - 154: {region: 0x85, script: 0x2d, flags: 0x0}, - 155: {region: 0xc, script: 0x2, flags: 0x1}, - 156: {region: 0x1, script: 0x52, flags: 0x0}, - 157: {region: 0x6d, script: 0x52, flags: 0x0}, - 158: {region: 0x132, script: 0x52, flags: 0x0}, - 159: {region: 0x69, script: 0x52, flags: 0x0}, - 160: {region: 0x9c, script: 0x3e, flags: 0x0}, - 161: {region: 0x6d, script: 0x52, flags: 0x0}, - 162: {region: 0x51, script: 0x52, flags: 0x0}, - 163: {region: 0x6d, script: 0x52, flags: 0x0}, - 164: {region: 0x9a, script: 0x5, flags: 0x0}, - 165: {region: 0x84, script: 0x52, flags: 0x0}, - 166: {region: 0xe, script: 0x2, flags: 0x1}, - 167: {region: 0xc1, script: 0x52, flags: 0x0}, - 168: {region: 0x70, script: 0x52, flags: 0x0}, - 169: {region: 0x109, script: 0x5, flags: 0x0}, - 170: {region: 0xe5, script: 0x52, flags: 0x0}, - 171: {region: 0x10a, script: 0x52, flags: 0x0}, - 172: {region: 0x71, script: 0x52, flags: 0x0}, - 173: {region: 0x74, script: 0x52, flags: 0x0}, - 174: {region: 0x3a, script: 0x52, flags: 0x0}, - 175: {region: 0x76, script: 0x52, flags: 0x0}, - 176: {region: 0x132, script: 0x52, flags: 0x0}, - 177: {region: 0x76, script: 0x52, flags: 0x0}, - 178: {region: 0x5f, script: 0x52, flags: 0x0}, - 179: {region: 0x5f, script: 0x52, flags: 0x0}, - 180: {region: 0x13d, script: 0x52, flags: 0x0}, - 181: {region: 0xd2, script: 0x52, flags: 0x0}, - 182: {region: 0x9c, script: 0x52, flags: 0x0}, - 183: {region: 0xd4, script: 0x52, flags: 0x0}, - 184: {region: 0x109, script: 0x52, flags: 0x0}, - 185: {region: 0xd7, script: 0x52, flags: 0x0}, - 186: {region: 0x94, script: 0x52, flags: 0x0}, - 187: {region: 0x7e, script: 0x52, flags: 0x0}, - 188: {region: 0xba, script: 0x52, flags: 0x0}, - 189: {region: 0x52, script: 0x34, flags: 0x0}, - 190: {region: 0x93, script: 0x52, flags: 0x0}, - 191: {region: 0x97, script: 0x20, flags: 0x0}, - 192: {region: 0x9a, script: 0x5, flags: 0x0}, - 193: {region: 0x7c, script: 0x52, flags: 0x0}, - 194: {region: 0x79, script: 0x52, flags: 0x0}, - 195: {region: 0x6e, script: 0x27, flags: 0x0}, - 196: {region: 0xd9, script: 0x20, flags: 0x0}, - 197: {region: 0xa5, script: 0x52, flags: 0x0}, - 198: {region: 0xe6, script: 0x5, flags: 0x0}, - 199: {region: 0xe6, script: 0x5, flags: 0x0}, - 200: {region: 0x6d, script: 0x52, flags: 0x0}, - 201: {region: 0x9a, script: 0x5, flags: 0x0}, - 202: {region: 0xef, script: 0x52, flags: 0x0}, - 203: {region: 0x97, script: 0x20, flags: 0x0}, - 204: {region: 0x97, script: 0xd0, flags: 0x0}, - 205: {region: 0x93, script: 0x52, flags: 0x0}, - 206: {region: 0xd7, script: 0x52, flags: 0x0}, - 207: {region: 0x12e, script: 0x2b, flags: 0x0}, - 208: {region: 0x10, script: 0x2, flags: 0x1}, - 209: {region: 0x97, script: 0xe, flags: 0x0}, - 210: {region: 0x4d, script: 0x52, flags: 0x0}, - 211: {region: 0x97, script: 0x2e, flags: 0x0}, - 212: {region: 0x40, script: 0x52, flags: 0x0}, - 213: {region: 0x53, script: 0x52, flags: 0x0}, - 214: {region: 0x7e, script: 0x52, flags: 0x0}, - 216: {region: 0xa2, script: 0x52, flags: 0x0}, - 217: {region: 0x96, script: 0x52, flags: 0x0}, - 218: {region: 0xd9, script: 0x20, flags: 0x0}, - 219: {region: 0x48, script: 0x52, flags: 0x0}, - 220: {region: 0x12, script: 0x3, flags: 0x1}, - 221: {region: 0x52, script: 0x34, flags: 0x0}, - 222: {region: 0x132, script: 0x52, flags: 0x0}, - 223: {region: 0x23, script: 0x5, flags: 0x0}, - 224: {region: 0x95, script: 0x37, flags: 0x0}, - 225: {region: 0x97, script: 0x20, flags: 0x0}, - 226: {region: 0x71, script: 0x52, flags: 0x0}, - 227: {region: 0xe5, script: 0x52, flags: 0x0}, - 228: {region: 0x129, script: 0x39, flags: 0x0}, - 229: {region: 0x52, script: 0x81, flags: 0x0}, - 230: {region: 0xe6, script: 0x5, flags: 0x0}, - 231: {region: 0x97, script: 0x20, flags: 0x0}, - 232: {region: 0xad, script: 0x3a, flags: 0x0}, - 233: {region: 0xe5, script: 0x52, flags: 0x0}, - 234: {region: 0xe6, script: 0x5, flags: 0x0}, - 235: {region: 0xe4, script: 0x52, flags: 0x0}, - 236: {region: 0x97, script: 0x20, flags: 0x0}, - 237: {region: 0x97, script: 0x20, flags: 0x0}, - 238: {region: 0x8e, script: 0x52, flags: 0x0}, - 239: {region: 0x5f, script: 0x52, flags: 0x0}, - 240: {region: 0x52, script: 0x34, flags: 0x0}, - 241: {region: 0x8f, script: 0x52, flags: 0x0}, - 242: {region: 0x90, script: 0x52, flags: 0x0}, - 243: {region: 0x27, script: 0x8, flags: 0x0}, - 244: {region: 0xd0, script: 0x52, flags: 0x0}, - 245: {region: 0x76, script: 0x52, flags: 0x0}, - 246: {region: 0xce, script: 0x52, flags: 0x0}, - 247: {region: 0xd4, script: 0x52, flags: 0x0}, - 248: {region: 0x93, script: 0x52, flags: 0x0}, - 250: {region: 0xd4, script: 0x52, flags: 0x0}, - 251: {region: 0x52, script: 0xdf, flags: 0x0}, - 252: {region: 0x132, script: 0x52, flags: 0x0}, - 253: {region: 0x48, script: 0x52, flags: 0x0}, - 254: {region: 0xe5, script: 0x52, flags: 0x0}, - 255: {region: 0x93, script: 0x52, flags: 0x0}, - 256: {region: 0x104, script: 0x1e, flags: 0x0}, - 258: {region: 0x9b, script: 0x52, flags: 0x0}, - 259: {region: 0x9c, script: 0x52, flags: 0x0}, - 260: {region: 0x48, script: 0x17, flags: 0x0}, - 261: {region: 0x95, script: 0x37, flags: 0x0}, - 262: {region: 0x104, script: 0x52, flags: 0x0}, - 263: {region: 0xa0, script: 0x41, flags: 0x0}, - 264: {region: 0x9e, script: 0x52, flags: 0x0}, - 266: {region: 0x51, script: 0x52, flags: 0x0}, - 267: {region: 0x12e, script: 0x37, flags: 0x0}, - 268: {region: 0x12d, script: 0x52, flags: 0x0}, - 269: {region: 0xd9, script: 0x20, flags: 0x0}, - 270: {region: 0x62, script: 0x52, flags: 0x0}, - 271: {region: 0x93, script: 0x52, flags: 0x0}, - 272: {region: 0x93, script: 0x52, flags: 0x0}, - 273: {region: 0x7b, script: 0x29, flags: 0x0}, - 274: {region: 0x134, script: 0x1e, flags: 0x0}, - 275: {region: 0x66, script: 0x52, flags: 0x0}, - 276: {region: 0xc2, script: 0x52, flags: 0x0}, - 277: {region: 0xd4, script: 0x52, flags: 0x0}, - 278: {region: 0xa2, script: 0x52, flags: 0x0}, - 279: {region: 0xc1, script: 0x52, flags: 0x0}, - 280: {region: 0x104, script: 0x1e, flags: 0x0}, - 281: {region: 0xd4, script: 0x52, flags: 0x0}, - 282: {region: 0x161, script: 0x52, flags: 0x0}, - 283: {region: 0x12d, script: 0x52, flags: 0x0}, - 284: {region: 0x121, script: 0xd5, flags: 0x0}, - 285: {region: 0x59, script: 0x52, flags: 0x0}, - 286: {region: 0x51, script: 0x52, flags: 0x0}, - 287: {region: 0x4e, script: 0x52, flags: 0x0}, - 288: {region: 0x97, script: 0x20, flags: 0x0}, - 289: {region: 0x97, script: 0x20, flags: 0x0}, - 290: {region: 0x4a, script: 0x52, flags: 0x0}, - 291: {region: 0x93, script: 0x52, flags: 0x0}, - 292: {region: 0x40, script: 0x52, flags: 0x0}, - 293: {region: 0x97, script: 0x52, flags: 0x0}, - 294: {region: 0x52, script: 0xcc, flags: 0x0}, - 295: {region: 0x97, script: 0x20, flags: 0x0}, - 296: {region: 0xc1, script: 0x52, flags: 0x0}, - 297: {region: 0x97, script: 0x6b, flags: 0x0}, - 298: {region: 0xe6, script: 0x5, flags: 0x0}, - 299: {region: 0xa2, script: 0x52, flags: 0x0}, - 300: {region: 0x129, script: 0x52, flags: 0x0}, - 301: {region: 0xd0, script: 0x52, flags: 0x0}, - 302: {region: 0xad, script: 0x4f, flags: 0x0}, - 303: {region: 0x15, script: 0x6, flags: 0x1}, - 304: {region: 0x51, script: 0x52, flags: 0x0}, - 305: {region: 0x80, script: 0x52, flags: 0x0}, - 306: {region: 0xa2, script: 0x52, flags: 0x0}, - 307: {region: 0xa4, script: 0x46, flags: 0x0}, - 308: {region: 0x29, script: 0x52, flags: 0x0}, - 309: {region: 0x97, script: 0x4a, flags: 0x0}, - 310: {region: 0xa9, script: 0x4b, flags: 0x0}, - 311: {region: 0x104, script: 0x1e, flags: 0x0}, - 312: {region: 0x97, script: 0x20, flags: 0x0}, - 313: {region: 0x73, script: 0x52, flags: 0x0}, - 314: {region: 0xb2, script: 0x52, flags: 0x0}, - 316: {region: 0x104, script: 0x1e, flags: 0x0}, - 317: {region: 0x110, script: 0x52, flags: 0x0}, - 318: {region: 0xe5, script: 0x52, flags: 0x0}, - 319: {region: 0x104, script: 0x52, flags: 0x0}, - 320: {region: 0x97, script: 0x20, flags: 0x0}, - 321: {region: 0x97, script: 0x5, flags: 0x0}, - 322: {region: 0x12d, script: 0x52, flags: 0x0}, - 323: {region: 0x51, script: 0x52, flags: 0x0}, - 324: {region: 0x5f, script: 0x52, flags: 0x0}, - 325: {region: 0x1b, script: 0x3, flags: 0x1}, - 326: {region: 0x104, script: 0x1e, flags: 0x0}, - 327: {region: 0x104, script: 0x1e, flags: 0x0}, - 328: {region: 0x93, script: 0x52, flags: 0x0}, - 329: {region: 0xe6, script: 0x5, flags: 0x0}, - 330: {region: 0x79, script: 0x52, flags: 0x0}, - 331: {region: 0x121, script: 0xd5, flags: 0x0}, - 332: {region: 0xe6, script: 0x5, flags: 0x0}, - 333: {region: 0x1e, script: 0x5, flags: 0x1}, - 334: {region: 0x135, script: 0x52, flags: 0x0}, - 335: {region: 0x85, script: 0x56, flags: 0x0}, - 336: {region: 0x95, script: 0x37, flags: 0x0}, - 337: {region: 0x12d, script: 0x52, flags: 0x0}, - 338: {region: 0xe6, script: 0x5, flags: 0x0}, - 339: {region: 0x12f, script: 0x52, flags: 0x0}, - 340: {region: 0xb5, script: 0x52, flags: 0x0}, - 341: {region: 0x104, script: 0x1e, flags: 0x0}, - 342: {region: 0x93, script: 0x52, flags: 0x0}, - 343: {region: 0x52, script: 0xd5, flags: 0x0}, - 344: {region: 0x97, script: 0x54, flags: 0x0}, - 345: {region: 0x104, script: 0x1e, flags: 0x0}, - 346: {region: 0x12f, script: 0x52, flags: 0x0}, - 347: {region: 0xd7, script: 0x52, flags: 0x0}, - 348: {region: 0x23, script: 0x2, flags: 0x1}, - 349: {region: 0x9c, script: 0x52, flags: 0x0}, - 350: {region: 0x52, script: 0x58, flags: 0x0}, - 351: {region: 0x93, script: 0x52, flags: 0x0}, - 352: {region: 0x9a, script: 0x5, flags: 0x0}, - 353: {region: 0x132, script: 0x52, flags: 0x0}, - 354: {region: 0x97, script: 0xd0, flags: 0x0}, - 355: {region: 0x9c, script: 0x52, flags: 0x0}, - 356: {region: 0x4a, script: 0x52, flags: 0x0}, - 357: {region: 0xad, script: 0x4f, flags: 0x0}, - 358: {region: 0x4a, script: 0x52, flags: 0x0}, - 359: {region: 0x15f, script: 0x52, flags: 0x0}, - 360: {region: 0x9a, script: 0x5, flags: 0x0}, - 361: {region: 0xb4, script: 0x52, flags: 0x0}, - 362: {region: 0xb6, script: 0x52, flags: 0x0}, - 363: {region: 0x4a, script: 0x52, flags: 0x0}, - 364: {region: 0x4a, script: 0x52, flags: 0x0}, - 365: {region: 0xa2, script: 0x52, flags: 0x0}, - 366: {region: 0xa2, script: 0x52, flags: 0x0}, - 367: {region: 0x9a, script: 0x5, flags: 0x0}, - 368: {region: 0xb6, script: 0x52, flags: 0x0}, - 369: {region: 0x121, script: 0xd5, flags: 0x0}, - 370: {region: 0x52, script: 0x34, flags: 0x0}, - 371: {region: 0x129, script: 0x52, flags: 0x0}, - 372: {region: 0x93, script: 0x52, flags: 0x0}, - 373: {region: 0x51, script: 0x52, flags: 0x0}, - 374: {region: 0x97, script: 0x20, flags: 0x0}, - 375: {region: 0x97, script: 0x20, flags: 0x0}, - 376: {region: 0x93, script: 0x52, flags: 0x0}, - 377: {region: 0x25, script: 0x3, flags: 0x1}, - 378: {region: 0xa2, script: 0x52, flags: 0x0}, - 379: {region: 0xcd, script: 0x52, flags: 0x0}, - 380: {region: 0x104, script: 0x1e, flags: 0x0}, - 381: {region: 0xe5, script: 0x52, flags: 0x0}, - 382: {region: 0x93, script: 0x52, flags: 0x0}, - 383: {region: 0x110, script: 0x52, flags: 0x0}, - 384: {region: 0xa2, script: 0x52, flags: 0x0}, - 385: {region: 0x121, script: 0x5, flags: 0x0}, - 386: {region: 0xca, script: 0x52, flags: 0x0}, - 387: {region: 0xbd, script: 0x52, flags: 0x0}, - 388: {region: 0xcf, script: 0x52, flags: 0x0}, - 389: {region: 0x51, script: 0x52, flags: 0x0}, - 390: {region: 0xd9, script: 0x20, flags: 0x0}, - 391: {region: 0x12d, script: 0x52, flags: 0x0}, - 392: {region: 0xbe, script: 0x52, flags: 0x0}, - 393: {region: 0xde, script: 0x52, flags: 0x0}, - 394: {region: 0x93, script: 0x52, flags: 0x0}, - 395: {region: 0x99, script: 0x36, flags: 0x0}, - 396: {region: 0xc0, script: 0x1e, flags: 0x0}, - 397: {region: 0x97, script: 0x64, flags: 0x0}, - 398: {region: 0x109, script: 0x52, flags: 0x0}, - 399: {region: 0x28, script: 0x3, flags: 0x1}, - 400: {region: 0x97, script: 0xe, flags: 0x0}, - 401: {region: 0xc2, script: 0x6b, flags: 0x0}, - 403: {region: 0x48, script: 0x52, flags: 0x0}, - 404: {region: 0x48, script: 0x52, flags: 0x0}, - 405: {region: 0x36, script: 0x52, flags: 0x0}, - 406: {region: 0x97, script: 0x20, flags: 0x0}, - 407: {region: 0xd9, script: 0x20, flags: 0x0}, - 408: {region: 0x104, script: 0x1e, flags: 0x0}, - 409: {region: 0x34, script: 0x68, flags: 0x0}, - 410: {region: 0x2b, script: 0x3, flags: 0x1}, - 411: {region: 0xc9, script: 0x52, flags: 0x0}, - 412: {region: 0x97, script: 0x20, flags: 0x0}, - 413: {region: 0x51, script: 0x52, flags: 0x0}, - 415: {region: 0x132, script: 0x52, flags: 0x0}, - 416: {region: 0xe6, script: 0x5, flags: 0x0}, - 417: {region: 0xc1, script: 0x52, flags: 0x0}, - 418: {region: 0x97, script: 0x20, flags: 0x0}, - 419: {region: 0x93, script: 0x52, flags: 0x0}, - 420: {region: 0x161, script: 0x52, flags: 0x0}, - 421: {region: 0xc2, script: 0x6b, flags: 0x0}, - 422: {region: 0x104, script: 0x1e, flags: 0x0}, - 423: {region: 0x12f, script: 0x52, flags: 0x0}, - 424: {region: 0x9a, script: 0x5d, flags: 0x0}, - 425: {region: 0x9a, script: 0x5, flags: 0x0}, - 426: {region: 0xdb, script: 0x52, flags: 0x0}, - 428: {region: 0x52, script: 0x34, flags: 0x0}, - 429: {region: 0x9c, script: 0x52, flags: 0x0}, - 430: {region: 0xd0, script: 0x52, flags: 0x0}, - 431: {region: 0xd8, script: 0x52, flags: 0x0}, - 432: {region: 0xcd, script: 0x52, flags: 0x0}, - 433: {region: 0x161, script: 0x52, flags: 0x0}, - 434: {region: 0xcf, script: 0x52, flags: 0x0}, - 435: {region: 0x5f, script: 0x52, flags: 0x0}, - 436: {region: 0xd9, script: 0x20, flags: 0x0}, - 437: {region: 0xd9, script: 0x20, flags: 0x0}, - 438: {region: 0xd0, script: 0x52, flags: 0x0}, - 439: {region: 0xcf, script: 0x52, flags: 0x0}, - 440: {region: 0xcd, script: 0x52, flags: 0x0}, - 441: {region: 0xcd, script: 0x52, flags: 0x0}, - 442: {region: 0x93, script: 0x52, flags: 0x0}, - 443: {region: 0xdd, script: 0x52, flags: 0x0}, - 444: {region: 0x97, script: 0x52, flags: 0x0}, - 445: {region: 0xd7, script: 0x52, flags: 0x0}, - 446: {region: 0x51, script: 0x52, flags: 0x0}, - 447: {region: 0xd8, script: 0x52, flags: 0x0}, - 448: {region: 0x51, script: 0x52, flags: 0x0}, - 449: {region: 0xd8, script: 0x52, flags: 0x0}, - 450: {region: 0x121, script: 0x4e, flags: 0x0}, - 451: {region: 0x97, script: 0x20, flags: 0x0}, - 452: {region: 0x10a, script: 0xb7, flags: 0x0}, - 453: {region: 0x82, script: 0x70, flags: 0x0}, - 454: {region: 0x15e, script: 0x52, flags: 0x0}, - 455: {region: 0x48, script: 0x17, flags: 0x0}, - 456: {region: 0x15e, script: 0x52, flags: 0x0}, - 457: {region: 0x115, script: 0x52, flags: 0x0}, - 458: {region: 0x132, script: 0x52, flags: 0x0}, - 459: {region: 0x52, script: 0x52, flags: 0x0}, - 460: {region: 0xcc, script: 0x52, flags: 0x0}, - 461: {region: 0x12d, script: 0x52, flags: 0x0}, - 462: {region: 0x12f, script: 0x52, flags: 0x0}, - 463: {region: 0x7e, script: 0x52, flags: 0x0}, - 464: {region: 0x76, script: 0x52, flags: 0x0}, - 466: {region: 0x6e, script: 0x52, flags: 0x0}, - 467: {region: 0x97, script: 0x75, flags: 0x0}, - 468: {region: 0x7b, script: 0x1e, flags: 0x0}, - 469: {region: 0x132, script: 0x76, flags: 0x0}, - 470: {region: 0xc3, script: 0x74, flags: 0x0}, - 471: {region: 0x2e, script: 0x3, flags: 0x1}, - 472: {region: 0xe5, script: 0x52, flags: 0x0}, - 473: {region: 0x31, script: 0x2, flags: 0x1}, - 474: {region: 0xe5, script: 0x52, flags: 0x0}, - 475: {region: 0x2f, script: 0x52, flags: 0x0}, - 476: {region: 0xee, script: 0x52, flags: 0x0}, - 477: {region: 0x76, script: 0x52, flags: 0x0}, - 478: {region: 0xd4, script: 0x52, flags: 0x0}, - 479: {region: 0x132, script: 0x52, flags: 0x0}, - 480: {region: 0x48, script: 0x52, flags: 0x0}, - 481: {region: 0x9a, script: 0xdd, flags: 0x0}, - 482: {region: 0x5f, script: 0x52, flags: 0x0}, - 483: {region: 0xae, script: 0x7f, flags: 0x0}, - 485: {region: 0x97, script: 0x12, flags: 0x0}, - 486: {region: 0xa2, script: 0x52, flags: 0x0}, - 487: {region: 0xe7, script: 0x52, flags: 0x0}, - 488: {region: 0x9c, script: 0x52, flags: 0x0}, - 489: {region: 0x85, script: 0x2d, flags: 0x0}, - 490: {region: 0x73, script: 0x52, flags: 0x0}, - 491: {region: 0xe6, script: 0x45, flags: 0x0}, - 492: {region: 0x9a, script: 0x5, flags: 0x0}, - 493: {region: 0x1, script: 0x52, flags: 0x0}, - 494: {region: 0x23, script: 0x5, flags: 0x0}, - 495: {region: 0x40, script: 0x52, flags: 0x0}, - 496: {region: 0x78, script: 0x52, flags: 0x0}, - 497: {region: 0xe2, script: 0x52, flags: 0x0}, - 498: {region: 0x87, script: 0x52, flags: 0x0}, - 499: {region: 0x68, script: 0x52, flags: 0x0}, - 500: {region: 0x97, script: 0x20, flags: 0x0}, - 501: {region: 0x100, script: 0x52, flags: 0x0}, - 502: {region: 0x93, script: 0x52, flags: 0x0}, - 503: {region: 0x9c, script: 0x52, flags: 0x0}, - 504: {region: 0x97, script: 0x52, flags: 0x0}, - 505: {region: 0x33, script: 0x2, flags: 0x1}, - 506: {region: 0xd9, script: 0x20, flags: 0x0}, - 507: {region: 0x34, script: 0xe, flags: 0x0}, - 508: {region: 0x4d, script: 0x52, flags: 0x0}, - 509: {region: 0x70, script: 0x52, flags: 0x0}, - 510: {region: 0x4d, script: 0x52, flags: 0x0}, - 511: {region: 0x9a, script: 0x5, flags: 0x0}, - 512: {region: 0x10a, script: 0x52, flags: 0x0}, - 513: {region: 0x39, script: 0x52, flags: 0x0}, - 514: {region: 0xcf, script: 0x52, flags: 0x0}, - 515: {region: 0x102, script: 0x52, flags: 0x0}, - 516: {region: 0x93, script: 0x52, flags: 0x0}, - 517: {region: 0x12d, script: 0x52, flags: 0x0}, - 518: {region: 0x71, script: 0x52, flags: 0x0}, - 519: {region: 0x104, script: 0x1e, flags: 0x0}, - 520: {region: 0x12e, script: 0x1e, flags: 0x0}, - 521: {region: 0x107, script: 0x52, flags: 0x0}, - 522: {region: 0x105, script: 0x52, flags: 0x0}, - 523: {region: 0x12d, script: 0x52, flags: 0x0}, - 524: {region: 0xa0, script: 0x44, flags: 0x0}, - 525: {region: 0x97, script: 0x20, flags: 0x0}, - 526: {region: 0x7e, script: 0x52, flags: 0x0}, - 527: {region: 0x104, script: 0x1e, flags: 0x0}, - 528: {region: 0xa2, script: 0x52, flags: 0x0}, - 529: {region: 0x93, script: 0x52, flags: 0x0}, - 530: {region: 0x97, script: 0x52, flags: 0x0}, - 531: {region: 0x97, script: 0xbb, flags: 0x0}, - 532: {region: 0x12d, script: 0x52, flags: 0x0}, - 533: {region: 0x9c, script: 0x52, flags: 0x0}, - 534: {region: 0x97, script: 0x20, flags: 0x0}, - 535: {region: 0x9c, script: 0x52, flags: 0x0}, - 536: {region: 0x79, script: 0x52, flags: 0x0}, - 537: {region: 0x48, script: 0x52, flags: 0x0}, - 538: {region: 0x35, script: 0x4, flags: 0x1}, - 539: {region: 0x9c, script: 0x52, flags: 0x0}, - 540: {region: 0x9a, script: 0x5, flags: 0x0}, - 541: {region: 0xd8, script: 0x52, flags: 0x0}, - 542: {region: 0x4e, script: 0x52, flags: 0x0}, - 543: {region: 0xcf, script: 0x52, flags: 0x0}, - 544: {region: 0xcd, script: 0x52, flags: 0x0}, - 545: {region: 0xc1, script: 0x52, flags: 0x0}, - 546: {region: 0x4b, script: 0x52, flags: 0x0}, - 547: {region: 0x94, script: 0x72, flags: 0x0}, - 548: {region: 0xb4, script: 0x52, flags: 0x0}, - 550: {region: 0xb8, script: 0xd2, flags: 0x0}, - 551: {region: 0xc2, script: 0x6b, flags: 0x0}, - 552: {region: 0xb1, script: 0xc1, flags: 0x0}, - 553: {region: 0x6e, script: 0x52, flags: 0x0}, - 554: {region: 0x10f, script: 0x52, flags: 0x0}, - 555: {region: 0xe6, script: 0x5, flags: 0x0}, - 556: {region: 0x10d, script: 0x52, flags: 0x0}, - 557: {region: 0xe7, script: 0x52, flags: 0x0}, - 558: {region: 0x93, script: 0x52, flags: 0x0}, - 559: {region: 0x13f, script: 0x52, flags: 0x0}, - 560: {region: 0x10a, script: 0x52, flags: 0x0}, - 562: {region: 0x10a, script: 0x52, flags: 0x0}, - 563: {region: 0x70, script: 0x52, flags: 0x0}, - 564: {region: 0x95, script: 0xb8, flags: 0x0}, - 565: {region: 0x70, script: 0x52, flags: 0x0}, - 566: {region: 0x161, script: 0x52, flags: 0x0}, - 567: {region: 0xc1, script: 0x52, flags: 0x0}, - 568: {region: 0x113, script: 0x52, flags: 0x0}, - 569: {region: 0x121, script: 0xd5, flags: 0x0}, - 570: {region: 0x26, script: 0x52, flags: 0x0}, - 571: {region: 0x39, script: 0x5, flags: 0x1}, - 572: {region: 0x97, script: 0xc2, flags: 0x0}, - 573: {region: 0x114, script: 0x52, flags: 0x0}, - 574: {region: 0x112, script: 0x52, flags: 0x0}, - 575: {region: 0x97, script: 0x20, flags: 0x0}, - 576: {region: 0x15e, script: 0x52, flags: 0x0}, - 577: {region: 0x6c, script: 0x52, flags: 0x0}, - 578: {region: 0x15e, script: 0x52, flags: 0x0}, - 579: {region: 0x5f, script: 0x52, flags: 0x0}, - 580: {region: 0x93, script: 0x52, flags: 0x0}, - 581: {region: 0x12d, script: 0x52, flags: 0x0}, - 582: {region: 0x82, script: 0x52, flags: 0x0}, - 583: {region: 0x10a, script: 0x52, flags: 0x0}, - 584: {region: 0x12d, script: 0x52, flags: 0x0}, - 585: {region: 0x15c, script: 0x5, flags: 0x0}, - 586: {region: 0x4a, script: 0x52, flags: 0x0}, - 587: {region: 0x5f, script: 0x52, flags: 0x0}, - 588: {region: 0x97, script: 0x20, flags: 0x0}, - 589: {region: 0x93, script: 0x52, flags: 0x0}, - 590: {region: 0x34, script: 0xe, flags: 0x0}, - 591: {region: 0x99, script: 0xc5, flags: 0x0}, - 592: {region: 0xe7, script: 0x52, flags: 0x0}, - 593: {region: 0x97, script: 0xcd, flags: 0x0}, - 594: {region: 0xd9, script: 0x20, flags: 0x0}, - 595: {region: 0xe5, script: 0x52, flags: 0x0}, - 596: {region: 0x97, script: 0x4a, flags: 0x0}, - 597: {region: 0x52, script: 0xcb, flags: 0x0}, - 598: {region: 0xd9, script: 0x20, flags: 0x0}, - 599: {region: 0xd9, script: 0x20, flags: 0x0}, - 600: {region: 0x97, script: 0xd0, flags: 0x0}, - 601: {region: 0x110, script: 0x52, flags: 0x0}, - 602: {region: 0x12f, script: 0x52, flags: 0x0}, - 603: {region: 0x124, script: 0x52, flags: 0x0}, - 604: {region: 0x3e, script: 0x3, flags: 0x1}, - 605: {region: 0x121, script: 0xd5, flags: 0x0}, - 606: {region: 0xd9, script: 0x20, flags: 0x0}, - 607: {region: 0xd9, script: 0x20, flags: 0x0}, - 608: {region: 0xd9, script: 0x20, flags: 0x0}, - 609: {region: 0x6e, script: 0x27, flags: 0x0}, - 610: {region: 0x6c, script: 0x27, flags: 0x0}, - 611: {region: 0xd4, script: 0x52, flags: 0x0}, - 612: {region: 0x125, script: 0x52, flags: 0x0}, - 613: {region: 0x123, script: 0x52, flags: 0x0}, - 614: {region: 0x31, script: 0x52, flags: 0x0}, - 615: {region: 0xd9, script: 0x20, flags: 0x0}, - 616: {region: 0xe5, script: 0x52, flags: 0x0}, - 617: {region: 0x31, script: 0x52, flags: 0x0}, - 618: {region: 0xd2, script: 0x52, flags: 0x0}, - 619: {region: 0x15e, script: 0x52, flags: 0x0}, - 620: {region: 0x127, script: 0x52, flags: 0x0}, - 621: {region: 0xcc, script: 0x52, flags: 0x0}, - 622: {region: 0xe4, script: 0x52, flags: 0x0}, - 623: {region: 0x129, script: 0x52, flags: 0x0}, - 624: {region: 0x129, script: 0x52, flags: 0x0}, - 625: {region: 0x12c, script: 0x52, flags: 0x0}, - 626: {region: 0x15e, script: 0x52, flags: 0x0}, - 627: {region: 0x85, script: 0x2d, flags: 0x0}, - 628: {region: 0xd9, script: 0x20, flags: 0x0}, - 629: {region: 0xe5, script: 0x52, flags: 0x0}, - 630: {region: 0x42, script: 0xd6, flags: 0x0}, - 631: {region: 0x104, script: 0x1e, flags: 0x0}, - 632: {region: 0x12f, script: 0x52, flags: 0x0}, - 633: {region: 0x121, script: 0xd5, flags: 0x0}, - 634: {region: 0x31, script: 0x52, flags: 0x0}, - 635: {region: 0xcc, script: 0x52, flags: 0x0}, - 636: {region: 0x12b, script: 0x52, flags: 0x0}, - 638: {region: 0xd2, script: 0x52, flags: 0x0}, - 639: {region: 0x52, script: 0xce, flags: 0x0}, - 640: {region: 0xe3, script: 0x52, flags: 0x0}, - 641: {region: 0x104, script: 0x1e, flags: 0x0}, - 642: {region: 0xb8, script: 0x52, flags: 0x0}, - 643: {region: 0x104, script: 0x1e, flags: 0x0}, - 644: {region: 0x41, script: 0x4, flags: 0x1}, - 645: {region: 0x11a, script: 0xd8, flags: 0x0}, - 646: {region: 0x12e, script: 0x1e, flags: 0x0}, - 647: {region: 0x73, script: 0x52, flags: 0x0}, - 648: {region: 0x29, script: 0x52, flags: 0x0}, - 650: {region: 0x45, script: 0x3, flags: 0x1}, - 651: {region: 0x97, script: 0xe, flags: 0x0}, - 652: {region: 0xe6, script: 0x5, flags: 0x0}, - 653: {region: 0x48, script: 0x4, flags: 0x1}, - 654: {region: 0xb2, script: 0xd9, flags: 0x0}, - 655: {region: 0x15e, script: 0x52, flags: 0x0}, - 656: {region: 0x9c, script: 0x52, flags: 0x0}, - 657: {region: 0x104, script: 0x52, flags: 0x0}, - 658: {region: 0x13b, script: 0x52, flags: 0x0}, - 659: {region: 0x119, script: 0x52, flags: 0x0}, - 660: {region: 0x35, script: 0x52, flags: 0x0}, - 661: {region: 0x5f, script: 0x52, flags: 0x0}, - 662: {region: 0xcf, script: 0x52, flags: 0x0}, - 663: {region: 0x1, script: 0x52, flags: 0x0}, - 664: {region: 0x104, script: 0x52, flags: 0x0}, - 665: {region: 0x69, script: 0x52, flags: 0x0}, - 666: {region: 0x12d, script: 0x52, flags: 0x0}, - 667: {region: 0x35, script: 0x52, flags: 0x0}, - 668: {region: 0x4d, script: 0x52, flags: 0x0}, - 669: {region: 0x6e, script: 0x27, flags: 0x0}, - 670: {region: 0xe5, script: 0x52, flags: 0x0}, - 671: {region: 0x2e, script: 0x52, flags: 0x0}, - 672: {region: 0x97, script: 0xd0, flags: 0x0}, - 673: {region: 0x97, script: 0x20, flags: 0x0}, - 674: {region: 0x13d, script: 0x52, flags: 0x0}, - 675: {region: 0xa6, script: 0x5, flags: 0x0}, - 676: {region: 0x112, script: 0x52, flags: 0x0}, - 677: {region: 0x97, script: 0x20, flags: 0x0}, - 678: {region: 0x52, script: 0x34, flags: 0x0}, - 679: {region: 0x40, script: 0x52, flags: 0x0}, - 680: {region: 0x129, script: 0x18, flags: 0x0}, - 681: {region: 0x15e, script: 0x52, flags: 0x0}, - 682: {region: 0x129, script: 0x5a, flags: 0x0}, - 683: {region: 0x129, script: 0x5b, flags: 0x0}, - 684: {region: 0x7b, script: 0x29, flags: 0x0}, - 685: {region: 0x52, script: 0x5e, flags: 0x0}, - 686: {region: 0x109, script: 0x62, flags: 0x0}, - 687: {region: 0x106, script: 0x6c, flags: 0x0}, - 688: {region: 0x97, script: 0x20, flags: 0x0}, - 689: {region: 0x12f, script: 0x52, flags: 0x0}, - 690: {region: 0x9a, script: 0x82, flags: 0x0}, - 691: {region: 0x15b, script: 0xba, flags: 0x0}, - 692: {region: 0xd9, script: 0x20, flags: 0x0}, - 693: {region: 0xcf, script: 0x52, flags: 0x0}, - 694: {region: 0x73, script: 0x52, flags: 0x0}, - 695: {region: 0x51, script: 0x52, flags: 0x0}, - 696: {region: 0x51, script: 0x52, flags: 0x0}, - 697: {region: 0x1, script: 0x37, flags: 0x0}, - 698: {region: 0xd4, script: 0x52, flags: 0x0}, - 699: {region: 0x40, script: 0x52, flags: 0x0}, - 700: {region: 0xcd, script: 0x52, flags: 0x0}, - 701: {region: 0x4c, script: 0x3, flags: 0x1}, - 702: {region: 0x52, script: 0x52, flags: 0x0}, - 703: {region: 0x109, script: 0x52, flags: 0x0}, - 705: {region: 0xa6, script: 0x5, flags: 0x0}, - 706: {region: 0xd7, script: 0x52, flags: 0x0}, - 707: {region: 0xb8, script: 0xd2, flags: 0x0}, - 708: {region: 0x4f, script: 0x14, flags: 0x1}, - 709: {region: 0xce, script: 0x52, flags: 0x0}, - 710: {region: 0x15e, script: 0x52, flags: 0x0}, - 712: {region: 0x129, script: 0x52, flags: 0x0}, +// Size: 5308 bytes, 1327 elements +var likelyLang = [1327]likelyScriptRegion{ + 0: {region: 0x134, script: 0x52, flags: 0x0}, + 1: {region: 0x6e, script: 0x52, flags: 0x0}, + 2: {region: 0x164, script: 0x52, flags: 0x0}, + 3: {region: 0x164, script: 0x52, flags: 0x0}, + 4: {region: 0x164, script: 0x52, flags: 0x0}, + 5: {region: 0x7c, script: 0x1e, flags: 0x0}, + 6: {region: 0x164, script: 0x52, flags: 0x0}, + 7: {region: 0x164, script: 0x1e, flags: 0x0}, + 8: {region: 0x7f, script: 0x52, flags: 0x0}, + 9: {region: 0x164, script: 0x52, flags: 0x0}, + 10: {region: 0x164, script: 0x52, flags: 0x0}, + 11: {region: 0x164, script: 0x52, flags: 0x0}, + 12: {region: 0x94, script: 0x52, flags: 0x0}, + 13: {region: 0x130, script: 0x52, flags: 0x0}, + 14: {region: 0x7f, script: 0x52, flags: 0x0}, + 15: {region: 0x164, script: 0x52, flags: 0x0}, + 16: {region: 0x164, script: 0x52, flags: 0x0}, + 17: {region: 0x105, script: 0x1e, flags: 0x0}, + 18: {region: 0x164, script: 0x52, flags: 0x0}, + 19: {region: 0x9b, script: 0x9, flags: 0x0}, + 20: {region: 0x127, script: 0x5, flags: 0x0}, + 21: {region: 0x164, script: 0x52, flags: 0x0}, + 22: {region: 0x160, script: 0x52, flags: 0x0}, + 23: {region: 0x164, script: 0x52, flags: 0x0}, + 24: {region: 0x164, script: 0x52, flags: 0x0}, + 25: {region: 0x164, script: 0x52, flags: 0x0}, + 26: {region: 0x164, script: 0x52, flags: 0x0}, + 27: {region: 0x164, script: 0x52, flags: 0x0}, + 28: {region: 0x51, script: 0x52, flags: 0x0}, + 29: {region: 0x164, script: 0x52, flags: 0x0}, + 30: {region: 0x164, script: 0x52, flags: 0x0}, + 31: {region: 0x98, script: 0x4, flags: 0x0}, + 32: {region: 0x164, script: 0x52, flags: 0x0}, + 33: {region: 0x7f, script: 0x52, flags: 0x0}, + 34: {region: 0x9a, script: 0xde, flags: 0x0}, + 35: {region: 0x164, script: 0x52, flags: 0x0}, + 36: {region: 0x164, script: 0x52, flags: 0x0}, + 37: {region: 0x14c, script: 0x52, flags: 0x0}, + 38: {region: 0x105, script: 0x1e, flags: 0x0}, + 39: {region: 0x6e, script: 0x27, flags: 0x0}, + 40: {region: 0x164, script: 0x52, flags: 0x0}, + 41: {region: 0x164, script: 0x52, flags: 0x0}, + 42: {region: 0xd5, script: 0x52, flags: 0x0}, + 43: {region: 0x164, script: 0x52, flags: 0x0}, + 45: {region: 0x164, script: 0x52, flags: 0x0}, + 46: {region: 0x164, script: 0x52, flags: 0x0}, + 47: {region: 0x164, script: 0x52, flags: 0x0}, + 48: {region: 0x164, script: 0x52, flags: 0x0}, + 49: {region: 0x164, script: 0x52, flags: 0x0}, + 50: {region: 0x164, script: 0x52, flags: 0x0}, + 51: {region: 0x94, script: 0x52, flags: 0x0}, + 52: {region: 0x164, script: 0x5, flags: 0x0}, + 53: {region: 0x121, script: 0x5, flags: 0x0}, + 54: {region: 0x164, script: 0x52, flags: 0x0}, + 55: {region: 0x164, script: 0x52, flags: 0x0}, + 56: {region: 0x164, script: 0x52, flags: 0x0}, + 57: {region: 0x164, script: 0x52, flags: 0x0}, + 58: {region: 0x6a, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x164, script: 0x52, flags: 0x0}, + 61: {region: 0x50, script: 0x52, flags: 0x0}, + 62: {region: 0x3e, script: 0x52, flags: 0x0}, + 63: {region: 0x66, script: 0x5, flags: 0x0}, + 65: {region: 0xb9, script: 0x5, flags: 0x0}, + 66: {region: 0x6a, script: 0x5, flags: 0x0}, + 67: {region: 0x98, script: 0xe, flags: 0x0}, + 68: {region: 0x12e, script: 0x52, flags: 0x0}, + 69: {region: 0x134, script: 0xbc, flags: 0x0}, + 70: {region: 0x164, script: 0x52, flags: 0x0}, + 71: {region: 0x164, script: 0x52, flags: 0x0}, + 72: {region: 0x6d, script: 0x52, flags: 0x0}, + 73: {region: 0x164, script: 0x52, flags: 0x0}, + 74: {region: 0x164, script: 0x52, flags: 0x0}, + 75: {region: 0x48, script: 0x52, flags: 0x0}, + 76: {region: 0x164, script: 0x52, flags: 0x0}, + 77: {region: 0x105, script: 0x1e, flags: 0x0}, + 78: {region: 0x164, script: 0x5, flags: 0x0}, + 79: {region: 0x164, script: 0x52, flags: 0x0}, + 80: {region: 0x164, script: 0x52, flags: 0x0}, + 81: {region: 0x164, script: 0x52, flags: 0x0}, + 82: {region: 0x98, script: 0x20, flags: 0x0}, + 83: {region: 0x164, script: 0x52, flags: 0x0}, + 84: {region: 0x164, script: 0x52, flags: 0x0}, + 85: {region: 0x164, script: 0x52, flags: 0x0}, + 86: {region: 0x3e, script: 0x52, flags: 0x0}, + 87: {region: 0x164, script: 0x52, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x105, script: 0x1e, flags: 0x0}, + 90: {region: 0xe7, script: 0x5, flags: 0x0}, + 91: {region: 0x94, script: 0x52, flags: 0x0}, + 92: {region: 0xda, script: 0x20, flags: 0x0}, + 93: {region: 0x2d, script: 0x52, flags: 0x0}, + 94: {region: 0x51, script: 0x52, flags: 0x0}, + 95: {region: 0x164, script: 0x52, flags: 0x0}, + 96: {region: 0x51, script: 0xb, flags: 0x0}, + 97: {region: 0x164, script: 0x52, flags: 0x0}, + 98: {region: 0x164, script: 0x52, flags: 0x0}, + 99: {region: 0x94, script: 0x52, flags: 0x0}, + 100: {region: 0x164, script: 0x52, flags: 0x0}, + 101: {region: 0x51, script: 0x52, flags: 0x0}, + 102: {region: 0x164, script: 0x52, flags: 0x0}, + 103: {region: 0x164, script: 0x52, flags: 0x0}, + 104: {region: 0x164, script: 0x52, flags: 0x0}, + 105: {region: 0x164, script: 0x52, flags: 0x0}, + 106: {region: 0x4e, script: 0x52, flags: 0x0}, + 107: {region: 0x164, script: 0x52, flags: 0x0}, + 108: {region: 0x164, script: 0x52, flags: 0x0}, + 109: {region: 0x164, script: 0x52, flags: 0x0}, + 110: {region: 0x164, script: 0x27, flags: 0x0}, + 111: {region: 0x164, script: 0x52, flags: 0x0}, + 112: {region: 0x164, script: 0x52, flags: 0x0}, + 113: {region: 0x46, script: 0x1e, flags: 0x0}, + 114: {region: 0x164, script: 0x52, flags: 0x0}, + 115: {region: 0x164, script: 0x52, flags: 0x0}, + 116: {region: 0x10a, script: 0x5, flags: 0x0}, + 117: {region: 0x161, script: 0x52, flags: 0x0}, + 118: {region: 0x164, script: 0x52, flags: 0x0}, + 119: {region: 0x94, script: 0x52, flags: 0x0}, + 120: {region: 0x164, script: 0x52, flags: 0x0}, + 121: {region: 0x12e, script: 0x52, flags: 0x0}, + 122: {region: 0x51, script: 0x52, flags: 0x0}, + 123: {region: 0x98, script: 0xcd, flags: 0x0}, + 124: {region: 0xe7, script: 0x5, flags: 0x0}, + 125: {region: 0x98, script: 0x20, flags: 0x0}, + 126: {region: 0x37, script: 0x1e, flags: 0x0}, + 127: {region: 0x98, script: 0x20, flags: 0x0}, + 128: {region: 0xe7, script: 0x5, flags: 0x0}, + 129: {region: 0x12a, script: 0x2d, flags: 0x0}, + 131: {region: 0x98, script: 0x20, flags: 0x0}, + 132: {region: 0x164, script: 0x52, flags: 0x0}, + 133: {region: 0x98, script: 0x20, flags: 0x0}, + 134: {region: 0xe6, script: 0x52, flags: 0x0}, + 135: {region: 0x164, script: 0x52, flags: 0x0}, + 136: {region: 0x98, script: 0x20, flags: 0x0}, + 137: {region: 0x164, script: 0x52, flags: 0x0}, + 138: {region: 0x13e, script: 0x52, flags: 0x0}, + 139: {region: 0x164, script: 0x52, flags: 0x0}, + 140: {region: 0x164, script: 0x52, flags: 0x0}, + 141: {region: 0xe6, script: 0x52, flags: 0x0}, + 142: {region: 0x164, script: 0x52, flags: 0x0}, + 143: {region: 0xd5, script: 0x52, flags: 0x0}, + 144: {region: 0x164, script: 0x52, flags: 0x0}, + 145: {region: 0x164, script: 0x52, flags: 0x0}, + 146: {region: 0x164, script: 0x52, flags: 0x0}, + 147: {region: 0x164, script: 0x27, flags: 0x0}, + 148: {region: 0x98, script: 0x20, flags: 0x0}, + 149: {region: 0x94, script: 0x52, flags: 0x0}, + 150: {region: 0x164, script: 0x52, flags: 0x0}, + 151: {region: 0x164, script: 0x52, flags: 0x0}, + 152: {region: 0x113, script: 0x52, flags: 0x0}, + 153: {region: 0x164, script: 0x52, flags: 0x0}, + 154: {region: 0x164, script: 0x52, flags: 0x0}, + 155: {region: 0x51, script: 0x52, flags: 0x0}, + 156: {region: 0x164, script: 0x52, flags: 0x0}, + 157: {region: 0xe6, script: 0x52, flags: 0x0}, + 158: {region: 0x164, script: 0x52, flags: 0x0}, + 159: {region: 0x13d, script: 0xcf, flags: 0x0}, + 160: {region: 0xc2, script: 0x52, flags: 0x0}, + 161: {region: 0x164, script: 0x52, flags: 0x0}, + 162: {region: 0x164, script: 0x52, flags: 0x0}, + 163: {region: 0xc2, script: 0x52, flags: 0x0}, + 164: {region: 0x164, script: 0x52, flags: 0x0}, + 165: {region: 0x34, script: 0xe, flags: 0x0}, + 166: {region: 0x164, script: 0x52, flags: 0x0}, + 167: {region: 0x164, script: 0x52, flags: 0x0}, + 168: {region: 0x164, script: 0x52, flags: 0x0}, + 169: {region: 0x52, script: 0xd6, flags: 0x0}, + 170: {region: 0x164, script: 0x52, flags: 0x0}, + 171: {region: 0x164, script: 0x52, flags: 0x0}, + 172: {region: 0x164, script: 0x52, flags: 0x0}, + 173: {region: 0x98, script: 0xe, flags: 0x0}, + 174: {region: 0x164, script: 0x52, flags: 0x0}, + 175: {region: 0x9b, script: 0x5, flags: 0x0}, + 176: {region: 0x164, script: 0x52, flags: 0x0}, + 177: {region: 0x4e, script: 0x52, flags: 0x0}, + 178: {region: 0x77, script: 0x52, flags: 0x0}, + 179: {region: 0x98, script: 0x20, flags: 0x0}, + 180: {region: 0xe7, script: 0x5, flags: 0x0}, + 181: {region: 0x98, script: 0x20, flags: 0x0}, + 182: {region: 0x164, script: 0x52, flags: 0x0}, + 183: {region: 0x32, script: 0x52, flags: 0x0}, + 184: {region: 0x164, script: 0x52, flags: 0x0}, + 185: {region: 0xb3, script: 0xc, flags: 0x0}, + 186: {region: 0x51, script: 0x52, flags: 0x0}, + 187: {region: 0x164, script: 0x27, flags: 0x0}, + 188: {region: 0xe6, script: 0x52, flags: 0x0}, + 189: {region: 0x164, script: 0x52, flags: 0x0}, + 190: {region: 0xe7, script: 0x20, flags: 0x0}, + 191: {region: 0x105, script: 0x1e, flags: 0x0}, + 192: {region: 0x15e, script: 0x52, flags: 0x0}, + 193: {region: 0x164, script: 0x52, flags: 0x0}, + 194: {region: 0x94, script: 0x52, flags: 0x0}, + 195: {region: 0x164, script: 0x52, flags: 0x0}, + 196: {region: 0x51, script: 0x52, flags: 0x0}, + 197: {region: 0x164, script: 0x52, flags: 0x0}, + 198: {region: 0x164, script: 0x52, flags: 0x0}, + 199: {region: 0x164, script: 0x52, flags: 0x0}, + 200: {region: 0x85, script: 0x52, flags: 0x0}, + 201: {region: 0x164, script: 0x52, flags: 0x0}, + 202: {region: 0x164, script: 0x52, flags: 0x0}, + 203: {region: 0x164, script: 0x52, flags: 0x0}, + 204: {region: 0x164, script: 0x52, flags: 0x0}, + 205: {region: 0x6c, script: 0x27, flags: 0x0}, + 206: {region: 0x164, script: 0x52, flags: 0x0}, + 207: {region: 0x164, script: 0x52, flags: 0x0}, + 208: {region: 0x51, script: 0x52, flags: 0x0}, + 209: {region: 0x164, script: 0x52, flags: 0x0}, + 210: {region: 0x164, script: 0x52, flags: 0x0}, + 211: {region: 0xc2, script: 0x52, flags: 0x0}, + 212: {region: 0x164, script: 0x52, flags: 0x0}, + 213: {region: 0x164, script: 0x52, flags: 0x0}, + 214: {region: 0x164, script: 0x52, flags: 0x0}, + 215: {region: 0x6d, script: 0x52, flags: 0x0}, + 216: {region: 0x164, script: 0x52, flags: 0x0}, + 217: {region: 0x164, script: 0x52, flags: 0x0}, + 218: {region: 0xd5, script: 0x52, flags: 0x0}, + 219: {region: 0x34, script: 0x16, flags: 0x0}, + 220: {region: 0x105, script: 0x1e, flags: 0x0}, + 221: {region: 0xe6, script: 0x52, flags: 0x0}, + 222: {region: 0x164, script: 0x52, flags: 0x0}, + 223: {region: 0x130, script: 0x52, flags: 0x0}, + 224: {region: 0x89, script: 0x52, flags: 0x0}, + 225: {region: 0x74, script: 0x52, flags: 0x0}, + 226: {region: 0x105, script: 0x1e, flags: 0x0}, + 227: {region: 0x134, script: 0x52, flags: 0x0}, + 228: {region: 0x48, script: 0x52, flags: 0x0}, + 229: {region: 0x134, script: 0x1a, flags: 0x0}, + 230: {region: 0xa5, script: 0x5, flags: 0x0}, + 231: {region: 0x13d, script: 0x19, flags: 0x0}, + 232: {region: 0x164, script: 0x52, flags: 0x0}, + 233: {region: 0x9a, script: 0x5, flags: 0x0}, + 234: {region: 0x164, script: 0x52, flags: 0x0}, + 235: {region: 0x164, script: 0x52, flags: 0x0}, + 236: {region: 0x164, script: 0x52, flags: 0x0}, + 237: {region: 0x164, script: 0x52, flags: 0x0}, + 238: {region: 0x164, script: 0x52, flags: 0x0}, + 239: {region: 0x77, script: 0x52, flags: 0x0}, + 240: {region: 0x6a, script: 0x1c, flags: 0x0}, + 241: {region: 0xe6, script: 0x52, flags: 0x0}, + 242: {region: 0x48, script: 0x17, flags: 0x0}, + 243: {region: 0x12f, script: 0x1e, flags: 0x0}, + 244: {region: 0x48, script: 0x17, flags: 0x0}, + 245: {region: 0x48, script: 0x17, flags: 0x0}, + 246: {region: 0x48, script: 0x17, flags: 0x0}, + 247: {region: 0x48, script: 0x17, flags: 0x0}, + 248: {region: 0x109, script: 0x52, flags: 0x0}, + 249: {region: 0x5d, script: 0x52, flags: 0x0}, + 250: {region: 0xe8, script: 0x52, flags: 0x0}, + 251: {region: 0x48, script: 0x17, flags: 0x0}, + 252: {region: 0xc3, script: 0x79, flags: 0x0}, + 253: {region: 0x8, script: 0x2, flags: 0x1}, + 254: {region: 0x105, script: 0x1e, flags: 0x0}, + 255: {region: 0x7a, script: 0x52, flags: 0x0}, + 256: {region: 0x62, script: 0x52, flags: 0x0}, + 257: {region: 0x164, script: 0x52, flags: 0x0}, + 258: {region: 0x164, script: 0x52, flags: 0x0}, + 259: {region: 0x164, script: 0x52, flags: 0x0}, + 260: {region: 0x164, script: 0x52, flags: 0x0}, + 261: {region: 0x134, script: 0x52, flags: 0x0}, + 262: {region: 0x105, script: 0x1e, flags: 0x0}, + 263: {region: 0xa3, script: 0x52, flags: 0x0}, + 264: {region: 0x164, script: 0x52, flags: 0x0}, + 265: {region: 0x164, script: 0x52, flags: 0x0}, + 266: {region: 0x98, script: 0x5, flags: 0x0}, + 267: {region: 0x164, script: 0x52, flags: 0x0}, + 268: {region: 0x5f, script: 0x52, flags: 0x0}, + 269: {region: 0x164, script: 0x52, flags: 0x0}, + 270: {region: 0x48, script: 0x52, flags: 0x0}, + 271: {region: 0x164, script: 0x52, flags: 0x0}, + 272: {region: 0x164, script: 0x52, flags: 0x0}, + 273: {region: 0x164, script: 0x52, flags: 0x0}, + 274: {region: 0x164, script: 0x5, flags: 0x0}, + 275: {region: 0x48, script: 0x52, flags: 0x0}, + 276: {region: 0x164, script: 0x52, flags: 0x0}, + 277: {region: 0x164, script: 0x52, flags: 0x0}, + 278: {region: 0xd3, script: 0x52, flags: 0x0}, + 279: {region: 0x4e, script: 0x52, flags: 0x0}, + 280: {region: 0x164, script: 0x52, flags: 0x0}, + 281: {region: 0x98, script: 0x5, flags: 0x0}, + 282: {region: 0x164, script: 0x52, flags: 0x0}, + 283: {region: 0x164, script: 0x52, flags: 0x0}, + 284: {region: 0x164, script: 0x52, flags: 0x0}, + 285: {region: 0x164, script: 0x27, flags: 0x0}, + 286: {region: 0x5f, script: 0x52, flags: 0x0}, + 287: {region: 0xc2, script: 0x52, flags: 0x0}, + 288: {region: 0xcf, script: 0x52, flags: 0x0}, + 289: {region: 0x164, script: 0x52, flags: 0x0}, + 290: {region: 0xda, script: 0x20, flags: 0x0}, + 291: {region: 0x51, script: 0x52, flags: 0x0}, + 292: {region: 0x164, script: 0x52, flags: 0x0}, + 293: {region: 0x164, script: 0x52, flags: 0x0}, + 294: {region: 0x164, script: 0x52, flags: 0x0}, + 295: {region: 0xcc, script: 0xd4, flags: 0x0}, + 296: {region: 0x164, script: 0x52, flags: 0x0}, + 297: {region: 0x164, script: 0x52, flags: 0x0}, + 298: {region: 0x113, script: 0x52, flags: 0x0}, + 299: {region: 0x36, script: 0x52, flags: 0x0}, + 300: {region: 0x42, script: 0xd6, flags: 0x0}, + 301: {region: 0x164, script: 0x52, flags: 0x0}, + 302: {region: 0xa3, script: 0x52, flags: 0x0}, + 303: {region: 0x7f, script: 0x52, flags: 0x0}, + 304: {region: 0xd5, script: 0x52, flags: 0x0}, + 305: {region: 0x9d, script: 0x52, flags: 0x0}, + 306: {region: 0x6a, script: 0x25, flags: 0x0}, + 307: {region: 0x164, script: 0x52, flags: 0x0}, + 308: {region: 0xc3, script: 0x43, flags: 0x0}, + 309: {region: 0x86, script: 0x2d, flags: 0x0}, + 310: {region: 0x164, script: 0x52, flags: 0x0}, + 311: {region: 0x164, script: 0x52, flags: 0x0}, + 312: {region: 0xa, script: 0x2, flags: 0x1}, + 313: {region: 0x164, script: 0x52, flags: 0x0}, + 314: {region: 0x164, script: 0x52, flags: 0x0}, + 315: {region: 0x1, script: 0x52, flags: 0x0}, + 316: {region: 0x164, script: 0x52, flags: 0x0}, + 317: {region: 0x6d, script: 0x52, flags: 0x0}, + 318: {region: 0x134, script: 0x52, flags: 0x0}, + 319: {region: 0x69, script: 0x52, flags: 0x0}, + 320: {region: 0x164, script: 0x52, flags: 0x0}, + 321: {region: 0x9d, script: 0x3e, flags: 0x0}, + 322: {region: 0x164, script: 0x52, flags: 0x0}, + 323: {region: 0x164, script: 0x52, flags: 0x0}, + 324: {region: 0x6d, script: 0x52, flags: 0x0}, + 325: {region: 0x51, script: 0x52, flags: 0x0}, + 326: {region: 0x6d, script: 0x52, flags: 0x0}, + 327: {region: 0x9b, script: 0x5, flags: 0x0}, + 328: {region: 0x164, script: 0x52, flags: 0x0}, + 329: {region: 0x164, script: 0x52, flags: 0x0}, + 330: {region: 0x164, script: 0x52, flags: 0x0}, + 331: {region: 0x164, script: 0x52, flags: 0x0}, + 332: {region: 0x85, script: 0x52, flags: 0x0}, + 333: {region: 0xc, script: 0x2, flags: 0x1}, + 334: {region: 0x164, script: 0x52, flags: 0x0}, + 335: {region: 0xc2, script: 0x52, flags: 0x0}, + 336: {region: 0x71, script: 0x52, flags: 0x0}, + 337: {region: 0x10a, script: 0x5, flags: 0x0}, + 338: {region: 0xe6, script: 0x52, flags: 0x0}, + 339: {region: 0x10b, script: 0x52, flags: 0x0}, + 340: {region: 0x72, script: 0x52, flags: 0x0}, + 341: {region: 0x164, script: 0x52, flags: 0x0}, + 342: {region: 0x164, script: 0x52, flags: 0x0}, + 343: {region: 0x75, script: 0x52, flags: 0x0}, + 344: {region: 0x164, script: 0x52, flags: 0x0}, + 345: {region: 0x3a, script: 0x52, flags: 0x0}, + 346: {region: 0x164, script: 0x52, flags: 0x0}, + 347: {region: 0x164, script: 0x52, flags: 0x0}, + 348: {region: 0x164, script: 0x52, flags: 0x0}, + 349: {region: 0x77, script: 0x52, flags: 0x0}, + 350: {region: 0x134, script: 0x52, flags: 0x0}, + 351: {region: 0x77, script: 0x52, flags: 0x0}, + 352: {region: 0x5f, script: 0x52, flags: 0x0}, + 353: {region: 0x5f, script: 0x52, flags: 0x0}, + 354: {region: 0x51, script: 0x5, flags: 0x0}, + 355: {region: 0x13f, script: 0x52, flags: 0x0}, + 356: {region: 0x164, script: 0x52, flags: 0x0}, + 357: {region: 0x83, script: 0x52, flags: 0x0}, + 358: {region: 0x164, script: 0x52, flags: 0x0}, + 359: {region: 0xd3, script: 0x52, flags: 0x0}, + 360: {region: 0x9d, script: 0x52, flags: 0x0}, + 361: {region: 0xd5, script: 0x52, flags: 0x0}, + 362: {region: 0x164, script: 0x52, flags: 0x0}, + 363: {region: 0x10a, script: 0x52, flags: 0x0}, + 364: {region: 0xd8, script: 0x52, flags: 0x0}, + 365: {region: 0x95, script: 0x52, flags: 0x0}, + 366: {region: 0x7f, script: 0x52, flags: 0x0}, + 367: {region: 0x164, script: 0x52, flags: 0x0}, + 368: {region: 0xbb, script: 0x52, flags: 0x0}, + 369: {region: 0x164, script: 0x52, flags: 0x0}, + 370: {region: 0x164, script: 0x52, flags: 0x0}, + 371: {region: 0x164, script: 0x52, flags: 0x0}, + 372: {region: 0x52, script: 0x34, flags: 0x0}, + 373: {region: 0x164, script: 0x52, flags: 0x0}, + 374: {region: 0x94, script: 0x52, flags: 0x0}, + 375: {region: 0x164, script: 0x52, flags: 0x0}, + 376: {region: 0x98, script: 0x20, flags: 0x0}, + 377: {region: 0x164, script: 0x52, flags: 0x0}, + 378: {region: 0x9b, script: 0x5, flags: 0x0}, + 379: {region: 0x7d, script: 0x52, flags: 0x0}, + 380: {region: 0x7a, script: 0x52, flags: 0x0}, + 381: {region: 0x164, script: 0x52, flags: 0x0}, + 382: {region: 0x164, script: 0x52, flags: 0x0}, + 383: {region: 0x164, script: 0x52, flags: 0x0}, + 384: {region: 0x164, script: 0x52, flags: 0x0}, + 385: {region: 0x164, script: 0x52, flags: 0x0}, + 386: {region: 0x164, script: 0x52, flags: 0x0}, + 387: {region: 0x6e, script: 0x27, flags: 0x0}, + 388: {region: 0x164, script: 0x52, flags: 0x0}, + 389: {region: 0xda, script: 0x20, flags: 0x0}, + 390: {region: 0x164, script: 0x52, flags: 0x0}, + 391: {region: 0xa6, script: 0x52, flags: 0x0}, + 392: {region: 0x164, script: 0x52, flags: 0x0}, + 393: {region: 0xe7, script: 0x5, flags: 0x0}, + 394: {region: 0x164, script: 0x52, flags: 0x0}, + 395: {region: 0xe7, script: 0x5, flags: 0x0}, + 396: {region: 0x164, script: 0x52, flags: 0x0}, + 397: {region: 0x164, script: 0x52, flags: 0x0}, + 398: {region: 0x6d, script: 0x52, flags: 0x0}, + 399: {region: 0x9b, script: 0x5, flags: 0x0}, + 400: {region: 0x164, script: 0x52, flags: 0x0}, + 401: {region: 0x164, script: 0x27, flags: 0x0}, + 402: {region: 0xf0, script: 0x52, flags: 0x0}, + 403: {region: 0x164, script: 0x52, flags: 0x0}, + 404: {region: 0x164, script: 0x52, flags: 0x0}, + 405: {region: 0x164, script: 0x52, flags: 0x0}, + 406: {region: 0x164, script: 0x27, flags: 0x0}, + 407: {region: 0x164, script: 0x52, flags: 0x0}, + 408: {region: 0x98, script: 0x20, flags: 0x0}, + 409: {region: 0x98, script: 0xd0, flags: 0x0}, + 410: {region: 0x94, script: 0x52, flags: 0x0}, + 411: {region: 0xd8, script: 0x52, flags: 0x0}, + 412: {region: 0x12f, script: 0x2b, flags: 0x0}, + 413: {region: 0x164, script: 0x52, flags: 0x0}, + 414: {region: 0xe, script: 0x2, flags: 0x1}, + 415: {region: 0x98, script: 0xe, flags: 0x0}, + 416: {region: 0x164, script: 0x52, flags: 0x0}, + 417: {region: 0x4d, script: 0x52, flags: 0x0}, + 418: {region: 0x98, script: 0x2e, flags: 0x0}, + 419: {region: 0x40, script: 0x52, flags: 0x0}, + 420: {region: 0x53, script: 0x52, flags: 0x0}, + 421: {region: 0x164, script: 0x52, flags: 0x0}, + 422: {region: 0x7f, script: 0x52, flags: 0x0}, + 423: {region: 0x164, script: 0x52, flags: 0x0}, + 424: {region: 0x164, script: 0x52, flags: 0x0}, + 425: {region: 0xa3, script: 0x52, flags: 0x0}, + 426: {region: 0x97, script: 0x52, flags: 0x0}, + 427: {region: 0x164, script: 0x52, flags: 0x0}, + 428: {region: 0xda, script: 0x20, flags: 0x0}, + 429: {region: 0x164, script: 0x52, flags: 0x0}, + 430: {region: 0x164, script: 0x5, flags: 0x0}, + 431: {region: 0x48, script: 0x52, flags: 0x0}, + 432: {region: 0x164, script: 0x5, flags: 0x0}, + 433: {region: 0x164, script: 0x52, flags: 0x0}, + 434: {region: 0x10, script: 0x3, flags: 0x1}, + 435: {region: 0x164, script: 0x52, flags: 0x0}, + 436: {region: 0x52, script: 0x34, flags: 0x0}, + 437: {region: 0x164, script: 0x52, flags: 0x0}, + 438: {region: 0x134, script: 0x52, flags: 0x0}, + 439: {region: 0x23, script: 0x5, flags: 0x0}, + 440: {region: 0x164, script: 0x52, flags: 0x0}, + 441: {region: 0x164, script: 0x27, flags: 0x0}, + 442: {region: 0x96, script: 0x37, flags: 0x0}, + 443: {region: 0x164, script: 0x52, flags: 0x0}, + 444: {region: 0x98, script: 0x20, flags: 0x0}, + 445: {region: 0x164, script: 0x52, flags: 0x0}, + 446: {region: 0x72, script: 0x52, flags: 0x0}, + 447: {region: 0x164, script: 0x52, flags: 0x0}, + 448: {region: 0x164, script: 0x52, flags: 0x0}, + 449: {region: 0xe6, script: 0x52, flags: 0x0}, + 450: {region: 0x164, script: 0x52, flags: 0x0}, + 451: {region: 0x12a, script: 0x39, flags: 0x0}, + 452: {region: 0x52, script: 0x81, flags: 0x0}, + 453: {region: 0x164, script: 0x52, flags: 0x0}, + 454: {region: 0xe7, script: 0x5, flags: 0x0}, + 455: {region: 0x98, script: 0x20, flags: 0x0}, + 456: {region: 0xae, script: 0x3a, flags: 0x0}, + 457: {region: 0xe6, script: 0x52, flags: 0x0}, + 458: {region: 0xe7, script: 0x5, flags: 0x0}, + 459: {region: 0xe5, script: 0x52, flags: 0x0}, + 460: {region: 0x98, script: 0x20, flags: 0x0}, + 461: {region: 0x98, script: 0x20, flags: 0x0}, + 462: {region: 0x164, script: 0x52, flags: 0x0}, + 463: {region: 0x8f, script: 0x52, flags: 0x0}, + 464: {region: 0x5f, script: 0x52, flags: 0x0}, + 465: {region: 0x52, script: 0x34, flags: 0x0}, + 466: {region: 0x90, script: 0x52, flags: 0x0}, + 467: {region: 0x91, script: 0x52, flags: 0x0}, + 468: {region: 0x164, script: 0x52, flags: 0x0}, + 469: {region: 0x27, script: 0x8, flags: 0x0}, + 470: {region: 0xd1, script: 0x52, flags: 0x0}, + 471: {region: 0x77, script: 0x52, flags: 0x0}, + 472: {region: 0x164, script: 0x52, flags: 0x0}, + 473: {region: 0x164, script: 0x52, flags: 0x0}, + 474: {region: 0xcf, script: 0x52, flags: 0x0}, + 475: {region: 0xd5, script: 0x52, flags: 0x0}, + 476: {region: 0x164, script: 0x52, flags: 0x0}, + 477: {region: 0x164, script: 0x52, flags: 0x0}, + 478: {region: 0x164, script: 0x52, flags: 0x0}, + 479: {region: 0x94, script: 0x52, flags: 0x0}, + 480: {region: 0x164, script: 0x52, flags: 0x0}, + 481: {region: 0x164, script: 0x52, flags: 0x0}, + 482: {region: 0x164, script: 0x52, flags: 0x0}, + 484: {region: 0x121, script: 0x52, flags: 0x0}, + 485: {region: 0xd5, script: 0x52, flags: 0x0}, + 486: {region: 0x164, script: 0x52, flags: 0x0}, + 487: {region: 0x164, script: 0x52, flags: 0x0}, + 488: {region: 0x52, script: 0xdf, flags: 0x0}, + 489: {region: 0x164, script: 0x52, flags: 0x0}, + 490: {region: 0x134, script: 0x52, flags: 0x0}, + 491: {region: 0x164, script: 0x52, flags: 0x0}, + 492: {region: 0x48, script: 0x52, flags: 0x0}, + 493: {region: 0x164, script: 0x52, flags: 0x0}, + 494: {region: 0x164, script: 0x52, flags: 0x0}, + 495: {region: 0xe6, script: 0x52, flags: 0x0}, + 496: {region: 0x164, script: 0x52, flags: 0x0}, + 497: {region: 0x94, script: 0x52, flags: 0x0}, + 498: {region: 0x105, script: 0x1e, flags: 0x0}, + 500: {region: 0x164, script: 0x52, flags: 0x0}, + 501: {region: 0x164, script: 0x52, flags: 0x0}, + 502: {region: 0x9c, script: 0x52, flags: 0x0}, + 503: {region: 0x9d, script: 0x52, flags: 0x0}, + 504: {region: 0x48, script: 0x17, flags: 0x0}, + 505: {region: 0x96, script: 0x37, flags: 0x0}, + 506: {region: 0x164, script: 0x52, flags: 0x0}, + 507: {region: 0x164, script: 0x52, flags: 0x0}, + 508: {region: 0x105, script: 0x52, flags: 0x0}, + 509: {region: 0x164, script: 0x52, flags: 0x0}, + 510: {region: 0xa1, script: 0x41, flags: 0x0}, + 511: {region: 0x164, script: 0x52, flags: 0x0}, + 512: {region: 0x9f, script: 0x52, flags: 0x0}, + 514: {region: 0x164, script: 0x52, flags: 0x0}, + 515: {region: 0x164, script: 0x52, flags: 0x0}, + 516: {region: 0x164, script: 0x52, flags: 0x0}, + 517: {region: 0x51, script: 0x52, flags: 0x0}, + 518: {region: 0x12f, script: 0x37, flags: 0x0}, + 519: {region: 0x164, script: 0x52, flags: 0x0}, + 520: {region: 0x12e, script: 0x52, flags: 0x0}, + 521: {region: 0xda, script: 0x20, flags: 0x0}, + 522: {region: 0x164, script: 0x52, flags: 0x0}, + 523: {region: 0x62, script: 0x52, flags: 0x0}, + 524: {region: 0x94, script: 0x52, flags: 0x0}, + 525: {region: 0x94, script: 0x52, flags: 0x0}, + 526: {region: 0x7c, script: 0x29, flags: 0x0}, + 527: {region: 0x136, script: 0x1e, flags: 0x0}, + 528: {region: 0x66, script: 0x52, flags: 0x0}, + 529: {region: 0xc3, script: 0x52, flags: 0x0}, + 530: {region: 0x164, script: 0x52, flags: 0x0}, + 531: {region: 0x164, script: 0x52, flags: 0x0}, + 532: {region: 0xd5, script: 0x52, flags: 0x0}, + 533: {region: 0xa3, script: 0x52, flags: 0x0}, + 534: {region: 0xc2, script: 0x52, flags: 0x0}, + 535: {region: 0x105, script: 0x1e, flags: 0x0}, + 536: {region: 0x164, script: 0x52, flags: 0x0}, + 537: {region: 0x164, script: 0x52, flags: 0x0}, + 538: {region: 0x164, script: 0x52, flags: 0x0}, + 539: {region: 0x164, script: 0x52, flags: 0x0}, + 540: {region: 0xd3, script: 0x5, flags: 0x0}, + 541: {region: 0xd5, script: 0x52, flags: 0x0}, + 542: {region: 0x163, script: 0x52, flags: 0x0}, + 543: {region: 0x164, script: 0x52, flags: 0x0}, + 544: {region: 0x164, script: 0x52, flags: 0x0}, + 545: {region: 0x12e, script: 0x52, flags: 0x0}, + 546: {region: 0x121, script: 0x5, flags: 0x0}, + 547: {region: 0x164, script: 0x52, flags: 0x0}, + 548: {region: 0x122, script: 0xd5, flags: 0x0}, + 549: {region: 0x59, script: 0x52, flags: 0x0}, + 550: {region: 0x51, script: 0x52, flags: 0x0}, + 551: {region: 0x164, script: 0x52, flags: 0x0}, + 552: {region: 0x4e, script: 0x52, flags: 0x0}, + 553: {region: 0x98, script: 0x20, flags: 0x0}, + 554: {region: 0x98, script: 0x20, flags: 0x0}, + 555: {region: 0x4a, script: 0x52, flags: 0x0}, + 556: {region: 0x94, script: 0x52, flags: 0x0}, + 557: {region: 0x164, script: 0x52, flags: 0x0}, + 558: {region: 0x40, script: 0x52, flags: 0x0}, + 559: {region: 0x98, script: 0x52, flags: 0x0}, + 560: {region: 0x52, script: 0xcc, flags: 0x0}, + 561: {region: 0x98, script: 0x20, flags: 0x0}, + 562: {region: 0xc2, script: 0x52, flags: 0x0}, + 563: {region: 0x164, script: 0x52, flags: 0x0}, + 564: {region: 0x98, script: 0x6b, flags: 0x0}, + 565: {region: 0xe7, script: 0x5, flags: 0x0}, + 566: {region: 0x164, script: 0x52, flags: 0x0}, + 567: {region: 0xa3, script: 0x52, flags: 0x0}, + 568: {region: 0x164, script: 0x52, flags: 0x0}, + 569: {region: 0x12a, script: 0x52, flags: 0x0}, + 570: {region: 0x164, script: 0x52, flags: 0x0}, + 571: {region: 0xd1, script: 0x52, flags: 0x0}, + 572: {region: 0x164, script: 0x52, flags: 0x0}, + 573: {region: 0xae, script: 0x4f, flags: 0x0}, + 574: {region: 0x164, script: 0x52, flags: 0x0}, + 575: {region: 0x164, script: 0x52, flags: 0x0}, + 576: {region: 0x13, script: 0x6, flags: 0x1}, + 577: {region: 0x164, script: 0x52, flags: 0x0}, + 578: {region: 0x51, script: 0x52, flags: 0x0}, + 579: {region: 0x81, script: 0x52, flags: 0x0}, + 580: {region: 0xa3, script: 0x52, flags: 0x0}, + 581: {region: 0x164, script: 0x52, flags: 0x0}, + 582: {region: 0x164, script: 0x52, flags: 0x0}, + 583: {region: 0x164, script: 0x52, flags: 0x0}, + 584: {region: 0xa5, script: 0x46, flags: 0x0}, + 585: {region: 0x29, script: 0x52, flags: 0x0}, + 586: {region: 0x164, script: 0x52, flags: 0x0}, + 587: {region: 0x164, script: 0x52, flags: 0x0}, + 588: {region: 0x164, script: 0x52, flags: 0x0}, + 589: {region: 0x164, script: 0x52, flags: 0x0}, + 590: {region: 0x164, script: 0x52, flags: 0x0}, + 591: {region: 0x98, script: 0x4a, flags: 0x0}, + 592: {region: 0x113, script: 0x52, flags: 0x0}, + 593: {region: 0x164, script: 0x52, flags: 0x0}, + 594: {region: 0xaa, script: 0x4b, flags: 0x0}, + 595: {region: 0x105, script: 0x1e, flags: 0x0}, + 596: {region: 0x98, script: 0x20, flags: 0x0}, + 597: {region: 0x164, script: 0x52, flags: 0x0}, + 598: {region: 0x74, script: 0x52, flags: 0x0}, + 599: {region: 0x164, script: 0x52, flags: 0x0}, + 600: {region: 0xb3, script: 0x52, flags: 0x0}, + 601: {region: 0x164, script: 0x52, flags: 0x0}, + 602: {region: 0x164, script: 0x52, flags: 0x0}, + 603: {region: 0x164, script: 0x52, flags: 0x0}, + 604: {region: 0x164, script: 0x52, flags: 0x0}, + 605: {region: 0x164, script: 0x52, flags: 0x0}, + 606: {region: 0x164, script: 0x52, flags: 0x0}, + 607: {region: 0x164, script: 0x52, flags: 0x0}, + 608: {region: 0x164, script: 0x27, flags: 0x0}, + 610: {region: 0x105, script: 0x1e, flags: 0x0}, + 611: {region: 0x111, script: 0x52, flags: 0x0}, + 612: {region: 0xe6, script: 0x52, flags: 0x0}, + 613: {region: 0x105, script: 0x52, flags: 0x0}, + 614: {region: 0x164, script: 0x52, flags: 0x0}, + 615: {region: 0x98, script: 0x20, flags: 0x0}, + 616: {region: 0x98, script: 0x5, flags: 0x0}, + 617: {region: 0x12e, script: 0x52, flags: 0x0}, + 618: {region: 0x164, script: 0x52, flags: 0x0}, + 619: {region: 0x51, script: 0x52, flags: 0x0}, + 620: {region: 0x5f, script: 0x52, flags: 0x0}, + 621: {region: 0x164, script: 0x52, flags: 0x0}, + 622: {region: 0x164, script: 0x52, flags: 0x0}, + 623: {region: 0x164, script: 0x27, flags: 0x0}, + 624: {region: 0x164, script: 0x52, flags: 0x0}, + 625: {region: 0x164, script: 0x52, flags: 0x0}, + 626: {region: 0x19, script: 0x3, flags: 0x1}, + 627: {region: 0x164, script: 0x52, flags: 0x0}, + 628: {region: 0x164, script: 0x52, flags: 0x0}, + 629: {region: 0x164, script: 0x52, flags: 0x0}, + 630: {region: 0x164, script: 0x52, flags: 0x0}, + 631: {region: 0x105, script: 0x1e, flags: 0x0}, + 632: {region: 0x164, script: 0x52, flags: 0x0}, + 633: {region: 0x164, script: 0x52, flags: 0x0}, + 634: {region: 0x164, script: 0x52, flags: 0x0}, + 635: {region: 0x105, script: 0x1e, flags: 0x0}, + 636: {region: 0x164, script: 0x52, flags: 0x0}, + 637: {region: 0x94, script: 0x52, flags: 0x0}, + 638: {region: 0xe7, script: 0x5, flags: 0x0}, + 639: {region: 0x7a, script: 0x52, flags: 0x0}, + 640: {region: 0x164, script: 0x52, flags: 0x0}, + 641: {region: 0x164, script: 0x52, flags: 0x0}, + 642: {region: 0x164, script: 0x52, flags: 0x0}, + 643: {region: 0x164, script: 0x27, flags: 0x0}, + 644: {region: 0x122, script: 0xd5, flags: 0x0}, + 645: {region: 0xe7, script: 0x5, flags: 0x0}, + 646: {region: 0x164, script: 0x52, flags: 0x0}, + 647: {region: 0x164, script: 0x52, flags: 0x0}, + 648: {region: 0x1c, script: 0x5, flags: 0x1}, + 649: {region: 0x164, script: 0x52, flags: 0x0}, + 650: {region: 0x164, script: 0x52, flags: 0x0}, + 651: {region: 0x164, script: 0x52, flags: 0x0}, + 652: {region: 0x137, script: 0x52, flags: 0x0}, + 653: {region: 0x86, script: 0x56, flags: 0x0}, + 654: {region: 0x96, script: 0x37, flags: 0x0}, + 655: {region: 0x12e, script: 0x52, flags: 0x0}, + 656: {region: 0xe7, script: 0x5, flags: 0x0}, + 657: {region: 0x130, script: 0x52, flags: 0x0}, + 658: {region: 0x164, script: 0x52, flags: 0x0}, + 659: {region: 0xb6, script: 0x52, flags: 0x0}, + 660: {region: 0x105, script: 0x1e, flags: 0x0}, + 661: {region: 0x164, script: 0x52, flags: 0x0}, + 662: {region: 0x94, script: 0x52, flags: 0x0}, + 663: {region: 0x164, script: 0x52, flags: 0x0}, + 664: {region: 0x52, script: 0xd5, flags: 0x0}, + 665: {region: 0x164, script: 0x52, flags: 0x0}, + 666: {region: 0x164, script: 0x52, flags: 0x0}, + 667: {region: 0x164, script: 0x52, flags: 0x0}, + 668: {region: 0x164, script: 0x52, flags: 0x0}, + 669: {region: 0x98, script: 0x54, flags: 0x0}, + 670: {region: 0x164, script: 0x52, flags: 0x0}, + 671: {region: 0x164, script: 0x52, flags: 0x0}, + 672: {region: 0x105, script: 0x1e, flags: 0x0}, + 673: {region: 0x130, script: 0x52, flags: 0x0}, + 674: {region: 0x164, script: 0x52, flags: 0x0}, + 675: {region: 0xd8, script: 0x52, flags: 0x0}, + 676: {region: 0x164, script: 0x52, flags: 0x0}, + 677: {region: 0x164, script: 0x52, flags: 0x0}, + 678: {region: 0x21, script: 0x2, flags: 0x1}, + 679: {region: 0x164, script: 0x52, flags: 0x0}, + 680: {region: 0x164, script: 0x52, flags: 0x0}, + 681: {region: 0x9d, script: 0x52, flags: 0x0}, + 682: {region: 0x52, script: 0x58, flags: 0x0}, + 683: {region: 0x94, script: 0x52, flags: 0x0}, + 684: {region: 0x9b, script: 0x5, flags: 0x0}, + 685: {region: 0x134, script: 0x52, flags: 0x0}, + 686: {region: 0x164, script: 0x52, flags: 0x0}, + 687: {region: 0x164, script: 0x52, flags: 0x0}, + 688: {region: 0x98, script: 0xd0, flags: 0x0}, + 689: {region: 0x9d, script: 0x52, flags: 0x0}, + 690: {region: 0x164, script: 0x52, flags: 0x0}, + 691: {region: 0x4a, script: 0x52, flags: 0x0}, + 692: {region: 0x164, script: 0x52, flags: 0x0}, + 693: {region: 0x164, script: 0x52, flags: 0x0}, + 694: {region: 0xae, script: 0x4f, flags: 0x0}, + 695: {region: 0x164, script: 0x52, flags: 0x0}, + 696: {region: 0x164, script: 0x52, flags: 0x0}, + 697: {region: 0x4a, script: 0x52, flags: 0x0}, + 698: {region: 0x164, script: 0x52, flags: 0x0}, + 699: {region: 0x164, script: 0x52, flags: 0x0}, + 700: {region: 0x161, script: 0x52, flags: 0x0}, + 701: {region: 0x9b, script: 0x5, flags: 0x0}, + 702: {region: 0xb5, script: 0x52, flags: 0x0}, + 703: {region: 0xb7, script: 0x52, flags: 0x0}, + 704: {region: 0x4a, script: 0x52, flags: 0x0}, + 705: {region: 0x4a, script: 0x52, flags: 0x0}, + 706: {region: 0xa3, script: 0x52, flags: 0x0}, + 707: {region: 0xa3, script: 0x52, flags: 0x0}, + 708: {region: 0x9b, script: 0x5, flags: 0x0}, + 709: {region: 0xb7, script: 0x52, flags: 0x0}, + 710: {region: 0x122, script: 0xd5, flags: 0x0}, + 711: {region: 0x52, script: 0x34, flags: 0x0}, + 712: {region: 0x12a, script: 0x52, flags: 0x0}, + 713: {region: 0x94, script: 0x52, flags: 0x0}, + 714: {region: 0x51, script: 0x52, flags: 0x0}, + 715: {region: 0x98, script: 0x20, flags: 0x0}, + 716: {region: 0x98, script: 0x20, flags: 0x0}, + 717: {region: 0x94, script: 0x52, flags: 0x0}, + 718: {region: 0x23, script: 0x3, flags: 0x1}, + 719: {region: 0xa3, script: 0x52, flags: 0x0}, + 720: {region: 0x164, script: 0x52, flags: 0x0}, + 721: {region: 0xce, script: 0x52, flags: 0x0}, + 722: {region: 0x164, script: 0x52, flags: 0x0}, + 723: {region: 0x164, script: 0x52, flags: 0x0}, + 724: {region: 0x164, script: 0x52, flags: 0x0}, + 725: {region: 0x164, script: 0x52, flags: 0x0}, + 726: {region: 0x164, script: 0x52, flags: 0x0}, + 727: {region: 0x164, script: 0x52, flags: 0x0}, + 728: {region: 0x164, script: 0x52, flags: 0x0}, + 729: {region: 0x164, script: 0x52, flags: 0x0}, + 730: {region: 0x164, script: 0x52, flags: 0x0}, + 731: {region: 0x164, script: 0x52, flags: 0x0}, + 732: {region: 0x164, script: 0x52, flags: 0x0}, + 733: {region: 0x164, script: 0x5, flags: 0x0}, + 734: {region: 0x105, script: 0x1e, flags: 0x0}, + 735: {region: 0xe6, script: 0x52, flags: 0x0}, + 736: {region: 0x164, script: 0x52, flags: 0x0}, + 737: {region: 0x94, script: 0x52, flags: 0x0}, + 738: {region: 0x164, script: 0x27, flags: 0x0}, + 739: {region: 0x164, script: 0x52, flags: 0x0}, + 740: {region: 0x164, script: 0x52, flags: 0x0}, + 741: {region: 0x164, script: 0x52, flags: 0x0}, + 742: {region: 0x111, script: 0x52, flags: 0x0}, + 743: {region: 0xa3, script: 0x52, flags: 0x0}, + 744: {region: 0x164, script: 0x52, flags: 0x0}, + 745: {region: 0x164, script: 0x52, flags: 0x0}, + 746: {region: 0x122, script: 0x5, flags: 0x0}, + 747: {region: 0xcb, script: 0x52, flags: 0x0}, + 748: {region: 0x164, script: 0x52, flags: 0x0}, + 749: {region: 0x164, script: 0x52, flags: 0x0}, + 750: {region: 0x164, script: 0x52, flags: 0x0}, + 751: {region: 0xbe, script: 0x52, flags: 0x0}, + 752: {region: 0xd0, script: 0x52, flags: 0x0}, + 753: {region: 0x164, script: 0x52, flags: 0x0}, + 754: {region: 0x51, script: 0x52, flags: 0x0}, + 755: {region: 0xda, script: 0x20, flags: 0x0}, + 756: {region: 0x12e, script: 0x52, flags: 0x0}, + 757: {region: 0xbf, script: 0x52, flags: 0x0}, + 758: {region: 0x164, script: 0x52, flags: 0x0}, + 759: {region: 0x164, script: 0x52, flags: 0x0}, + 760: {region: 0xdf, script: 0x52, flags: 0x0}, + 761: {region: 0x164, script: 0x52, flags: 0x0}, + 762: {region: 0x94, script: 0x52, flags: 0x0}, + 763: {region: 0x9a, script: 0x36, flags: 0x0}, + 764: {region: 0x164, script: 0x52, flags: 0x0}, + 765: {region: 0xc1, script: 0x1e, flags: 0x0}, + 766: {region: 0x164, script: 0x5, flags: 0x0}, + 767: {region: 0x164, script: 0x52, flags: 0x0}, + 768: {region: 0x164, script: 0x52, flags: 0x0}, + 769: {region: 0x164, script: 0x52, flags: 0x0}, + 770: {region: 0x98, script: 0x64, flags: 0x0}, + 771: {region: 0x164, script: 0x52, flags: 0x0}, + 772: {region: 0x164, script: 0x52, flags: 0x0}, + 773: {region: 0x10a, script: 0x52, flags: 0x0}, + 774: {region: 0x164, script: 0x52, flags: 0x0}, + 775: {region: 0x164, script: 0x52, flags: 0x0}, + 776: {region: 0x164, script: 0x52, flags: 0x0}, + 777: {region: 0x26, script: 0x3, flags: 0x1}, + 778: {region: 0x164, script: 0x52, flags: 0x0}, + 779: {region: 0x164, script: 0x52, flags: 0x0}, + 780: {region: 0x98, script: 0xe, flags: 0x0}, + 781: {region: 0xc3, script: 0x6b, flags: 0x0}, + 783: {region: 0x164, script: 0x52, flags: 0x0}, + 784: {region: 0x48, script: 0x52, flags: 0x0}, + 785: {region: 0x48, script: 0x52, flags: 0x0}, + 786: {region: 0x36, script: 0x52, flags: 0x0}, + 787: {region: 0x164, script: 0x52, flags: 0x0}, + 788: {region: 0x164, script: 0x52, flags: 0x0}, + 789: {region: 0x164, script: 0x52, flags: 0x0}, + 790: {region: 0x164, script: 0x52, flags: 0x0}, + 791: {region: 0x164, script: 0x52, flags: 0x0}, + 792: {region: 0x164, script: 0x52, flags: 0x0}, + 793: {region: 0x98, script: 0x20, flags: 0x0}, + 794: {region: 0xda, script: 0x20, flags: 0x0}, + 795: {region: 0x105, script: 0x1e, flags: 0x0}, + 796: {region: 0x34, script: 0x68, flags: 0x0}, + 797: {region: 0x29, script: 0x3, flags: 0x1}, + 798: {region: 0xca, script: 0x52, flags: 0x0}, + 799: {region: 0x164, script: 0x52, flags: 0x0}, + 800: {region: 0x164, script: 0x52, flags: 0x0}, + 801: {region: 0x164, script: 0x52, flags: 0x0}, + 802: {region: 0x98, script: 0x20, flags: 0x0}, + 803: {region: 0x51, script: 0x52, flags: 0x0}, + 805: {region: 0x164, script: 0x52, flags: 0x0}, + 806: {region: 0x134, script: 0x52, flags: 0x0}, + 807: {region: 0x164, script: 0x52, flags: 0x0}, + 808: {region: 0x164, script: 0x52, flags: 0x0}, + 809: {region: 0xe7, script: 0x5, flags: 0x0}, + 810: {region: 0xc2, script: 0x52, flags: 0x0}, + 811: {region: 0x98, script: 0x20, flags: 0x0}, + 812: {region: 0x94, script: 0x52, flags: 0x0}, + 813: {region: 0x163, script: 0x52, flags: 0x0}, + 814: {region: 0x164, script: 0x52, flags: 0x0}, + 815: {region: 0xc3, script: 0x6b, flags: 0x0}, + 816: {region: 0x164, script: 0x52, flags: 0x0}, + 817: {region: 0x164, script: 0x27, flags: 0x0}, + 818: {region: 0x105, script: 0x1e, flags: 0x0}, + 819: {region: 0x164, script: 0x52, flags: 0x0}, + 820: {region: 0x130, script: 0x52, flags: 0x0}, + 821: {region: 0x9b, script: 0x5d, flags: 0x0}, + 822: {region: 0x164, script: 0x52, flags: 0x0}, + 823: {region: 0x164, script: 0x52, flags: 0x0}, + 824: {region: 0x9b, script: 0x5, flags: 0x0}, + 825: {region: 0x164, script: 0x52, flags: 0x0}, + 826: {region: 0x164, script: 0x52, flags: 0x0}, + 827: {region: 0x164, script: 0x52, flags: 0x0}, + 828: {region: 0xdc, script: 0x52, flags: 0x0}, + 829: {region: 0x164, script: 0x52, flags: 0x0}, + 830: {region: 0x164, script: 0x52, flags: 0x0}, + 832: {region: 0x164, script: 0x52, flags: 0x0}, + 833: {region: 0x52, script: 0x34, flags: 0x0}, + 834: {region: 0x9d, script: 0x52, flags: 0x0}, + 835: {region: 0xd1, script: 0x52, flags: 0x0}, + 836: {region: 0x164, script: 0x52, flags: 0x0}, + 837: {region: 0xd9, script: 0x52, flags: 0x0}, + 838: {region: 0x164, script: 0x52, flags: 0x0}, + 839: {region: 0x164, script: 0x52, flags: 0x0}, + 840: {region: 0x164, script: 0x52, flags: 0x0}, + 841: {region: 0xce, script: 0x52, flags: 0x0}, + 842: {region: 0x164, script: 0x52, flags: 0x0}, + 843: {region: 0x164, script: 0x52, flags: 0x0}, + 844: {region: 0x163, script: 0x52, flags: 0x0}, + 845: {region: 0xd0, script: 0x52, flags: 0x0}, + 846: {region: 0x5f, script: 0x52, flags: 0x0}, + 847: {region: 0xda, script: 0x20, flags: 0x0}, + 848: {region: 0x164, script: 0x52, flags: 0x0}, + 849: {region: 0xda, script: 0x20, flags: 0x0}, + 850: {region: 0x164, script: 0x52, flags: 0x0}, + 851: {region: 0x164, script: 0x52, flags: 0x0}, + 852: {region: 0xd1, script: 0x52, flags: 0x0}, + 853: {region: 0x164, script: 0x52, flags: 0x0}, + 854: {region: 0x164, script: 0x52, flags: 0x0}, + 855: {region: 0xd0, script: 0x52, flags: 0x0}, + 856: {region: 0x164, script: 0x52, flags: 0x0}, + 857: {region: 0xce, script: 0x52, flags: 0x0}, + 858: {region: 0xce, script: 0x52, flags: 0x0}, + 859: {region: 0x164, script: 0x52, flags: 0x0}, + 860: {region: 0x164, script: 0x52, flags: 0x0}, + 861: {region: 0x94, script: 0x52, flags: 0x0}, + 862: {region: 0x164, script: 0x52, flags: 0x0}, + 863: {region: 0xde, script: 0x52, flags: 0x0}, + 864: {region: 0x164, script: 0x52, flags: 0x0}, + 865: {region: 0x164, script: 0x52, flags: 0x0}, + 866: {region: 0x98, script: 0x52, flags: 0x0}, + 867: {region: 0x164, script: 0x52, flags: 0x0}, + 868: {region: 0x164, script: 0x52, flags: 0x0}, + 869: {region: 0xd8, script: 0x52, flags: 0x0}, + 870: {region: 0x51, script: 0x52, flags: 0x0}, + 871: {region: 0x164, script: 0x52, flags: 0x0}, + 872: {region: 0xd9, script: 0x52, flags: 0x0}, + 873: {region: 0x164, script: 0x52, flags: 0x0}, + 874: {region: 0x51, script: 0x52, flags: 0x0}, + 875: {region: 0x164, script: 0x52, flags: 0x0}, + 876: {region: 0x164, script: 0x52, flags: 0x0}, + 877: {region: 0xd9, script: 0x52, flags: 0x0}, + 878: {region: 0x122, script: 0x4e, flags: 0x0}, + 879: {region: 0x98, script: 0x20, flags: 0x0}, + 880: {region: 0x10b, script: 0xb7, flags: 0x0}, + 881: {region: 0x164, script: 0x52, flags: 0x0}, + 882: {region: 0x164, script: 0x52, flags: 0x0}, + 883: {region: 0x83, script: 0x70, flags: 0x0}, + 884: {region: 0x160, script: 0x52, flags: 0x0}, + 885: {region: 0x164, script: 0x52, flags: 0x0}, + 886: {region: 0x48, script: 0x17, flags: 0x0}, + 887: {region: 0x164, script: 0x52, flags: 0x0}, + 888: {region: 0x160, script: 0x52, flags: 0x0}, + 889: {region: 0x164, script: 0x52, flags: 0x0}, + 890: {region: 0x164, script: 0x52, flags: 0x0}, + 891: {region: 0x164, script: 0x52, flags: 0x0}, + 892: {region: 0x164, script: 0x52, flags: 0x0}, + 893: {region: 0x164, script: 0x52, flags: 0x0}, + 894: {region: 0x116, script: 0x52, flags: 0x0}, + 895: {region: 0x164, script: 0x52, flags: 0x0}, + 896: {region: 0x164, script: 0x52, flags: 0x0}, + 897: {region: 0x134, script: 0x52, flags: 0x0}, + 898: {region: 0x164, script: 0x52, flags: 0x0}, + 899: {region: 0x52, script: 0x52, flags: 0x0}, + 900: {region: 0x164, script: 0x52, flags: 0x0}, + 901: {region: 0xcd, script: 0x52, flags: 0x0}, + 902: {region: 0x12e, script: 0x52, flags: 0x0}, + 903: {region: 0x130, script: 0x52, flags: 0x0}, + 904: {region: 0x7f, script: 0x52, flags: 0x0}, + 905: {region: 0x77, script: 0x52, flags: 0x0}, + 906: {region: 0x164, script: 0x52, flags: 0x0}, + 908: {region: 0x164, script: 0x52, flags: 0x0}, + 909: {region: 0x164, script: 0x52, flags: 0x0}, + 910: {region: 0x6e, script: 0x52, flags: 0x0}, + 911: {region: 0x164, script: 0x52, flags: 0x0}, + 912: {region: 0x164, script: 0x52, flags: 0x0}, + 913: {region: 0x164, script: 0x52, flags: 0x0}, + 914: {region: 0x164, script: 0x52, flags: 0x0}, + 915: {region: 0x98, script: 0x75, flags: 0x0}, + 916: {region: 0x164, script: 0x52, flags: 0x0}, + 917: {region: 0x164, script: 0x5, flags: 0x0}, + 918: {region: 0x7c, script: 0x1e, flags: 0x0}, + 919: {region: 0x134, script: 0x76, flags: 0x0}, + 920: {region: 0x164, script: 0x5, flags: 0x0}, + 921: {region: 0xc4, script: 0x74, flags: 0x0}, + 922: {region: 0x164, script: 0x52, flags: 0x0}, + 923: {region: 0x2c, script: 0x3, flags: 0x1}, + 924: {region: 0xe6, script: 0x52, flags: 0x0}, + 925: {region: 0x2f, script: 0x2, flags: 0x1}, + 926: {region: 0xe6, script: 0x52, flags: 0x0}, + 927: {region: 0x2f, script: 0x52, flags: 0x0}, + 928: {region: 0xef, script: 0x52, flags: 0x0}, + 929: {region: 0x164, script: 0x52, flags: 0x0}, + 930: {region: 0x77, script: 0x52, flags: 0x0}, + 931: {region: 0xd5, script: 0x52, flags: 0x0}, + 932: {region: 0x134, script: 0x52, flags: 0x0}, + 933: {region: 0x48, script: 0x52, flags: 0x0}, + 934: {region: 0x164, script: 0x52, flags: 0x0}, + 935: {region: 0x9b, script: 0xdd, flags: 0x0}, + 936: {region: 0x164, script: 0x52, flags: 0x0}, + 937: {region: 0x5f, script: 0x52, flags: 0x0}, + 938: {region: 0x164, script: 0x5, flags: 0x0}, + 939: {region: 0xaf, script: 0x7f, flags: 0x0}, + 941: {region: 0x164, script: 0x52, flags: 0x0}, + 942: {region: 0x164, script: 0x52, flags: 0x0}, + 943: {region: 0x98, script: 0x12, flags: 0x0}, + 944: {region: 0xa3, script: 0x52, flags: 0x0}, + 945: {region: 0xe8, script: 0x52, flags: 0x0}, + 946: {region: 0x164, script: 0x52, flags: 0x0}, + 947: {region: 0x9d, script: 0x52, flags: 0x0}, + 948: {region: 0x164, script: 0x52, flags: 0x0}, + 949: {region: 0x164, script: 0x52, flags: 0x0}, + 950: {region: 0x86, script: 0x2d, flags: 0x0}, + 951: {region: 0x74, script: 0x52, flags: 0x0}, + 952: {region: 0x164, script: 0x52, flags: 0x0}, + 953: {region: 0xe7, script: 0x45, flags: 0x0}, + 954: {region: 0x9b, script: 0x5, flags: 0x0}, + 955: {region: 0x1, script: 0x52, flags: 0x0}, + 956: {region: 0x23, script: 0x5, flags: 0x0}, + 957: {region: 0x164, script: 0x52, flags: 0x0}, + 958: {region: 0x40, script: 0x52, flags: 0x0}, + 959: {region: 0x164, script: 0x52, flags: 0x0}, + 960: {region: 0x79, script: 0x52, flags: 0x0}, + 961: {region: 0x164, script: 0x52, flags: 0x0}, + 962: {region: 0xe3, script: 0x52, flags: 0x0}, + 963: {region: 0x88, script: 0x52, flags: 0x0}, + 964: {region: 0x68, script: 0x52, flags: 0x0}, + 965: {region: 0x164, script: 0x52, flags: 0x0}, + 966: {region: 0x98, script: 0x20, flags: 0x0}, + 967: {region: 0x164, script: 0x52, flags: 0x0}, + 968: {region: 0x101, script: 0x52, flags: 0x0}, + 969: {region: 0x94, script: 0x52, flags: 0x0}, + 970: {region: 0x164, script: 0x52, flags: 0x0}, + 971: {region: 0x164, script: 0x52, flags: 0x0}, + 972: {region: 0x9d, script: 0x52, flags: 0x0}, + 973: {region: 0x164, script: 0x5, flags: 0x0}, + 974: {region: 0x98, script: 0x52, flags: 0x0}, + 975: {region: 0x31, script: 0x2, flags: 0x1}, + 976: {region: 0xda, script: 0x20, flags: 0x0}, + 977: {region: 0x34, script: 0xe, flags: 0x0}, + 978: {region: 0x4d, script: 0x52, flags: 0x0}, + 979: {region: 0x71, script: 0x52, flags: 0x0}, + 980: {region: 0x4d, script: 0x52, flags: 0x0}, + 981: {region: 0x9b, script: 0x5, flags: 0x0}, + 982: {region: 0x10b, script: 0x52, flags: 0x0}, + 983: {region: 0x39, script: 0x52, flags: 0x0}, + 984: {region: 0x164, script: 0x52, flags: 0x0}, + 985: {region: 0xd0, script: 0x52, flags: 0x0}, + 986: {region: 0x103, script: 0x52, flags: 0x0}, + 987: {region: 0x94, script: 0x52, flags: 0x0}, + 988: {region: 0x12e, script: 0x52, flags: 0x0}, + 989: {region: 0x164, script: 0x52, flags: 0x0}, + 990: {region: 0x164, script: 0x52, flags: 0x0}, + 991: {region: 0x72, script: 0x52, flags: 0x0}, + 992: {region: 0x105, script: 0x1e, flags: 0x0}, + 993: {region: 0x12f, script: 0x1e, flags: 0x0}, + 994: {region: 0x108, script: 0x52, flags: 0x0}, + 995: {region: 0x106, script: 0x52, flags: 0x0}, + 996: {region: 0x12e, script: 0x52, flags: 0x0}, + 997: {region: 0x164, script: 0x52, flags: 0x0}, + 998: {region: 0xa1, script: 0x44, flags: 0x0}, + 999: {region: 0x98, script: 0x20, flags: 0x0}, + 1000: {region: 0x7f, script: 0x52, flags: 0x0}, + 1001: {region: 0x105, script: 0x1e, flags: 0x0}, + 1002: {region: 0xa3, script: 0x52, flags: 0x0}, + 1003: {region: 0x94, script: 0x52, flags: 0x0}, + 1004: {region: 0x98, script: 0x52, flags: 0x0}, + 1005: {region: 0x113, script: 0x52, flags: 0x0}, + 1006: {region: 0x98, script: 0xbb, flags: 0x0}, + 1007: {region: 0x164, script: 0x52, flags: 0x0}, + 1008: {region: 0x164, script: 0x52, flags: 0x0}, + 1009: {region: 0x12e, script: 0x52, flags: 0x0}, + 1010: {region: 0x9d, script: 0x52, flags: 0x0}, + 1011: {region: 0x98, script: 0x20, flags: 0x0}, + 1012: {region: 0x164, script: 0x5, flags: 0x0}, + 1013: {region: 0x9d, script: 0x52, flags: 0x0}, + 1014: {region: 0x7a, script: 0x52, flags: 0x0}, + 1015: {region: 0x48, script: 0x52, flags: 0x0}, + 1016: {region: 0x33, script: 0x4, flags: 0x1}, + 1017: {region: 0x9d, script: 0x52, flags: 0x0}, + 1018: {region: 0x9b, script: 0x5, flags: 0x0}, + 1019: {region: 0xd9, script: 0x52, flags: 0x0}, + 1020: {region: 0x4e, script: 0x52, flags: 0x0}, + 1021: {region: 0xd0, script: 0x52, flags: 0x0}, + 1022: {region: 0xce, script: 0x52, flags: 0x0}, + 1023: {region: 0xc2, script: 0x52, flags: 0x0}, + 1024: {region: 0x4b, script: 0x52, flags: 0x0}, + 1025: {region: 0x95, script: 0x72, flags: 0x0}, + 1026: {region: 0xb5, script: 0x52, flags: 0x0}, + 1027: {region: 0x164, script: 0x27, flags: 0x0}, + 1028: {region: 0x164, script: 0x52, flags: 0x0}, + 1030: {region: 0xb9, script: 0xd2, flags: 0x0}, + 1031: {region: 0x164, script: 0x52, flags: 0x0}, + 1032: {region: 0xc3, script: 0x6b, flags: 0x0}, + 1033: {region: 0x164, script: 0x5, flags: 0x0}, + 1034: {region: 0xb2, script: 0xc1, flags: 0x0}, + 1035: {region: 0x6e, script: 0x52, flags: 0x0}, + 1036: {region: 0x164, script: 0x52, flags: 0x0}, + 1037: {region: 0x164, script: 0x52, flags: 0x0}, + 1038: {region: 0x164, script: 0x52, flags: 0x0}, + 1039: {region: 0x164, script: 0x52, flags: 0x0}, + 1040: {region: 0x110, script: 0x52, flags: 0x0}, + 1041: {region: 0x164, script: 0x52, flags: 0x0}, + 1042: {region: 0xe7, script: 0x5, flags: 0x0}, + 1043: {region: 0x164, script: 0x52, flags: 0x0}, + 1044: {region: 0x10e, script: 0x52, flags: 0x0}, + 1045: {region: 0x164, script: 0x52, flags: 0x0}, + 1046: {region: 0xe8, script: 0x52, flags: 0x0}, + 1047: {region: 0x164, script: 0x52, flags: 0x0}, + 1048: {region: 0x94, script: 0x52, flags: 0x0}, + 1049: {region: 0x141, script: 0x52, flags: 0x0}, + 1050: {region: 0x10b, script: 0x52, flags: 0x0}, + 1052: {region: 0x10b, script: 0x52, flags: 0x0}, + 1053: {region: 0x71, script: 0x52, flags: 0x0}, + 1054: {region: 0x96, script: 0xb8, flags: 0x0}, + 1055: {region: 0x164, script: 0x52, flags: 0x0}, + 1056: {region: 0x71, script: 0x52, flags: 0x0}, + 1057: {region: 0x163, script: 0x52, flags: 0x0}, + 1058: {region: 0x164, script: 0x52, flags: 0x0}, + 1059: {region: 0xc2, script: 0x52, flags: 0x0}, + 1060: {region: 0x164, script: 0x52, flags: 0x0}, + 1061: {region: 0x164, script: 0x52, flags: 0x0}, + 1062: {region: 0x164, script: 0x52, flags: 0x0}, + 1063: {region: 0x114, script: 0x52, flags: 0x0}, + 1064: {region: 0x164, script: 0x52, flags: 0x0}, + 1065: {region: 0x164, script: 0x52, flags: 0x0}, + 1066: {region: 0x122, script: 0xd5, flags: 0x0}, + 1067: {region: 0x164, script: 0x52, flags: 0x0}, + 1068: {region: 0x164, script: 0x52, flags: 0x0}, + 1069: {region: 0x164, script: 0x52, flags: 0x0}, + 1070: {region: 0x164, script: 0x52, flags: 0x0}, + 1071: {region: 0x26, script: 0x52, flags: 0x0}, + 1072: {region: 0x37, script: 0x5, flags: 0x1}, + 1073: {region: 0x98, script: 0xc2, flags: 0x0}, + 1074: {region: 0x115, script: 0x52, flags: 0x0}, + 1075: {region: 0x113, script: 0x52, flags: 0x0}, + 1076: {region: 0x98, script: 0x20, flags: 0x0}, + 1077: {region: 0x160, script: 0x52, flags: 0x0}, + 1078: {region: 0x164, script: 0x52, flags: 0x0}, + 1079: {region: 0x164, script: 0x52, flags: 0x0}, + 1080: {region: 0x6c, script: 0x52, flags: 0x0}, + 1081: {region: 0x160, script: 0x52, flags: 0x0}, + 1082: {region: 0x164, script: 0x52, flags: 0x0}, + 1083: {region: 0x5f, script: 0x52, flags: 0x0}, + 1084: {region: 0x94, script: 0x52, flags: 0x0}, + 1085: {region: 0x164, script: 0x52, flags: 0x0}, + 1086: {region: 0x164, script: 0x52, flags: 0x0}, + 1087: {region: 0x12e, script: 0x52, flags: 0x0}, + 1088: {region: 0x164, script: 0x52, flags: 0x0}, + 1089: {region: 0x83, script: 0x52, flags: 0x0}, + 1090: {region: 0x10b, script: 0x52, flags: 0x0}, + 1091: {region: 0x12e, script: 0x52, flags: 0x0}, + 1092: {region: 0x15e, script: 0x5, flags: 0x0}, + 1093: {region: 0x4a, script: 0x52, flags: 0x0}, + 1094: {region: 0x5f, script: 0x52, flags: 0x0}, + 1095: {region: 0x164, script: 0x52, flags: 0x0}, + 1096: {region: 0x98, script: 0x20, flags: 0x0}, + 1097: {region: 0x94, script: 0x52, flags: 0x0}, + 1098: {region: 0x164, script: 0x52, flags: 0x0}, + 1099: {region: 0x34, script: 0xe, flags: 0x0}, + 1100: {region: 0x9a, script: 0xc5, flags: 0x0}, + 1101: {region: 0xe8, script: 0x52, flags: 0x0}, + 1102: {region: 0x98, script: 0xcd, flags: 0x0}, + 1103: {region: 0xda, script: 0x20, flags: 0x0}, + 1104: {region: 0x164, script: 0x52, flags: 0x0}, + 1105: {region: 0x164, script: 0x52, flags: 0x0}, + 1106: {region: 0x164, script: 0x52, flags: 0x0}, + 1107: {region: 0x164, script: 0x52, flags: 0x0}, + 1108: {region: 0x164, script: 0x52, flags: 0x0}, + 1109: {region: 0x164, script: 0x52, flags: 0x0}, + 1110: {region: 0x164, script: 0x52, flags: 0x0}, + 1111: {region: 0x164, script: 0x52, flags: 0x0}, + 1112: {region: 0xe6, script: 0x52, flags: 0x0}, + 1113: {region: 0x164, script: 0x52, flags: 0x0}, + 1114: {region: 0x164, script: 0x52, flags: 0x0}, + 1115: {region: 0x98, script: 0x4a, flags: 0x0}, + 1116: {region: 0x52, script: 0xcb, flags: 0x0}, + 1117: {region: 0xda, script: 0x20, flags: 0x0}, + 1118: {region: 0xda, script: 0x20, flags: 0x0}, + 1119: {region: 0x98, script: 0xd0, flags: 0x0}, + 1120: {region: 0x164, script: 0x52, flags: 0x0}, + 1121: {region: 0x111, script: 0x52, flags: 0x0}, + 1122: {region: 0x130, script: 0x52, flags: 0x0}, + 1123: {region: 0x125, script: 0x52, flags: 0x0}, + 1124: {region: 0x164, script: 0x52, flags: 0x0}, + 1125: {region: 0x3c, script: 0x3, flags: 0x1}, + 1126: {region: 0x164, script: 0x52, flags: 0x0}, + 1127: {region: 0x164, script: 0x52, flags: 0x0}, + 1128: {region: 0x164, script: 0x52, flags: 0x0}, + 1129: {region: 0x122, script: 0xd5, flags: 0x0}, + 1130: {region: 0xda, script: 0x20, flags: 0x0}, + 1131: {region: 0xda, script: 0x20, flags: 0x0}, + 1132: {region: 0xda, script: 0x20, flags: 0x0}, + 1133: {region: 0x6e, script: 0x27, flags: 0x0}, + 1134: {region: 0x164, script: 0x52, flags: 0x0}, + 1135: {region: 0x6c, script: 0x27, flags: 0x0}, + 1136: {region: 0x164, script: 0x52, flags: 0x0}, + 1137: {region: 0x164, script: 0x52, flags: 0x0}, + 1138: {region: 0x164, script: 0x52, flags: 0x0}, + 1139: {region: 0xd5, script: 0x52, flags: 0x0}, + 1140: {region: 0x126, script: 0x52, flags: 0x0}, + 1141: {region: 0x124, script: 0x52, flags: 0x0}, + 1142: {region: 0x31, script: 0x52, flags: 0x0}, + 1143: {region: 0xda, script: 0x20, flags: 0x0}, + 1144: {region: 0xe6, script: 0x52, flags: 0x0}, + 1145: {region: 0x164, script: 0x52, flags: 0x0}, + 1146: {region: 0x164, script: 0x52, flags: 0x0}, + 1147: {region: 0x31, script: 0x52, flags: 0x0}, + 1148: {region: 0xd3, script: 0x52, flags: 0x0}, + 1149: {region: 0x164, script: 0x52, flags: 0x0}, + 1150: {region: 0x160, script: 0x52, flags: 0x0}, + 1151: {region: 0x164, script: 0x52, flags: 0x0}, + 1152: {region: 0x128, script: 0x52, flags: 0x0}, + 1153: {region: 0x164, script: 0x52, flags: 0x0}, + 1154: {region: 0xcd, script: 0x52, flags: 0x0}, + 1155: {region: 0x164, script: 0x52, flags: 0x0}, + 1156: {region: 0xe5, script: 0x52, flags: 0x0}, + 1157: {region: 0x164, script: 0x52, flags: 0x0}, + 1158: {region: 0x164, script: 0x52, flags: 0x0}, + 1159: {region: 0x164, script: 0x52, flags: 0x0}, + 1160: {region: 0x12a, script: 0x52, flags: 0x0}, + 1161: {region: 0x12a, script: 0x52, flags: 0x0}, + 1162: {region: 0x12d, script: 0x52, flags: 0x0}, + 1163: {region: 0x164, script: 0x5, flags: 0x0}, + 1164: {region: 0x160, script: 0x52, flags: 0x0}, + 1165: {region: 0x86, script: 0x2d, flags: 0x0}, + 1166: {region: 0xda, script: 0x20, flags: 0x0}, + 1167: {region: 0xe6, script: 0x52, flags: 0x0}, + 1168: {region: 0x42, script: 0xd6, flags: 0x0}, + 1169: {region: 0x164, script: 0x52, flags: 0x0}, + 1170: {region: 0x105, script: 0x1e, flags: 0x0}, + 1171: {region: 0x164, script: 0x52, flags: 0x0}, + 1172: {region: 0x164, script: 0x52, flags: 0x0}, + 1173: {region: 0x130, script: 0x52, flags: 0x0}, + 1174: {region: 0x164, script: 0x52, flags: 0x0}, + 1175: {region: 0x122, script: 0xd5, flags: 0x0}, + 1176: {region: 0x31, script: 0x52, flags: 0x0}, + 1177: {region: 0x164, script: 0x52, flags: 0x0}, + 1178: {region: 0x164, script: 0x52, flags: 0x0}, + 1179: {region: 0xcd, script: 0x52, flags: 0x0}, + 1180: {region: 0x164, script: 0x52, flags: 0x0}, + 1181: {region: 0x164, script: 0x52, flags: 0x0}, + 1182: {region: 0x12c, script: 0x52, flags: 0x0}, + 1183: {region: 0x164, script: 0x52, flags: 0x0}, + 1185: {region: 0x164, script: 0x52, flags: 0x0}, + 1186: {region: 0xd3, script: 0x52, flags: 0x0}, + 1187: {region: 0x52, script: 0xce, flags: 0x0}, + 1188: {region: 0xe4, script: 0x52, flags: 0x0}, + 1189: {region: 0x164, script: 0x52, flags: 0x0}, + 1190: {region: 0x105, script: 0x1e, flags: 0x0}, + 1191: {region: 0xb9, script: 0x52, flags: 0x0}, + 1192: {region: 0x164, script: 0x52, flags: 0x0}, + 1193: {region: 0x105, script: 0x1e, flags: 0x0}, + 1194: {region: 0x3f, script: 0x4, flags: 0x1}, + 1195: {region: 0x11b, script: 0xd8, flags: 0x0}, + 1196: {region: 0x12f, script: 0x1e, flags: 0x0}, + 1197: {region: 0x74, script: 0x52, flags: 0x0}, + 1198: {region: 0x29, script: 0x52, flags: 0x0}, + 1200: {region: 0x43, script: 0x3, flags: 0x1}, + 1201: {region: 0x98, script: 0xe, flags: 0x0}, + 1202: {region: 0xe7, script: 0x5, flags: 0x0}, + 1203: {region: 0x164, script: 0x52, flags: 0x0}, + 1204: {region: 0x164, script: 0x52, flags: 0x0}, + 1205: {region: 0x164, script: 0x52, flags: 0x0}, + 1206: {region: 0x164, script: 0x52, flags: 0x0}, + 1207: {region: 0x164, script: 0x52, flags: 0x0}, + 1208: {region: 0x164, script: 0x52, flags: 0x0}, + 1209: {region: 0x164, script: 0x52, flags: 0x0}, + 1210: {region: 0x46, script: 0x4, flags: 0x1}, + 1211: {region: 0x164, script: 0x52, flags: 0x0}, + 1212: {region: 0xb3, script: 0xd9, flags: 0x0}, + 1213: {region: 0x164, script: 0x52, flags: 0x0}, + 1214: {region: 0x160, script: 0x52, flags: 0x0}, + 1215: {region: 0x9d, script: 0x52, flags: 0x0}, + 1216: {region: 0x105, script: 0x52, flags: 0x0}, + 1217: {region: 0x13d, script: 0x52, flags: 0x0}, + 1218: {region: 0x11a, script: 0x52, flags: 0x0}, + 1219: {region: 0x164, script: 0x52, flags: 0x0}, + 1220: {region: 0x35, script: 0x52, flags: 0x0}, + 1221: {region: 0x5f, script: 0x52, flags: 0x0}, + 1222: {region: 0xd0, script: 0x52, flags: 0x0}, + 1223: {region: 0x1, script: 0x52, flags: 0x0}, + 1224: {region: 0x105, script: 0x52, flags: 0x0}, + 1225: {region: 0x69, script: 0x52, flags: 0x0}, + 1226: {region: 0x12e, script: 0x52, flags: 0x0}, + 1227: {region: 0x164, script: 0x52, flags: 0x0}, + 1228: {region: 0x35, script: 0x52, flags: 0x0}, + 1229: {region: 0x4d, script: 0x52, flags: 0x0}, + 1230: {region: 0x164, script: 0x52, flags: 0x0}, + 1231: {region: 0x6e, script: 0x27, flags: 0x0}, + 1232: {region: 0x164, script: 0x52, flags: 0x0}, + 1233: {region: 0xe6, script: 0x52, flags: 0x0}, + 1234: {region: 0x2e, script: 0x52, flags: 0x0}, + 1235: {region: 0x98, script: 0xd0, flags: 0x0}, + 1236: {region: 0x98, script: 0x20, flags: 0x0}, + 1237: {region: 0x164, script: 0x52, flags: 0x0}, + 1238: {region: 0x164, script: 0x52, flags: 0x0}, + 1239: {region: 0x164, script: 0x52, flags: 0x0}, + 1240: {region: 0x164, script: 0x52, flags: 0x0}, + 1241: {region: 0x164, script: 0x52, flags: 0x0}, + 1242: {region: 0x164, script: 0x52, flags: 0x0}, + 1243: {region: 0x164, script: 0x52, flags: 0x0}, + 1244: {region: 0x164, script: 0x52, flags: 0x0}, + 1245: {region: 0x164, script: 0x52, flags: 0x0}, + 1246: {region: 0x13f, script: 0x52, flags: 0x0}, + 1247: {region: 0x164, script: 0x52, flags: 0x0}, + 1248: {region: 0x164, script: 0x52, flags: 0x0}, + 1249: {region: 0xa7, script: 0x5, flags: 0x0}, + 1250: {region: 0x164, script: 0x52, flags: 0x0}, + 1251: {region: 0x113, script: 0x52, flags: 0x0}, + 1252: {region: 0x164, script: 0x52, flags: 0x0}, + 1253: {region: 0x164, script: 0x52, flags: 0x0}, + 1254: {region: 0x164, script: 0x52, flags: 0x0}, + 1255: {region: 0x164, script: 0x52, flags: 0x0}, + 1256: {region: 0x98, script: 0x20, flags: 0x0}, + 1257: {region: 0x52, script: 0x34, flags: 0x0}, + 1258: {region: 0x164, script: 0x52, flags: 0x0}, + 1259: {region: 0x164, script: 0x52, flags: 0x0}, + 1260: {region: 0x40, script: 0x52, flags: 0x0}, + 1261: {region: 0x164, script: 0x52, flags: 0x0}, + 1262: {region: 0x12a, script: 0x18, flags: 0x0}, + 1263: {region: 0x164, script: 0x52, flags: 0x0}, + 1264: {region: 0x160, script: 0x52, flags: 0x0}, + 1265: {region: 0x164, script: 0x52, flags: 0x0}, + 1266: {region: 0x12a, script: 0x5a, flags: 0x0}, + 1267: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1268: {region: 0x7c, script: 0x29, flags: 0x0}, + 1269: {region: 0x52, script: 0x5e, flags: 0x0}, + 1270: {region: 0x10a, script: 0x62, flags: 0x0}, + 1271: {region: 0x107, script: 0x6c, flags: 0x0}, + 1272: {region: 0x98, script: 0x20, flags: 0x0}, + 1273: {region: 0x130, script: 0x52, flags: 0x0}, + 1274: {region: 0x164, script: 0x52, flags: 0x0}, + 1275: {region: 0x9b, script: 0x82, flags: 0x0}, + 1276: {region: 0x164, script: 0x52, flags: 0x0}, + 1277: {region: 0x15d, script: 0xba, flags: 0x0}, + 1278: {region: 0x164, script: 0x52, flags: 0x0}, + 1279: {region: 0x164, script: 0x52, flags: 0x0}, + 1280: {region: 0xda, script: 0x20, flags: 0x0}, + 1281: {region: 0x164, script: 0x52, flags: 0x0}, + 1282: {region: 0x164, script: 0x52, flags: 0x0}, + 1283: {region: 0xd0, script: 0x52, flags: 0x0}, + 1284: {region: 0x74, script: 0x52, flags: 0x0}, + 1285: {region: 0x164, script: 0x52, flags: 0x0}, + 1286: {region: 0x164, script: 0x52, flags: 0x0}, + 1287: {region: 0x51, script: 0x52, flags: 0x0}, + 1288: {region: 0x164, script: 0x52, flags: 0x0}, + 1289: {region: 0x164, script: 0x52, flags: 0x0}, + 1290: {region: 0x164, script: 0x52, flags: 0x0}, + 1291: {region: 0x51, script: 0x52, flags: 0x0}, + 1292: {region: 0x164, script: 0x52, flags: 0x0}, + 1293: {region: 0x164, script: 0x52, flags: 0x0}, + 1294: {region: 0x164, script: 0x52, flags: 0x0}, + 1295: {region: 0x164, script: 0x52, flags: 0x0}, + 1296: {region: 0x1, script: 0x37, flags: 0x0}, + 1297: {region: 0x164, script: 0x52, flags: 0x0}, + 1298: {region: 0x164, script: 0x52, flags: 0x0}, + 1299: {region: 0x164, script: 0x52, flags: 0x0}, + 1300: {region: 0x164, script: 0x52, flags: 0x0}, + 1301: {region: 0x164, script: 0x52, flags: 0x0}, + 1302: {region: 0xd5, script: 0x52, flags: 0x0}, + 1303: {region: 0x164, script: 0x52, flags: 0x0}, + 1304: {region: 0x164, script: 0x52, flags: 0x0}, + 1305: {region: 0x164, script: 0x52, flags: 0x0}, + 1306: {region: 0x40, script: 0x52, flags: 0x0}, + 1307: {region: 0x164, script: 0x52, flags: 0x0}, + 1308: {region: 0xce, script: 0x52, flags: 0x0}, + 1309: {region: 0x4a, script: 0x3, flags: 0x1}, + 1310: {region: 0x164, script: 0x52, flags: 0x0}, + 1311: {region: 0x164, script: 0x52, flags: 0x0}, + 1312: {region: 0x164, script: 0x52, flags: 0x0}, + 1313: {region: 0x52, script: 0x52, flags: 0x0}, + 1314: {region: 0x10a, script: 0x52, flags: 0x0}, + 1316: {region: 0xa7, script: 0x5, flags: 0x0}, + 1317: {region: 0xd8, script: 0x52, flags: 0x0}, + 1318: {region: 0xb9, script: 0xd2, flags: 0x0}, + 1319: {region: 0x4d, script: 0x14, flags: 0x1}, + 1320: {region: 0x164, script: 0x52, flags: 0x0}, + 1321: {region: 0x121, script: 0x52, flags: 0x0}, + 1322: {region: 0xcf, script: 0x52, flags: 0x0}, + 1323: {region: 0x164, script: 0x52, flags: 0x0}, + 1324: {region: 0x160, script: 0x52, flags: 0x0}, + 1326: {region: 0x12a, script: 0x52, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. -// Size: 396 bytes, 99 elements -var likelyLangList = [99]likelyScriptRegion{ - 0: {region: 0x9a, script: 0x7, flags: 0x0}, - 1: {region: 0x9f, script: 0x6d, flags: 0x2}, - 2: {region: 0x11a, script: 0x78, flags: 0x2}, +// Size: 388 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9b, script: 0x7, flags: 0x0}, + 1: {region: 0xa0, script: 0x6d, flags: 0x2}, + 2: {region: 0x11b, script: 0x78, flags: 0x2}, 3: {region: 0x31, script: 0x52, flags: 0x0}, - 4: {region: 0x99, script: 0x5, flags: 0x4}, - 5: {region: 0x9a, script: 0x5, flags: 0x4}, - 6: {region: 0x104, script: 0x1e, flags: 0x4}, - 7: {region: 0x9a, script: 0x5, flags: 0x2}, - 8: {region: 0x97, script: 0xe, flags: 0x0}, - 9: {region: 0x34, script: 0x16, flags: 0x2}, - 10: {region: 0x104, script: 0x1e, flags: 0x0}, - 11: {region: 0x37, script: 0x2a, flags: 0x2}, - 12: {region: 0x132, script: 0x52, flags: 0x0}, - 13: {region: 0x79, script: 0xbd, flags: 0x2}, - 14: {region: 0x112, script: 0x52, flags: 0x0}, - 15: {region: 0x82, script: 0x1, flags: 0x2}, - 16: {region: 0x5c, script: 0x1d, flags: 0x0}, - 17: {region: 0x85, script: 0x57, flags: 0x2}, - 18: {region: 0xd4, script: 0x52, flags: 0x0}, - 19: {region: 0x51, script: 0x5, flags: 0x4}, - 20: {region: 0x109, script: 0x5, flags: 0x4}, - 21: {region: 0xac, script: 0x1e, flags: 0x0}, - 22: {region: 0x23, script: 0x5, flags: 0x4}, - 23: {region: 0x52, script: 0x5, flags: 0x4}, - 24: {region: 0x9a, script: 0x5, flags: 0x4}, - 25: {region: 0xc3, script: 0x5, flags: 0x4}, - 26: {region: 0x52, script: 0x5, flags: 0x2}, - 27: {region: 0x129, script: 0x52, flags: 0x0}, - 28: {region: 0xae, script: 0x5, flags: 0x4}, - 29: {region: 0x99, script: 0x5, flags: 0x2}, - 30: {region: 0xa3, script: 0x1e, flags: 0x0}, - 31: {region: 0x52, script: 0x5, flags: 0x4}, - 32: {region: 0x129, script: 0x52, flags: 0x4}, - 33: {region: 0x52, script: 0x5, flags: 0x2}, - 34: {region: 0x129, script: 0x52, flags: 0x2}, - 35: {region: 0xd9, script: 0x20, flags: 0x0}, - 36: {region: 0x97, script: 0x55, flags: 0x2}, - 37: {region: 0x81, script: 0x52, flags: 0x0}, - 38: {region: 0x82, script: 0x70, flags: 0x4}, - 39: {region: 0x82, script: 0x70, flags: 0x2}, - 40: {region: 0xc3, script: 0x1e, flags: 0x0}, - 41: {region: 0x52, script: 0x66, flags: 0x4}, - 42: {region: 0x52, script: 0x66, flags: 0x2}, - 43: {region: 0xce, script: 0x52, flags: 0x0}, - 44: {region: 0x49, script: 0x5, flags: 0x4}, - 45: {region: 0x93, script: 0x5, flags: 0x4}, - 46: {region: 0x97, script: 0x2f, flags: 0x0}, - 47: {region: 0xe6, script: 0x5, flags: 0x4}, - 48: {region: 0xe6, script: 0x5, flags: 0x2}, - 49: {region: 0x9a, script: 0x7c, flags: 0x0}, - 50: {region: 0x52, script: 0x7d, flags: 0x2}, - 51: {region: 0xb8, script: 0xd2, flags: 0x0}, - 52: {region: 0xd7, script: 0x52, flags: 0x4}, - 53: {region: 0xe6, script: 0x5, flags: 0x0}, - 54: {region: 0x97, script: 0x20, flags: 0x2}, - 55: {region: 0x97, script: 0x47, flags: 0x2}, - 56: {region: 0x97, script: 0xc0, flags: 0x2}, - 57: {region: 0x103, script: 0x1e, flags: 0x0}, - 58: {region: 0xbb, script: 0x52, flags: 0x4}, - 59: {region: 0x102, script: 0x52, flags: 0x4}, - 60: {region: 0x104, script: 0x52, flags: 0x4}, - 61: {region: 0x129, script: 0x52, flags: 0x4}, - 62: {region: 0x122, script: 0x1e, flags: 0x0}, - 63: {region: 0xe6, script: 0x5, flags: 0x4}, - 64: {region: 0xe6, script: 0x5, flags: 0x2}, - 65: {region: 0x52, script: 0x5, flags: 0x0}, - 66: {region: 0xac, script: 0x1e, flags: 0x4}, - 67: {region: 0xc3, script: 0x1e, flags: 0x4}, - 68: {region: 0xac, script: 0x1e, flags: 0x2}, - 69: {region: 0x97, script: 0xe, flags: 0x0}, - 70: {region: 0xd9, script: 0x20, flags: 0x4}, - 71: {region: 0xd9, script: 0x20, flags: 0x2}, - 72: {region: 0x134, script: 0x52, flags: 0x0}, - 73: {region: 0x23, script: 0x5, flags: 0x4}, - 74: {region: 0x52, script: 0x1e, flags: 0x4}, - 75: {region: 0x23, script: 0x5, flags: 0x2}, - 76: {region: 0x8b, script: 0x35, flags: 0x0}, - 77: {region: 0x52, script: 0x34, flags: 0x4}, - 78: {region: 0x52, script: 0x34, flags: 0x2}, - 79: {region: 0x52, script: 0x34, flags: 0x0}, - 80: {region: 0x2e, script: 0x35, flags: 0x4}, - 81: {region: 0x3d, script: 0x35, flags: 0x4}, - 82: {region: 0x79, script: 0x35, flags: 0x4}, - 83: {region: 0x7c, script: 0x35, flags: 0x4}, - 84: {region: 0x8b, script: 0x35, flags: 0x4}, - 85: {region: 0x93, script: 0x35, flags: 0x4}, - 86: {region: 0xc4, script: 0x35, flags: 0x4}, - 87: {region: 0xce, script: 0x35, flags: 0x4}, - 88: {region: 0xe0, script: 0x35, flags: 0x4}, - 89: {region: 0xe3, script: 0x35, flags: 0x4}, - 90: {region: 0xe5, script: 0x35, flags: 0x4}, - 91: {region: 0x114, script: 0x35, flags: 0x4}, - 92: {region: 0x121, script: 0x35, flags: 0x4}, - 93: {region: 0x12c, script: 0x35, flags: 0x4}, - 94: {region: 0x132, script: 0x35, flags: 0x4}, - 95: {region: 0x13b, script: 0x35, flags: 0x4}, - 96: {region: 0x12c, script: 0x11, flags: 0x2}, - 97: {region: 0x12c, script: 0x30, flags: 0x2}, - 98: {region: 0x12c, script: 0x35, flags: 0x2}, + 4: {region: 0x9a, script: 0x5, flags: 0x4}, + 5: {region: 0x9b, script: 0x5, flags: 0x4}, + 6: {region: 0x105, script: 0x1e, flags: 0x4}, + 7: {region: 0x9b, script: 0x5, flags: 0x2}, + 8: {region: 0x105, script: 0x1e, flags: 0x0}, + 9: {region: 0x37, script: 0x2a, flags: 0x2}, + 10: {region: 0x134, script: 0x52, flags: 0x0}, + 11: {region: 0x7a, script: 0xbd, flags: 0x2}, + 12: {region: 0x113, script: 0x52, flags: 0x0}, + 13: {region: 0x83, script: 0x1, flags: 0x2}, + 14: {region: 0x5c, script: 0x1d, flags: 0x0}, + 15: {region: 0x86, script: 0x57, flags: 0x2}, + 16: {region: 0xd5, script: 0x52, flags: 0x0}, + 17: {region: 0x51, script: 0x5, flags: 0x4}, + 18: {region: 0x10a, script: 0x5, flags: 0x4}, + 19: {region: 0xad, script: 0x1e, flags: 0x0}, + 20: {region: 0x23, script: 0x5, flags: 0x4}, + 21: {region: 0x52, script: 0x5, flags: 0x4}, + 22: {region: 0x9b, script: 0x5, flags: 0x4}, + 23: {region: 0xc4, script: 0x5, flags: 0x4}, + 24: {region: 0x52, script: 0x5, flags: 0x2}, + 25: {region: 0x12a, script: 0x52, flags: 0x0}, + 26: {region: 0xaf, script: 0x5, flags: 0x4}, + 27: {region: 0x9a, script: 0x5, flags: 0x2}, + 28: {region: 0xa4, script: 0x1e, flags: 0x0}, + 29: {region: 0x52, script: 0x5, flags: 0x4}, + 30: {region: 0x12a, script: 0x52, flags: 0x4}, + 31: {region: 0x52, script: 0x5, flags: 0x2}, + 32: {region: 0x12a, script: 0x52, flags: 0x2}, + 33: {region: 0xda, script: 0x20, flags: 0x0}, + 34: {region: 0x98, script: 0x55, flags: 0x2}, + 35: {region: 0x82, script: 0x52, flags: 0x0}, + 36: {region: 0x83, script: 0x70, flags: 0x4}, + 37: {region: 0x83, script: 0x70, flags: 0x2}, + 38: {region: 0xc4, script: 0x1e, flags: 0x0}, + 39: {region: 0x52, script: 0x66, flags: 0x4}, + 40: {region: 0x52, script: 0x66, flags: 0x2}, + 41: {region: 0xcf, script: 0x52, flags: 0x0}, + 42: {region: 0x49, script: 0x5, flags: 0x4}, + 43: {region: 0x94, script: 0x5, flags: 0x4}, + 44: {region: 0x98, script: 0x2f, flags: 0x0}, + 45: {region: 0xe7, script: 0x5, flags: 0x4}, + 46: {region: 0xe7, script: 0x5, flags: 0x2}, + 47: {region: 0x9b, script: 0x7c, flags: 0x0}, + 48: {region: 0x52, script: 0x7d, flags: 0x2}, + 49: {region: 0xb9, script: 0xd2, flags: 0x0}, + 50: {region: 0xd8, script: 0x52, flags: 0x4}, + 51: {region: 0xe7, script: 0x5, flags: 0x0}, + 52: {region: 0x98, script: 0x20, flags: 0x2}, + 53: {region: 0x98, script: 0x47, flags: 0x2}, + 54: {region: 0x98, script: 0xc0, flags: 0x2}, + 55: {region: 0x104, script: 0x1e, flags: 0x0}, + 56: {region: 0xbc, script: 0x52, flags: 0x4}, + 57: {region: 0x103, script: 0x52, flags: 0x4}, + 58: {region: 0x105, script: 0x52, flags: 0x4}, + 59: {region: 0x12a, script: 0x52, flags: 0x4}, + 60: {region: 0x123, script: 0x1e, flags: 0x0}, + 61: {region: 0xe7, script: 0x5, flags: 0x4}, + 62: {region: 0xe7, script: 0x5, flags: 0x2}, + 63: {region: 0x52, script: 0x5, flags: 0x0}, + 64: {region: 0xad, script: 0x1e, flags: 0x4}, + 65: {region: 0xc4, script: 0x1e, flags: 0x4}, + 66: {region: 0xad, script: 0x1e, flags: 0x2}, + 67: {region: 0x98, script: 0xe, flags: 0x0}, + 68: {region: 0xda, script: 0x20, flags: 0x4}, + 69: {region: 0xda, script: 0x20, flags: 0x2}, + 70: {region: 0x136, script: 0x52, flags: 0x0}, + 71: {region: 0x23, script: 0x5, flags: 0x4}, + 72: {region: 0x52, script: 0x1e, flags: 0x4}, + 73: {region: 0x23, script: 0x5, flags: 0x2}, + 74: {region: 0x8c, script: 0x35, flags: 0x0}, + 75: {region: 0x52, script: 0x34, flags: 0x4}, + 76: {region: 0x52, script: 0x34, flags: 0x2}, + 77: {region: 0x52, script: 0x34, flags: 0x0}, + 78: {region: 0x2e, script: 0x35, flags: 0x4}, + 79: {region: 0x3d, script: 0x35, flags: 0x4}, + 80: {region: 0x7a, script: 0x35, flags: 0x4}, + 81: {region: 0x7d, script: 0x35, flags: 0x4}, + 82: {region: 0x8c, script: 0x35, flags: 0x4}, + 83: {region: 0x94, script: 0x35, flags: 0x4}, + 84: {region: 0xc5, script: 0x35, flags: 0x4}, + 85: {region: 0xcf, script: 0x35, flags: 0x4}, + 86: {region: 0xe1, script: 0x35, flags: 0x4}, + 87: {region: 0xe4, script: 0x35, flags: 0x4}, + 88: {region: 0xe6, script: 0x35, flags: 0x4}, + 89: {region: 0x115, script: 0x35, flags: 0x4}, + 90: {region: 0x122, script: 0x35, flags: 0x4}, + 91: {region: 0x12d, script: 0x35, flags: 0x4}, + 92: {region: 0x134, script: 0x35, flags: 0x4}, + 93: {region: 0x13d, script: 0x35, flags: 0x4}, + 94: {region: 0x12d, script: 0x11, flags: 0x2}, + 95: {region: 0x12d, script: 0x30, flags: 0x2}, + 96: {region: 0x12d, script: 0x35, flags: 0x2}, } type likelyLangScript struct { @@ -2163,307 +2924,308 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 1420 bytes, 355 elements -var likelyRegion = [355]likelyLangScript{ - 33: {lang: 0x61, script: 0x52, flags: 0x0}, - 34: {lang: 0x15, script: 0x5, flags: 0x0}, +// Size: 1428 bytes, 357 elements +var likelyRegion = [357]likelyLangScript{ + 33: {lang: 0xd7, script: 0x52, flags: 0x0}, + 34: {lang: 0x3a, script: 0x5, flags: 0x0}, 35: {lang: 0x0, script: 0x2, flags: 0x1}, 38: {lang: 0x2, script: 0x2, flags: 0x1}, 39: {lang: 0x4, script: 0x2, flags: 0x1}, - 41: {lang: 0x1ef, script: 0x52, flags: 0x0}, + 41: {lang: 0x3be, script: 0x52, flags: 0x0}, 42: {lang: 0x0, script: 0x52, flags: 0x0}, - 43: {lang: 0x9d, script: 0x52, flags: 0x0}, - 44: {lang: 0x22f, script: 0x52, flags: 0x0}, - 45: {lang: 0x85, script: 0x52, flags: 0x0}, - 47: {lang: 0x1bd, script: 0x52, flags: 0x0}, - 48: {lang: 0x247, script: 0x52, flags: 0x0}, - 49: {lang: 0x24, script: 0x52, flags: 0x0}, + 43: {lang: 0x13d, script: 0x52, flags: 0x0}, + 44: {lang: 0x419, script: 0x52, flags: 0x0}, + 45: {lang: 0x10c, script: 0x52, flags: 0x0}, + 47: {lang: 0x365, script: 0x52, flags: 0x0}, + 48: {lang: 0x442, script: 0x52, flags: 0x0}, + 49: {lang: 0x58, script: 0x52, flags: 0x0}, 50: {lang: 0x6, script: 0x2, flags: 0x1}, - 52: {lang: 0x4b, script: 0xe, flags: 0x0}, - 53: {lang: 0x1bd, script: 0x52, flags: 0x0}, - 54: {lang: 0xaf, script: 0x52, flags: 0x0}, - 55: {lang: 0x38, script: 0x1e, flags: 0x0}, - 56: {lang: 0x15, script: 0x5, flags: 0x0}, - 57: {lang: 0x201, script: 0x52, flags: 0x0}, - 58: {lang: 0xaf, script: 0x52, flags: 0x0}, - 59: {lang: 0xaf, script: 0x52, flags: 0x0}, - 61: {lang: 0x19a, script: 0x52, flags: 0x0}, - 62: {lang: 0x9d, script: 0x52, flags: 0x0}, - 63: {lang: 0x1db, script: 0x52, flags: 0x0}, - 64: {lang: 0x1ef, script: 0x52, flags: 0x0}, + 52: {lang: 0xa5, script: 0xe, flags: 0x0}, + 53: {lang: 0x365, script: 0x52, flags: 0x0}, + 54: {lang: 0x15d, script: 0x52, flags: 0x0}, + 55: {lang: 0x7e, script: 0x1e, flags: 0x0}, + 56: {lang: 0x3a, script: 0x5, flags: 0x0}, + 57: {lang: 0x3d7, script: 0x52, flags: 0x0}, + 58: {lang: 0x15d, script: 0x52, flags: 0x0}, + 59: {lang: 0x15d, script: 0x52, flags: 0x0}, + 61: {lang: 0x31d, script: 0x52, flags: 0x0}, + 62: {lang: 0x13d, script: 0x52, flags: 0x0}, + 63: {lang: 0x39f, script: 0x52, flags: 0x0}, + 64: {lang: 0x3be, script: 0x52, flags: 0x0}, 66: {lang: 0x8, script: 0x2, flags: 0x1}, 68: {lang: 0x0, script: 0x52, flags: 0x0}, - 70: {lang: 0x2f, script: 0x1e, flags: 0x0}, - 72: {lang: 0x2b9, script: 0x37, flags: 0x2}, - 73: {lang: 0x19a, script: 0x5, flags: 0x2}, - 74: {lang: 0x248, script: 0x52, flags: 0x0}, - 75: {lang: 0xaf, script: 0x52, flags: 0x0}, - 76: {lang: 0xaf, script: 0x52, flags: 0x0}, - 77: {lang: 0x85, script: 0x52, flags: 0x0}, - 78: {lang: 0xaf, script: 0x52, flags: 0x0}, - 80: {lang: 0x9d, script: 0x52, flags: 0x0}, - 81: {lang: 0xaf, script: 0x52, flags: 0x0}, + 70: {lang: 0x71, script: 0x1e, flags: 0x0}, + 72: {lang: 0x510, script: 0x37, flags: 0x2}, + 73: {lang: 0x31d, script: 0x5, flags: 0x2}, + 74: {lang: 0x443, script: 0x52, flags: 0x0}, + 75: {lang: 0x15d, script: 0x52, flags: 0x0}, + 76: {lang: 0x15d, script: 0x52, flags: 0x0}, + 77: {lang: 0x10c, script: 0x52, flags: 0x0}, + 78: {lang: 0x15d, script: 0x52, flags: 0x0}, + 80: {lang: 0x13d, script: 0x52, flags: 0x0}, + 81: {lang: 0x15d, script: 0x52, flags: 0x0}, 82: {lang: 0xa, script: 0x5, flags: 0x1}, - 83: {lang: 0x9d, script: 0x52, flags: 0x0}, + 83: {lang: 0x13d, script: 0x52, flags: 0x0}, 84: {lang: 0x0, script: 0x52, flags: 0x0}, - 85: {lang: 0x9d, script: 0x52, flags: 0x0}, - 88: {lang: 0x9d, script: 0x52, flags: 0x0}, - 89: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 90: {lang: 0x1db, script: 0x52, flags: 0x0}, + 85: {lang: 0x13d, script: 0x52, flags: 0x0}, + 88: {lang: 0x13d, script: 0x52, flags: 0x0}, + 89: {lang: 0x3be, script: 0x52, flags: 0x0}, + 90: {lang: 0x39f, script: 0x52, flags: 0x0}, 92: {lang: 0xf, script: 0x2, flags: 0x1}, - 93: {lang: 0x79, script: 0x52, flags: 0x0}, - 95: {lang: 0x85, script: 0x52, flags: 0x0}, + 93: {lang: 0xf9, script: 0x52, flags: 0x0}, + 95: {lang: 0x10c, script: 0x52, flags: 0x0}, 97: {lang: 0x1, script: 0x52, flags: 0x0}, - 98: {lang: 0x80, script: 0x52, flags: 0x0}, - 100: {lang: 0x9d, script: 0x52, flags: 0x0}, + 98: {lang: 0x100, script: 0x52, flags: 0x0}, + 100: {lang: 0x13d, script: 0x52, flags: 0x0}, 102: {lang: 0x11, script: 0x2, flags: 0x1}, - 103: {lang: 0x9d, script: 0x52, flags: 0x0}, - 104: {lang: 0x9d, script: 0x52, flags: 0x0}, - 105: {lang: 0x9f, script: 0x52, flags: 0x0}, - 106: {lang: 0x15, script: 0x5, flags: 0x0}, - 107: {lang: 0x15, script: 0x5, flags: 0x0}, - 108: {lang: 0x261, script: 0x27, flags: 0x0}, - 109: {lang: 0x9d, script: 0x52, flags: 0x0}, + 103: {lang: 0x13d, script: 0x52, flags: 0x0}, + 104: {lang: 0x13d, script: 0x52, flags: 0x0}, + 105: {lang: 0x13f, script: 0x52, flags: 0x0}, + 106: {lang: 0x3a, script: 0x5, flags: 0x0}, + 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 108: {lang: 0x46d, script: 0x27, flags: 0x0}, + 109: {lang: 0x13d, script: 0x52, flags: 0x0}, 110: {lang: 0x13, script: 0x2, flags: 0x1}, - 112: {lang: 0xa8, script: 0x52, flags: 0x0}, - 113: {lang: 0xe2, script: 0x20, flags: 0x2}, - 116: {lang: 0xad, script: 0x52, flags: 0x0}, - 118: {lang: 0xaf, script: 0x52, flags: 0x0}, - 120: {lang: 0xaf, script: 0x52, flags: 0x0}, - 121: {lang: 0x15, script: 0x2, flags: 0x1}, - 123: {lang: 0x17, script: 0x3, flags: 0x1}, - 124: {lang: 0xaf, script: 0x52, flags: 0x0}, - 126: {lang: 0xd, script: 0x52, flags: 0x0}, - 128: {lang: 0x131, script: 0x52, flags: 0x0}, - 130: {lang: 0xaf, script: 0x52, flags: 0x0}, - 131: {lang: 0xaf, script: 0x52, flags: 0x0}, - 132: {lang: 0x9d, script: 0x52, flags: 0x0}, - 133: {lang: 0x1a, script: 0x2, flags: 0x1}, - 134: {lang: 0x0, script: 0x52, flags: 0x0}, - 135: {lang: 0x9d, script: 0x52, flags: 0x0}, - 137: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 139: {lang: 0x2c4, script: 0x35, flags: 0x0}, - 140: {lang: 0x0, script: 0x52, flags: 0x0}, - 141: {lang: 0x9d, script: 0x52, flags: 0x0}, - 142: {lang: 0xee, script: 0x52, flags: 0x0}, - 143: {lang: 0xf1, script: 0x52, flags: 0x0}, - 144: {lang: 0xf2, script: 0x52, flags: 0x0}, - 146: {lang: 0x9d, script: 0x52, flags: 0x0}, - 147: {lang: 0x1c, script: 0x2, flags: 0x1}, - 149: {lang: 0xe0, script: 0x37, flags: 0x0}, - 151: {lang: 0x1e, script: 0x3, flags: 0x1}, - 153: {lang: 0x15, script: 0x5, flags: 0x0}, - 154: {lang: 0x21, script: 0x2, flags: 0x1}, - 155: {lang: 0x102, script: 0x52, flags: 0x0}, - 156: {lang: 0x103, script: 0x52, flags: 0x0}, - 159: {lang: 0x15, script: 0x5, flags: 0x0}, - 160: {lang: 0x107, script: 0x41, flags: 0x0}, - 162: {lang: 0x248, script: 0x52, flags: 0x0}, - 163: {lang: 0x14d, script: 0x1e, flags: 0x0}, - 164: {lang: 0x23, script: 0x3, flags: 0x1}, - 166: {lang: 0x26, script: 0x2, flags: 0x1}, - 168: {lang: 0x136, script: 0x4b, flags: 0x0}, - 169: {lang: 0x136, script: 0x4b, flags: 0x0}, - 170: {lang: 0x15, script: 0x5, flags: 0x0}, - 172: {lang: 0x207, script: 0x1e, flags: 0x0}, - 173: {lang: 0x28, script: 0x2, flags: 0x1}, - 174: {lang: 0x15, script: 0x5, flags: 0x0}, - 176: {lang: 0x85, script: 0x52, flags: 0x0}, - 177: {lang: 0x228, script: 0xc1, flags: 0x0}, - 179: {lang: 0x242, script: 0x52, flags: 0x0}, - 180: {lang: 0x169, script: 0x52, flags: 0x0}, - 181: {lang: 0xaf, script: 0x52, flags: 0x0}, - 182: {lang: 0x170, script: 0x52, flags: 0x0}, - 183: {lang: 0x15, script: 0x5, flags: 0x0}, - 184: {lang: 0x2a, script: 0x2, flags: 0x1}, - 185: {lang: 0xaf, script: 0x52, flags: 0x0}, - 186: {lang: 0x2c, script: 0x2, flags: 0x1}, - 187: {lang: 0x23b, script: 0x52, flags: 0x0}, - 188: {lang: 0xaf, script: 0x52, flags: 0x0}, - 189: {lang: 0x183, script: 0x52, flags: 0x0}, - 192: {lang: 0x2e, script: 0x2, flags: 0x1}, - 193: {lang: 0x49, script: 0x52, flags: 0x0}, - 194: {lang: 0x30, script: 0x2, flags: 0x1}, - 195: {lang: 0x32, script: 0x2, flags: 0x1}, - 196: {lang: 0x34, script: 0x2, flags: 0x1}, - 198: {lang: 0xaf, script: 0x52, flags: 0x0}, - 199: {lang: 0x36, script: 0x2, flags: 0x1}, - 201: {lang: 0x19b, script: 0x52, flags: 0x0}, - 202: {lang: 0x38, script: 0x3, flags: 0x1}, - 203: {lang: 0x90, script: 0xd4, flags: 0x0}, - 205: {lang: 0x9d, script: 0x52, flags: 0x0}, - 206: {lang: 0x19a, script: 0x52, flags: 0x0}, - 207: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 208: {lang: 0xa, script: 0x52, flags: 0x0}, - 209: {lang: 0xaf, script: 0x52, flags: 0x0}, - 210: {lang: 0xdc, script: 0x52, flags: 0x0}, - 212: {lang: 0xdc, script: 0x5, flags: 0x2}, - 214: {lang: 0x9d, script: 0x52, flags: 0x0}, - 215: {lang: 0x1bd, script: 0x52, flags: 0x0}, - 216: {lang: 0x1af, script: 0x52, flags: 0x0}, - 217: {lang: 0x1b4, script: 0x20, flags: 0x0}, - 223: {lang: 0x15, script: 0x5, flags: 0x0}, - 224: {lang: 0x9d, script: 0x52, flags: 0x0}, - 226: {lang: 0x9d, script: 0x52, flags: 0x0}, - 227: {lang: 0xaf, script: 0x52, flags: 0x0}, - 228: {lang: 0x26e, script: 0x52, flags: 0x0}, - 229: {lang: 0xaa, script: 0x52, flags: 0x0}, - 230: {lang: 0x3b, script: 0x3, flags: 0x1}, - 231: {lang: 0x3e, script: 0x2, flags: 0x1}, - 232: {lang: 0xaf, script: 0x52, flags: 0x0}, - 234: {lang: 0x9d, script: 0x52, flags: 0x0}, - 235: {lang: 0x15, script: 0x5, flags: 0x0}, - 236: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 238: {lang: 0x1dc, script: 0x52, flags: 0x0}, - 239: {lang: 0xca, script: 0x52, flags: 0x0}, - 241: {lang: 0x15, script: 0x5, flags: 0x0}, - 256: {lang: 0xaf, script: 0x52, flags: 0x0}, - 258: {lang: 0x40, script: 0x2, flags: 0x1}, - 259: {lang: 0x23b, script: 0x1e, flags: 0x0}, - 260: {lang: 0x42, script: 0x2, flags: 0x1}, - 261: {lang: 0x20a, script: 0x52, flags: 0x0}, - 262: {lang: 0x15, script: 0x5, flags: 0x0}, - 264: {lang: 0xaf, script: 0x52, flags: 0x0}, - 265: {lang: 0x15, script: 0x5, flags: 0x0}, - 266: {lang: 0x44, script: 0x2, flags: 0x1}, - 269: {lang: 0x22c, script: 0x52, flags: 0x0}, - 270: {lang: 0x1af, script: 0x52, flags: 0x0}, - 271: {lang: 0x46, script: 0x2, flags: 0x1}, - 273: {lang: 0x103, script: 0x52, flags: 0x0}, - 274: {lang: 0xaf, script: 0x52, flags: 0x0}, - 275: {lang: 0x238, script: 0x52, flags: 0x0}, - 276: {lang: 0x1bd, script: 0x52, flags: 0x0}, - 278: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 280: {lang: 0x9d, script: 0x52, flags: 0x0}, - 282: {lang: 0x48, script: 0x2, flags: 0x1}, - 286: {lang: 0xaf, script: 0x52, flags: 0x0}, - 287: {lang: 0xaf, script: 0x52, flags: 0x0}, - 288: {lang: 0xaf, script: 0x52, flags: 0x0}, - 289: {lang: 0x4a, script: 0x3, flags: 0x1}, - 290: {lang: 0x4d, script: 0x2, flags: 0x1}, - 291: {lang: 0x265, script: 0x52, flags: 0x0}, - 292: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 293: {lang: 0x264, script: 0x52, flags: 0x0}, - 294: {lang: 0x4f, script: 0x2, flags: 0x1}, - 295: {lang: 0x26c, script: 0x52, flags: 0x0}, - 297: {lang: 0x51, script: 0x4, flags: 0x1}, - 299: {lang: 0x27c, script: 0x52, flags: 0x0}, - 300: {lang: 0x55, script: 0x2, flags: 0x1}, - 301: {lang: 0x248, script: 0x52, flags: 0x0}, - 302: {lang: 0x57, script: 0x3, flags: 0x1}, - 303: {lang: 0x248, script: 0x52, flags: 0x0}, - 306: {lang: 0x2b9, script: 0x37, flags: 0x2}, - 307: {lang: 0x9d, script: 0x52, flags: 0x0}, - 308: {lang: 0x28d, script: 0x52, flags: 0x0}, - 309: {lang: 0x103, script: 0x52, flags: 0x0}, - 312: {lang: 0x9d, script: 0x52, flags: 0x0}, - 315: {lang: 0x292, script: 0x52, flags: 0x0}, - 316: {lang: 0x41, script: 0x52, flags: 0x0}, - 317: {lang: 0xaf, script: 0x52, flags: 0x0}, - 319: {lang: 0x22f, script: 0x52, flags: 0x0}, - 330: {lang: 0x5a, script: 0x2, flags: 0x1}, - 347: {lang: 0x15, script: 0x5, flags: 0x0}, - 348: {lang: 0x5c, script: 0x2, flags: 0x1}, - 353: {lang: 0x236, script: 0x52, flags: 0x0}, + 112: {lang: 0x10c, script: 0x52, flags: 0x0}, + 113: {lang: 0x150, script: 0x52, flags: 0x0}, + 114: {lang: 0x1be, script: 0x20, flags: 0x2}, + 117: {lang: 0x157, script: 0x52, flags: 0x0}, + 119: {lang: 0x15d, script: 0x52, flags: 0x0}, + 121: {lang: 0x15d, script: 0x52, flags: 0x0}, + 122: {lang: 0x15, script: 0x2, flags: 0x1}, + 124: {lang: 0x17, script: 0x3, flags: 0x1}, + 125: {lang: 0x15d, script: 0x52, flags: 0x0}, + 127: {lang: 0x21, script: 0x52, flags: 0x0}, + 129: {lang: 0x243, script: 0x52, flags: 0x0}, + 131: {lang: 0x15d, script: 0x52, flags: 0x0}, + 132: {lang: 0x15d, script: 0x52, flags: 0x0}, + 133: {lang: 0x13d, script: 0x52, flags: 0x0}, + 134: {lang: 0x1a, script: 0x2, flags: 0x1}, + 135: {lang: 0x0, script: 0x52, flags: 0x0}, + 136: {lang: 0x13d, script: 0x52, flags: 0x0}, + 138: {lang: 0x3be, script: 0x52, flags: 0x0}, + 140: {lang: 0x527, script: 0x35, flags: 0x0}, + 141: {lang: 0x0, script: 0x52, flags: 0x0}, + 142: {lang: 0x13d, script: 0x52, flags: 0x0}, + 143: {lang: 0x1cf, script: 0x52, flags: 0x0}, + 144: {lang: 0x1d2, script: 0x52, flags: 0x0}, + 145: {lang: 0x1d3, script: 0x52, flags: 0x0}, + 147: {lang: 0x13d, script: 0x52, flags: 0x0}, + 148: {lang: 0x1c, script: 0x2, flags: 0x1}, + 150: {lang: 0x1ba, script: 0x37, flags: 0x0}, + 152: {lang: 0x1e, script: 0x3, flags: 0x1}, + 154: {lang: 0x3a, script: 0x5, flags: 0x0}, + 155: {lang: 0x21, script: 0x2, flags: 0x1}, + 156: {lang: 0x1f6, script: 0x52, flags: 0x0}, + 157: {lang: 0x1f7, script: 0x52, flags: 0x0}, + 160: {lang: 0x3a, script: 0x5, flags: 0x0}, + 161: {lang: 0x1fe, script: 0x41, flags: 0x0}, + 163: {lang: 0x443, script: 0x52, flags: 0x0}, + 164: {lang: 0x288, script: 0x1e, flags: 0x0}, + 165: {lang: 0x23, script: 0x3, flags: 0x1}, + 167: {lang: 0x26, script: 0x2, flags: 0x1}, + 169: {lang: 0x252, script: 0x4b, flags: 0x0}, + 170: {lang: 0x252, script: 0x4b, flags: 0x0}, + 171: {lang: 0x3a, script: 0x5, flags: 0x0}, + 173: {lang: 0x3e0, script: 0x1e, flags: 0x0}, + 174: {lang: 0x28, script: 0x2, flags: 0x1}, + 175: {lang: 0x3a, script: 0x5, flags: 0x0}, + 177: {lang: 0x10c, script: 0x52, flags: 0x0}, + 178: {lang: 0x40a, script: 0xc1, flags: 0x0}, + 180: {lang: 0x439, script: 0x52, flags: 0x0}, + 181: {lang: 0x2be, script: 0x52, flags: 0x0}, + 182: {lang: 0x15d, script: 0x52, flags: 0x0}, + 183: {lang: 0x2c5, script: 0x52, flags: 0x0}, + 184: {lang: 0x3a, script: 0x5, flags: 0x0}, + 185: {lang: 0x2a, script: 0x2, flags: 0x1}, + 186: {lang: 0x15d, script: 0x52, flags: 0x0}, + 187: {lang: 0x2c, script: 0x2, flags: 0x1}, + 188: {lang: 0x430, script: 0x52, flags: 0x0}, + 189: {lang: 0x15d, script: 0x52, flags: 0x0}, + 190: {lang: 0x2ef, script: 0x52, flags: 0x0}, + 193: {lang: 0x2e, script: 0x2, flags: 0x1}, + 194: {lang: 0xa0, script: 0x52, flags: 0x0}, + 195: {lang: 0x30, script: 0x2, flags: 0x1}, + 196: {lang: 0x32, script: 0x2, flags: 0x1}, + 197: {lang: 0x34, script: 0x2, flags: 0x1}, + 199: {lang: 0x15d, script: 0x52, flags: 0x0}, + 200: {lang: 0x36, script: 0x2, flags: 0x1}, + 202: {lang: 0x31e, script: 0x52, flags: 0x0}, + 203: {lang: 0x38, script: 0x3, flags: 0x1}, + 204: {lang: 0x127, script: 0xd4, flags: 0x0}, + 206: {lang: 0x13d, script: 0x52, flags: 0x0}, + 207: {lang: 0x31d, script: 0x52, flags: 0x0}, + 208: {lang: 0x3be, script: 0x52, flags: 0x0}, + 209: {lang: 0x16, script: 0x52, flags: 0x0}, + 210: {lang: 0x15d, script: 0x52, flags: 0x0}, + 211: {lang: 0x1b2, script: 0x52, flags: 0x0}, + 213: {lang: 0x1b2, script: 0x5, flags: 0x2}, + 215: {lang: 0x13d, script: 0x52, flags: 0x0}, + 216: {lang: 0x365, script: 0x52, flags: 0x0}, + 217: {lang: 0x345, script: 0x52, flags: 0x0}, + 218: {lang: 0x34f, script: 0x20, flags: 0x0}, + 224: {lang: 0x3a, script: 0x5, flags: 0x0}, + 225: {lang: 0x13d, script: 0x52, flags: 0x0}, + 227: {lang: 0x13d, script: 0x52, flags: 0x0}, + 228: {lang: 0x15d, script: 0x52, flags: 0x0}, + 229: {lang: 0x484, script: 0x52, flags: 0x0}, + 230: {lang: 0x152, script: 0x52, flags: 0x0}, + 231: {lang: 0x3b, script: 0x3, flags: 0x1}, + 232: {lang: 0x3b1, script: 0x52, flags: 0x0}, + 233: {lang: 0x15d, script: 0x52, flags: 0x0}, + 235: {lang: 0x13d, script: 0x52, flags: 0x0}, + 236: {lang: 0x3a, script: 0x5, flags: 0x0}, + 237: {lang: 0x3be, script: 0x52, flags: 0x0}, + 239: {lang: 0x3a0, script: 0x52, flags: 0x0}, + 240: {lang: 0x192, script: 0x52, flags: 0x0}, + 242: {lang: 0x3a, script: 0x5, flags: 0x0}, + 257: {lang: 0x15d, script: 0x52, flags: 0x0}, + 259: {lang: 0x3e, script: 0x2, flags: 0x1}, + 260: {lang: 0x430, script: 0x1e, flags: 0x0}, + 261: {lang: 0x40, script: 0x2, flags: 0x1}, + 262: {lang: 0x3e3, script: 0x52, flags: 0x0}, + 263: {lang: 0x3a, script: 0x5, flags: 0x0}, + 265: {lang: 0x15d, script: 0x52, flags: 0x0}, + 266: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x42, script: 0x2, flags: 0x1}, + 270: {lang: 0x414, script: 0x52, flags: 0x0}, + 271: {lang: 0x345, script: 0x52, flags: 0x0}, + 272: {lang: 0x44, script: 0x2, flags: 0x1}, + 274: {lang: 0x1f7, script: 0x52, flags: 0x0}, + 275: {lang: 0x15d, script: 0x52, flags: 0x0}, + 276: {lang: 0x427, script: 0x52, flags: 0x0}, + 277: {lang: 0x365, script: 0x52, flags: 0x0}, + 279: {lang: 0x3be, script: 0x52, flags: 0x0}, + 281: {lang: 0x13d, script: 0x52, flags: 0x0}, + 283: {lang: 0x46, script: 0x2, flags: 0x1}, + 287: {lang: 0x15d, script: 0x52, flags: 0x0}, + 288: {lang: 0x15d, script: 0x52, flags: 0x0}, + 289: {lang: 0x48, script: 0x2, flags: 0x1}, + 290: {lang: 0x4a, script: 0x3, flags: 0x1}, + 291: {lang: 0x4d, script: 0x2, flags: 0x1}, + 292: {lang: 0x475, script: 0x52, flags: 0x0}, + 293: {lang: 0x3be, script: 0x52, flags: 0x0}, + 294: {lang: 0x474, script: 0x52, flags: 0x0}, + 295: {lang: 0x4f, script: 0x2, flags: 0x1}, + 296: {lang: 0x480, script: 0x52, flags: 0x0}, + 298: {lang: 0x51, script: 0x4, flags: 0x1}, + 300: {lang: 0x49e, script: 0x52, flags: 0x0}, + 301: {lang: 0x55, script: 0x2, flags: 0x1}, + 302: {lang: 0x443, script: 0x52, flags: 0x0}, + 303: {lang: 0x57, script: 0x3, flags: 0x1}, + 304: {lang: 0x443, script: 0x52, flags: 0x0}, + 308: {lang: 0x510, script: 0x37, flags: 0x2}, + 309: {lang: 0x13d, script: 0x52, flags: 0x0}, + 310: {lang: 0x4ba, script: 0x52, flags: 0x0}, + 311: {lang: 0x1f7, script: 0x52, flags: 0x0}, + 314: {lang: 0x13d, script: 0x52, flags: 0x0}, + 317: {lang: 0x4c1, script: 0x52, flags: 0x0}, + 318: {lang: 0x8a, script: 0x52, flags: 0x0}, + 319: {lang: 0x15d, script: 0x52, flags: 0x0}, + 321: {lang: 0x419, script: 0x52, flags: 0x0}, + 332: {lang: 0x5a, script: 0x2, flags: 0x1}, + 349: {lang: 0x3a, script: 0x5, flags: 0x0}, + 350: {lang: 0x5c, script: 0x2, flags: 0x1}, + 355: {lang: 0x421, script: 0x52, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 376 bytes, 94 elements var likelyRegionList = [94]likelyLangScript{ - 0: {lang: 0xa4, script: 0x5, flags: 0x0}, - 1: {lang: 0x264, script: 0x52, flags: 0x0}, - 2: {lang: 0x23a, script: 0x52, flags: 0x0}, - 3: {lang: 0x18c, script: 0x1e, flags: 0x0}, - 4: {lang: 0xf3, script: 0x8, flags: 0x0}, - 5: {lang: 0x145, script: 0x52, flags: 0x0}, - 6: {lang: 0x54, script: 0x52, flags: 0x0}, - 7: {lang: 0x23b, script: 0x1e, flags: 0x0}, - 8: {lang: 0x93, script: 0xd6, flags: 0x0}, - 9: {lang: 0x1b4, script: 0x20, flags: 0x0}, - 10: {lang: 0x2c4, script: 0x34, flags: 0x0}, - 11: {lang: 0x284, script: 0x5, flags: 0x0}, - 12: {lang: 0x2bd, script: 0x35, flags: 0x0}, - 13: {lang: 0x2be, script: 0x52, flags: 0x0}, - 14: {lang: 0x157, script: 0xd5, flags: 0x0}, - 15: {lang: 0x9a, script: 0x2d, flags: 0x0}, - 16: {lang: 0x26f, script: 0x52, flags: 0x0}, - 17: {lang: 0x15, script: 0x5, flags: 0x0}, - 18: {lang: 0xaf, script: 0x52, flags: 0x0}, - 19: {lang: 0x11, script: 0x27, flags: 0x0}, - 20: {lang: 0x9b, script: 0x52, flags: 0x0}, - 21: {lang: 0x141, script: 0x5, flags: 0x2}, - 22: {lang: 0x2b9, script: 0x37, flags: 0x2}, - 23: {lang: 0x111, script: 0x29, flags: 0x0}, - 24: {lang: 0x2, script: 0x1e, flags: 0x0}, - 25: {lang: 0x145, script: 0x52, flags: 0x0}, - 26: {lang: 0x9a, script: 0x2d, flags: 0x0}, - 27: {lang: 0x18c, script: 0x1e, flags: 0x0}, - 28: {lang: 0xf8, script: 0x52, flags: 0x0}, - 29: {lang: 0x19a, script: 0x5, flags: 0x0}, - 30: {lang: 0xe1, script: 0x20, flags: 0x0}, - 31: {lang: 0x28c, script: 0x5, flags: 0x0}, - 32: {lang: 0x129, script: 0x6b, flags: 0x0}, - 33: {lang: 0xa4, script: 0x5, flags: 0x0}, - 34: {lang: 0x264, script: 0x52, flags: 0x0}, - 35: {lang: 0x133, script: 0x46, flags: 0x0}, - 36: {lang: 0x6d, script: 0x5, flags: 0x0}, - 37: {lang: 0x11c, script: 0xd5, flags: 0x0}, - 38: {lang: 0x15, script: 0x5, flags: 0x0}, - 39: {lang: 0xaf, script: 0x52, flags: 0x0}, - 40: {lang: 0x165, script: 0x4f, flags: 0x0}, - 41: {lang: 0x11c, script: 0xd5, flags: 0x0}, - 42: {lang: 0x15, script: 0x5, flags: 0x0}, - 43: {lang: 0xaf, script: 0x52, flags: 0x0}, - 44: {lang: 0x203, script: 0x52, flags: 0x0}, - 45: {lang: 0x286, script: 0x1e, flags: 0x0}, - 46: {lang: 0x18c, script: 0x1e, flags: 0x0}, - 47: {lang: 0x23a, script: 0x52, flags: 0x0}, - 48: {lang: 0x1a5, script: 0x6b, flags: 0x0}, - 49: {lang: 0x114, script: 0x52, flags: 0x0}, - 50: {lang: 0x18f, script: 0x1e, flags: 0x0}, - 51: {lang: 0x12f, script: 0x5, flags: 0x0}, - 52: {lang: 0x2c4, script: 0x35, flags: 0x0}, - 53: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 54: {lang: 0x15, script: 0x5, flags: 0x0}, - 55: {lang: 0xaf, script: 0x52, flags: 0x0}, - 56: {lang: 0x182, script: 0x52, flags: 0x0}, - 57: {lang: 0x28c, script: 0x5, flags: 0x0}, - 58: {lang: 0x40, script: 0x20, flags: 0x0}, - 59: {lang: 0x28c, script: 0x5, flags: 0x0}, - 60: {lang: 0x28c, script: 0x5, flags: 0x0}, - 61: {lang: 0x58, script: 0x20, flags: 0x0}, - 62: {lang: 0x1e7, script: 0x52, flags: 0x0}, - 63: {lang: 0x2f, script: 0x1e, flags: 0x0}, - 64: {lang: 0x203, script: 0x52, flags: 0x0}, - 65: {lang: 0x38, script: 0x1e, flags: 0x0}, - 66: {lang: 0x207, script: 0x1e, flags: 0x0}, - 67: {lang: 0x13f, script: 0x52, flags: 0x0}, - 68: {lang: 0x247, script: 0x52, flags: 0x0}, - 69: {lang: 0x2b9, script: 0x37, flags: 0x0}, - 70: {lang: 0x22a, script: 0x52, flags: 0x0}, - 71: {lang: 0x286, script: 0x1e, flags: 0x0}, - 72: {lang: 0x15, script: 0x5, flags: 0x0}, - 73: {lang: 0xaf, script: 0x52, flags: 0x0}, - 74: {lang: 0x25d, script: 0xd5, flags: 0x0}, - 75: {lang: 0x181, script: 0x5, flags: 0x0}, - 76: {lang: 0x191, script: 0x6b, flags: 0x0}, - 77: {lang: 0x25c, script: 0x1e, flags: 0x0}, - 78: {lang: 0xa4, script: 0x5, flags: 0x0}, - 79: {lang: 0x15, script: 0x5, flags: 0x0}, - 80: {lang: 0xaf, script: 0x52, flags: 0x0}, - 81: {lang: 0x26f, script: 0x52, flags: 0x0}, - 82: {lang: 0x24, script: 0x5, flags: 0x0}, - 83: {lang: 0x118, script: 0x1e, flags: 0x0}, - 84: {lang: 0x3b, script: 0x2d, flags: 0x0}, - 85: {lang: 0x2c4, script: 0x35, flags: 0x0}, - 86: {lang: 0x271, script: 0x52, flags: 0x0}, - 87: {lang: 0x286, script: 0x1e, flags: 0x0}, - 88: {lang: 0x2b9, script: 0x37, flags: 0x0}, - 89: {lang: 0x1e7, script: 0x52, flags: 0x0}, - 90: {lang: 0x23a, script: 0x52, flags: 0x0}, - 91: {lang: 0x23b, script: 0x1e, flags: 0x0}, - 92: {lang: 0xaf, script: 0x52, flags: 0x0}, - 93: {lang: 0x249, script: 0x5, flags: 0x0}, + 0: {lang: 0x147, script: 0x5, flags: 0x0}, + 1: {lang: 0x474, script: 0x52, flags: 0x0}, + 2: {lang: 0x42f, script: 0x52, flags: 0x0}, + 3: {lang: 0x2fd, script: 0x1e, flags: 0x0}, + 4: {lang: 0x1d5, script: 0x8, flags: 0x0}, + 5: {lang: 0x272, script: 0x52, flags: 0x0}, + 6: {lang: 0xb7, script: 0x52, flags: 0x0}, + 7: {lang: 0x430, script: 0x1e, flags: 0x0}, + 8: {lang: 0x12c, script: 0xd6, flags: 0x0}, + 9: {lang: 0x34f, script: 0x20, flags: 0x0}, + 10: {lang: 0x527, script: 0x34, flags: 0x0}, + 11: {lang: 0x4aa, script: 0x5, flags: 0x0}, + 12: {lang: 0x51d, script: 0x35, flags: 0x0}, + 13: {lang: 0x521, script: 0x52, flags: 0x0}, + 14: {lang: 0x298, script: 0xd5, flags: 0x0}, + 15: {lang: 0x135, script: 0x2d, flags: 0x0}, + 16: {lang: 0x488, script: 0x52, flags: 0x0}, + 17: {lang: 0x3a, script: 0x5, flags: 0x0}, + 18: {lang: 0x15d, script: 0x52, flags: 0x0}, + 19: {lang: 0x27, script: 0x27, flags: 0x0}, + 20: {lang: 0x138, script: 0x52, flags: 0x0}, + 21: {lang: 0x268, script: 0x5, flags: 0x2}, + 22: {lang: 0x510, script: 0x37, flags: 0x2}, + 23: {lang: 0x20e, script: 0x29, flags: 0x0}, + 24: {lang: 0x5, script: 0x1e, flags: 0x0}, + 25: {lang: 0x272, script: 0x52, flags: 0x0}, + 26: {lang: 0x135, script: 0x2d, flags: 0x0}, + 27: {lang: 0x2fd, script: 0x1e, flags: 0x0}, + 28: {lang: 0x1df, script: 0x52, flags: 0x0}, + 29: {lang: 0x31d, script: 0x5, flags: 0x0}, + 30: {lang: 0x1bc, script: 0x20, flags: 0x0}, + 31: {lang: 0x4b2, script: 0x5, flags: 0x0}, + 32: {lang: 0x234, script: 0x6b, flags: 0x0}, + 33: {lang: 0x147, script: 0x5, flags: 0x0}, + 34: {lang: 0x474, script: 0x52, flags: 0x0}, + 35: {lang: 0x248, script: 0x46, flags: 0x0}, + 36: {lang: 0xe6, script: 0x5, flags: 0x0}, + 37: {lang: 0x224, script: 0xd5, flags: 0x0}, + 38: {lang: 0x3a, script: 0x5, flags: 0x0}, + 39: {lang: 0x15d, script: 0x52, flags: 0x0}, + 40: {lang: 0x2b6, script: 0x4f, flags: 0x0}, + 41: {lang: 0x224, script: 0xd5, flags: 0x0}, + 42: {lang: 0x3a, script: 0x5, flags: 0x0}, + 43: {lang: 0x15d, script: 0x52, flags: 0x0}, + 44: {lang: 0x3da, script: 0x52, flags: 0x0}, + 45: {lang: 0x4ac, script: 0x1e, flags: 0x0}, + 46: {lang: 0x2fd, script: 0x1e, flags: 0x0}, + 47: {lang: 0x42f, script: 0x52, flags: 0x0}, + 48: {lang: 0x32f, script: 0x6b, flags: 0x0}, + 49: {lang: 0x211, script: 0x52, flags: 0x0}, + 50: {lang: 0x309, script: 0x1e, flags: 0x0}, + 51: {lang: 0x240, script: 0x5, flags: 0x0}, + 52: {lang: 0x527, script: 0x35, flags: 0x0}, + 53: {lang: 0x3be, script: 0x52, flags: 0x0}, + 54: {lang: 0x3a, script: 0x5, flags: 0x0}, + 55: {lang: 0x15d, script: 0x52, flags: 0x0}, + 56: {lang: 0x2eb, script: 0x52, flags: 0x0}, + 57: {lang: 0x4b2, script: 0x5, flags: 0x0}, + 58: {lang: 0x88, script: 0x20, flags: 0x0}, + 59: {lang: 0x4b2, script: 0x5, flags: 0x0}, + 60: {lang: 0x4b2, script: 0x5, flags: 0x0}, + 61: {lang: 0xbe, script: 0x20, flags: 0x0}, + 62: {lang: 0x3da, script: 0x52, flags: 0x0}, + 63: {lang: 0x7e, script: 0x1e, flags: 0x0}, + 64: {lang: 0x3e0, script: 0x1e, flags: 0x0}, + 65: {lang: 0x265, script: 0x52, flags: 0x0}, + 66: {lang: 0x442, script: 0x52, flags: 0x0}, + 67: {lang: 0x510, script: 0x37, flags: 0x0}, + 68: {lang: 0x410, script: 0x52, flags: 0x0}, + 69: {lang: 0x4ac, script: 0x1e, flags: 0x0}, + 70: {lang: 0x3a, script: 0x5, flags: 0x0}, + 71: {lang: 0x15d, script: 0x52, flags: 0x0}, + 72: {lang: 0x15d, script: 0x52, flags: 0x0}, + 73: {lang: 0x35, script: 0x5, flags: 0x0}, + 74: {lang: 0x469, script: 0xd5, flags: 0x0}, + 75: {lang: 0x2ea, script: 0x5, flags: 0x0}, + 76: {lang: 0x30d, script: 0x6b, flags: 0x0}, + 77: {lang: 0x465, script: 0x1e, flags: 0x0}, + 78: {lang: 0x147, script: 0x5, flags: 0x0}, + 79: {lang: 0x3a, script: 0x5, flags: 0x0}, + 80: {lang: 0x15d, script: 0x52, flags: 0x0}, + 81: {lang: 0x488, script: 0x52, flags: 0x0}, + 82: {lang: 0x58, script: 0x5, flags: 0x0}, + 83: {lang: 0x217, script: 0x1e, flags: 0x0}, + 84: {lang: 0x81, script: 0x2d, flags: 0x0}, + 85: {lang: 0x527, script: 0x35, flags: 0x0}, + 86: {lang: 0x48a, script: 0x52, flags: 0x0}, + 87: {lang: 0x4ac, script: 0x1e, flags: 0x0}, + 88: {lang: 0x510, script: 0x37, flags: 0x0}, + 89: {lang: 0x3b1, script: 0x52, flags: 0x0}, + 90: {lang: 0x42f, script: 0x52, flags: 0x0}, + 91: {lang: 0x430, script: 0x1e, flags: 0x0}, + 92: {lang: 0x15d, script: 0x52, flags: 0x0}, + 93: {lang: 0x444, script: 0x5, flags: 0x0}, } type likelyTag struct { @@ -2474,186 +3236,287 @@ type likelyTag struct { // Size: 192 bytes, 32 elements var likelyRegionGroup = [32]likelyTag{ - 1: {lang: 0x9b, region: 0xd4, script: 0x52}, - 2: {lang: 0x9b, region: 0x132, script: 0x52}, - 3: {lang: 0x1ef, region: 0x40, script: 0x52}, - 4: {lang: 0x9b, region: 0x2e, script: 0x52}, - 5: {lang: 0x9b, region: 0xd4, script: 0x52}, - 6: {lang: 0x9d, region: 0xcd, script: 0x52}, - 7: {lang: 0x248, region: 0x12d, script: 0x52}, - 8: {lang: 0x15, region: 0x6a, script: 0x5}, - 9: {lang: 0x248, region: 0x4a, script: 0x52}, - 10: {lang: 0x9b, region: 0x15e, script: 0x52}, - 11: {lang: 0x9b, region: 0x132, script: 0x52}, - 12: {lang: 0x9b, region: 0x132, script: 0x52}, - 13: {lang: 0x9d, region: 0x58, script: 0x52}, - 14: {lang: 0x2c4, region: 0x52, script: 0x34}, - 15: {lang: 0xe1, region: 0x97, script: 0x20}, - 16: {lang: 0xf8, region: 0x93, script: 0x52}, - 17: {lang: 0x103, region: 0x9c, script: 0x52}, - 18: {lang: 0x9b, region: 0x2e, script: 0x52}, - 19: {lang: 0x9b, region: 0xe4, script: 0x52}, - 20: {lang: 0x9b, region: 0x88, script: 0x52}, - 21: {lang: 0x22f, region: 0x13f, script: 0x52}, - 22: {lang: 0x2c4, region: 0x52, script: 0x34}, - 23: {lang: 0x28d, region: 0x134, script: 0x52}, - 24: {lang: 0x15, region: 0x106, script: 0x5}, - 25: {lang: 0x207, region: 0x104, script: 0x1e}, - 26: {lang: 0x207, region: 0x104, script: 0x1e}, - 27: {lang: 0x9b, region: 0x79, script: 0x52}, - 28: {lang: 0x85, region: 0x5f, script: 0x52}, - 29: {lang: 0x9d, region: 0x1e, script: 0x52}, - 30: {lang: 0x9b, region: 0x98, script: 0x52}, - 31: {lang: 0x9b, region: 0x79, script: 0x52}, + 1: {lang: 0x138, region: 0xd5, script: 0x52}, + 2: {lang: 0x138, region: 0x134, script: 0x52}, + 3: {lang: 0x3be, region: 0x40, script: 0x52}, + 4: {lang: 0x138, region: 0x2e, script: 0x52}, + 5: {lang: 0x138, region: 0xd5, script: 0x52}, + 6: {lang: 0x13d, region: 0xce, script: 0x52}, + 7: {lang: 0x443, region: 0x12e, script: 0x52}, + 8: {lang: 0x3a, region: 0x6a, script: 0x5}, + 9: {lang: 0x443, region: 0x4a, script: 0x52}, + 10: {lang: 0x138, region: 0x160, script: 0x52}, + 11: {lang: 0x138, region: 0x134, script: 0x52}, + 12: {lang: 0x138, region: 0x134, script: 0x52}, + 13: {lang: 0x13d, region: 0x58, script: 0x52}, + 14: {lang: 0x527, region: 0x52, script: 0x34}, + 15: {lang: 0x1bc, region: 0x98, script: 0x20}, + 16: {lang: 0x1df, region: 0x94, script: 0x52}, + 17: {lang: 0x1f7, region: 0x9d, script: 0x52}, + 18: {lang: 0x138, region: 0x2e, script: 0x52}, + 19: {lang: 0x138, region: 0xe5, script: 0x52}, + 20: {lang: 0x138, region: 0x89, script: 0x52}, + 21: {lang: 0x419, region: 0x141, script: 0x52}, + 22: {lang: 0x527, region: 0x52, script: 0x34}, + 23: {lang: 0x4ba, region: 0x136, script: 0x52}, + 24: {lang: 0x3a, region: 0x107, script: 0x5}, + 25: {lang: 0x3e0, region: 0x105, script: 0x1e}, + 26: {lang: 0x3e0, region: 0x105, script: 0x1e}, + 27: {lang: 0x138, region: 0x7a, script: 0x52}, + 28: {lang: 0x10c, region: 0x5f, script: 0x52}, + 29: {lang: 0x13d, region: 0x1e, script: 0x52}, + 30: {lang: 0x138, region: 0x99, script: 0x52}, + 31: {lang: 0x138, region: 0x7a, script: 0x52}, +} + +// Size: 357 bytes, 357 elements +var regionToGroups = [357]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, 0x04, + // Entry 40 - 7F + 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, 0x00, + 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + // Entry 80 - BF + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x01, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, 0x04, + 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, 0x00, + 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, 0x00, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, } type mutualIntelligibility struct { - want uint16 - have uint16 - conf uint8 - oneway bool + want uint16 + have uint16 + distance uint8 + oneway bool } type scriptIntelligibility struct { - lang uint16 - want uint8 - have uint8 - conf uint8 + wantLang uint16 + haveLang uint16 + wantScript uint8 + haveScript uint8 + distance uint8 +} + +type regionIntelligibility struct { + lang uint16 + script uint8 + group uint8 + distance uint8 } // matchLang holds pairs of langIDs of base languages that are typically // mutually intelligible. Each pair is associated with a confidence and // whether the intelligibility goes one or both ways. -// Size: 708 bytes, 118 elements -var matchLang = [118]mutualIntelligibility{ - 0: {want: 0x1c1, have: 0x1af, conf: 0x2, oneway: false}, - 1: {want: 0x145, have: 0x6f, conf: 0x2, oneway: false}, - 2: {want: 0xee, have: 0x54, conf: 0x2, oneway: false}, - 3: {want: 0x225, have: 0x54, conf: 0x2, oneway: false}, - 4: {want: 0x23b, have: 0x54, conf: 0x2, oneway: false}, - 5: {want: 0x225, have: 0xee, conf: 0x2, oneway: false}, - 6: {want: 0x23b, have: 0xee, conf: 0x2, oneway: false}, - 7: {want: 0x225, have: 0x23b, conf: 0x2, oneway: false}, - 8: {want: 0x241, have: 0x1, conf: 0x2, oneway: false}, - 9: {want: 0xd2, have: 0x85, conf: 0x2, oneway: true}, - 10: {want: 0x154, have: 0x85, conf: 0x2, oneway: true}, - 11: {want: 0x80, have: 0x1c1, conf: 0x2, oneway: false}, - 12: {want: 0x80, have: 0x1af, conf: 0x2, oneway: false}, - 13: {want: 0x6f, have: 0x145, conf: 0x2, oneway: false}, - 14: {want: 0x2, have: 0x207, conf: 0x2, oneway: true}, - 15: {want: 0x5, have: 0x9b, conf: 0x2, oneway: true}, - 16: {want: 0xa, have: 0x1bd, conf: 0x2, oneway: true}, - 17: {want: 0xd, have: 0x9b, conf: 0x2, oneway: true}, - 18: {want: 0x23, have: 0x9d, conf: 0x2, oneway: true}, - 19: {want: 0x24, have: 0x207, conf: 0x2, oneway: true}, - 20: {want: 0x2f, have: 0x207, conf: 0x2, oneway: true}, - 21: {want: 0x31, have: 0x9b, conf: 0x2, oneway: true}, - 22: {want: 0x3c, have: 0xe1, conf: 0x2, oneway: true}, - 23: {want: 0x4b, have: 0x9b, conf: 0x2, oneway: true}, - 24: {want: 0x50, have: 0xaf, conf: 0x2, oneway: true}, - 25: {want: 0x65, have: 0xaa, conf: 0x2, oneway: true}, - 26: {want: 0x6c, have: 0x9b, conf: 0x2, oneway: true}, - 27: {want: 0x6f, have: 0x15, conf: 0x2, oneway: true}, - 28: {want: 0x70, have: 0xaf, conf: 0x2, oneway: true}, - 29: {want: 0x78, have: 0xaf, conf: 0x2, oneway: true}, - 30: {want: 0x7f, have: 0x9b, conf: 0x2, oneway: true}, - 31: {want: 0x95, have: 0x9b, conf: 0x2, oneway: true}, - 32: {want: 0x9c, have: 0x9b, conf: 0x2, oneway: true}, - 33: {want: 0x9f, have: 0xa8, conf: 0x2, oneway: true}, - 34: {want: 0xa1, have: 0x9d, conf: 0x2, oneway: true}, - 35: {want: 0xad, have: 0x80, conf: 0x2, oneway: true}, - 36: {want: 0xb9, have: 0x1bd, conf: 0x2, oneway: true}, - 37: {want: 0xba, have: 0x9b, conf: 0x2, oneway: true}, - 38: {want: 0xbb, have: 0x9b, conf: 0x2, oneway: true}, - 39: {want: 0xc2, have: 0x9b, conf: 0x2, oneway: true}, - 40: {want: 0xc8, have: 0x9d, conf: 0x2, oneway: true}, - 41: {want: 0xca, have: 0x9d, conf: 0x2, oneway: true}, - 42: {want: 0xd3, have: 0xe1, conf: 0x2, oneway: true}, - 43: {want: 0xdc, have: 0x9b, conf: 0x2, oneway: true}, - 44: {want: 0xde, have: 0x9b, conf: 0x2, oneway: true}, - 45: {want: 0xf1, have: 0xaf, conf: 0x2, oneway: true}, - 46: {want: 0xf3, have: 0x207, conf: 0x2, oneway: true}, - 47: {want: 0xf5, have: 0x9b, conf: 0x2, oneway: true}, - 48: {want: 0xfa, have: 0x9b, conf: 0x2, oneway: true}, - 49: {want: 0x102, have: 0x9b, conf: 0x2, oneway: true}, - 50: {want: 0x10f, have: 0xf8, conf: 0x2, oneway: true}, - 51: {want: 0x111, have: 0x9b, conf: 0x2, oneway: true}, - 52: {want: 0x122, have: 0xaf, conf: 0x2, oneway: true}, - 53: {want: 0x12f, have: 0x207, conf: 0x2, oneway: true}, - 54: {want: 0x133, have: 0x9b, conf: 0x2, oneway: true}, - 55: {want: 0x135, have: 0x9b, conf: 0x2, oneway: true}, - 56: {want: 0x13d, have: 0x9b, conf: 0x2, oneway: true}, - 57: {want: 0x145, have: 0x26f, conf: 0x2, oneway: true}, - 58: {want: 0x14d, have: 0x207, conf: 0x2, oneway: true}, - 59: {want: 0x14e, have: 0x103, conf: 0x2, oneway: true}, - 60: {want: 0x15a, have: 0x9b, conf: 0x2, oneway: true}, - 61: {want: 0x164, have: 0xaf, conf: 0x2, oneway: true}, - 62: {want: 0x165, have: 0x9b, conf: 0x2, oneway: true}, - 63: {want: 0x167, have: 0x9b, conf: 0x2, oneway: true}, - 64: {want: 0x16c, have: 0xaf, conf: 0x2, oneway: true}, - 65: {want: 0x182, have: 0x9b, conf: 0x2, oneway: true}, - 66: {want: 0x183, have: 0xaf, conf: 0x2, oneway: true}, - 67: {want: 0x189, have: 0x9b, conf: 0x2, oneway: true}, - 68: {want: 0x18c, have: 0x38, conf: 0x2, oneway: true}, - 69: {want: 0x18d, have: 0x9b, conf: 0x2, oneway: true}, - 70: {want: 0x18f, have: 0x207, conf: 0x2, oneway: true}, - 71: {want: 0x196, have: 0xe1, conf: 0x2, oneway: true}, - 72: {want: 0x19a, have: 0xf8, conf: 0x2, oneway: true}, - 73: {want: 0x19b, have: 0x9b, conf: 0x2, oneway: true}, - 74: {want: 0x1a5, have: 0x9b, conf: 0x2, oneway: true}, - 75: {want: 0x1b4, have: 0x9b, conf: 0x2, oneway: true}, - 76: {want: 0x1bf, have: 0x1af, conf: 0x2, oneway: false}, - 77: {want: 0x1bf, have: 0x1c1, conf: 0x2, oneway: true}, - 78: {want: 0x1c8, have: 0x9b, conf: 0x2, oneway: true}, - 79: {want: 0x1cc, have: 0x9b, conf: 0x2, oneway: true}, - 80: {want: 0x1ce, have: 0x9b, conf: 0x2, oneway: true}, - 81: {want: 0x1d0, have: 0xaf, conf: 0x2, oneway: true}, - 82: {want: 0x1d2, have: 0x9b, conf: 0x2, oneway: true}, - 83: {want: 0x1d3, have: 0x9b, conf: 0x2, oneway: true}, - 84: {want: 0x1d7, have: 0x9b, conf: 0x2, oneway: true}, - 85: {want: 0x1de, have: 0x9b, conf: 0x2, oneway: true}, - 86: {want: 0x1ee, have: 0x9b, conf: 0x2, oneway: true}, - 87: {want: 0x1f1, have: 0x9d, conf: 0x2, oneway: true}, - 88: {want: 0x1fc, have: 0x85, conf: 0x2, oneway: true}, - 89: {want: 0x201, have: 0x9b, conf: 0x2, oneway: true}, - 90: {want: 0x20a, have: 0xaf, conf: 0x2, oneway: true}, - 91: {want: 0x20d, have: 0xe1, conf: 0x2, oneway: true}, - 92: {want: 0x21a, have: 0x9b, conf: 0x2, oneway: true}, - 93: {want: 0x228, have: 0x9b, conf: 0x2, oneway: true}, - 94: {want: 0x236, have: 0x9b, conf: 0x2, oneway: true}, - 95: {want: 0x238, have: 0x9b, conf: 0x2, oneway: true}, - 96: {want: 0x23a, have: 0x9b, conf: 0x2, oneway: true}, - 97: {want: 0x242, have: 0x9b, conf: 0x2, oneway: true}, - 98: {want: 0x244, have: 0xf8, conf: 0x2, oneway: true}, - 99: {want: 0x248, have: 0x9b, conf: 0x2, oneway: true}, - 100: {want: 0x251, have: 0x9b, conf: 0x2, oneway: true}, - 101: {want: 0x258, have: 0x9b, conf: 0x2, oneway: true}, - 102: {want: 0x25c, have: 0x207, conf: 0x2, oneway: true}, - 103: {want: 0x261, have: 0x9b, conf: 0x2, oneway: true}, - 104: {want: 0x264, have: 0x207, conf: 0x2, oneway: true}, - 105: {want: 0x361a, have: 0x9b, conf: 0x2, oneway: true}, - 106: {want: 0x26b, have: 0x9b, conf: 0x2, oneway: true}, - 107: {want: 0x26c, have: 0x9b, conf: 0x2, oneway: true}, - 108: {want: 0x277, have: 0x207, conf: 0x2, oneway: true}, - 109: {want: 0x27b, have: 0x9b, conf: 0x2, oneway: true}, - 110: {want: 0x284, have: 0x2c4, conf: 0x2, oneway: true}, - 111: {want: 0x28c, have: 0x9b, conf: 0x2, oneway: true}, - 112: {want: 0x28d, have: 0x207, conf: 0x2, oneway: true}, - 113: {want: 0x2a4, have: 0xaf, conf: 0x2, oneway: true}, - 114: {want: 0x2a9, have: 0x9b, conf: 0x2, oneway: true}, - 115: {want: 0x2b9, have: 0x9b, conf: 0x2, oneway: true}, - 116: {want: 0x2ba, have: 0x9b, conf: 0x2, oneway: true}, - 117: {want: 0x2c6, have: 0x9b, conf: 0x2, oneway: true}, +// Size: 690 bytes, 115 elements +var matchLang = [115]mutualIntelligibility{ + 0: {want: 0x1cf, have: 0xb7, distance: 0x4, oneway: false}, + 1: {want: 0x405, have: 0xb7, distance: 0x4, oneway: false}, + 2: {want: 0x405, have: 0x1cf, distance: 0x4, oneway: false}, + 3: {want: 0x405, have: 0x430, distance: 0x4, oneway: false}, + 4: {want: 0x438, have: 0x1, distance: 0x4, oneway: false}, + 5: {want: 0x1a1, have: 0x10c, distance: 0x4, oneway: true}, + 6: {want: 0x293, have: 0x10c, distance: 0x4, oneway: true}, + 7: {want: 0x430, have: 0x1cf, distance: 0x5, oneway: false}, + 8: {want: 0x430, have: 0xb7, distance: 0x5, oneway: false}, + 9: {want: 0x100, have: 0x36d, distance: 0x8, oneway: false}, + 10: {want: 0x100, have: 0x345, distance: 0x8, oneway: false}, + 11: {want: 0x5, have: 0x3e0, distance: 0xa, oneway: true}, + 12: {want: 0xd, have: 0x138, distance: 0xa, oneway: true}, + 13: {want: 0x16, have: 0x365, distance: 0xa, oneway: true}, + 14: {want: 0x21, have: 0x138, distance: 0xa, oneway: true}, + 15: {want: 0x56, have: 0x13d, distance: 0xa, oneway: true}, + 16: {want: 0x58, have: 0x3e0, distance: 0xa, oneway: true}, + 17: {want: 0x71, have: 0x3e0, distance: 0xa, oneway: true}, + 18: {want: 0x75, have: 0x138, distance: 0xa, oneway: true}, + 19: {want: 0x82, have: 0x1bc, distance: 0xa, oneway: true}, + 20: {want: 0xa5, have: 0x138, distance: 0xa, oneway: true}, + 21: {want: 0xb2, have: 0x15d, distance: 0xa, oneway: true}, + 22: {want: 0xdd, have: 0x152, distance: 0xa, oneway: true}, + 23: {want: 0xe5, have: 0x138, distance: 0xa, oneway: true}, + 24: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, + 25: {want: 0xef, have: 0x15d, distance: 0xa, oneway: true}, + 26: {want: 0xf8, have: 0x15d, distance: 0xa, oneway: true}, + 27: {want: 0xff, have: 0x138, distance: 0xa, oneway: true}, + 28: {want: 0x12f, have: 0x138, distance: 0xa, oneway: true}, + 29: {want: 0x13b, have: 0x138, distance: 0xa, oneway: true}, + 30: {want: 0x13f, have: 0x150, distance: 0xa, oneway: true}, + 31: {want: 0x144, have: 0x13d, distance: 0xa, oneway: true}, + 32: {want: 0x157, have: 0x100, distance: 0xa, oneway: true}, + 33: {want: 0x16c, have: 0x365, distance: 0xa, oneway: true}, + 34: {want: 0x16d, have: 0x138, distance: 0xa, oneway: true}, + 35: {want: 0x16e, have: 0x138, distance: 0xa, oneway: true}, + 36: {want: 0x17c, have: 0x138, distance: 0xa, oneway: true}, + 37: {want: 0x18e, have: 0x13d, distance: 0xa, oneway: true}, + 38: {want: 0x192, have: 0x13d, distance: 0xa, oneway: true}, + 39: {want: 0x1a2, have: 0x1bc, distance: 0xa, oneway: true}, + 40: {want: 0x1b2, have: 0x138, distance: 0xa, oneway: true}, + 41: {want: 0x1b6, have: 0x138, distance: 0xa, oneway: true}, + 42: {want: 0x1d2, have: 0x15d, distance: 0xa, oneway: true}, + 43: {want: 0x1d5, have: 0x3e0, distance: 0xa, oneway: true}, + 44: {want: 0x1d7, have: 0x138, distance: 0xa, oneway: true}, + 45: {want: 0x1e5, have: 0x138, distance: 0xa, oneway: true}, + 46: {want: 0x1f6, have: 0x138, distance: 0xa, oneway: true}, + 47: {want: 0x20c, have: 0x1df, distance: 0xa, oneway: true}, + 48: {want: 0x20e, have: 0x138, distance: 0xa, oneway: true}, + 49: {want: 0x22b, have: 0x15d, distance: 0xa, oneway: true}, + 50: {want: 0x240, have: 0x3e0, distance: 0xa, oneway: true}, + 51: {want: 0x248, have: 0x138, distance: 0xa, oneway: true}, + 52: {want: 0x24f, have: 0x138, distance: 0xa, oneway: true}, + 53: {want: 0x263, have: 0x138, distance: 0xa, oneway: true}, + 54: {want: 0x272, have: 0x488, distance: 0xa, oneway: true}, + 55: {want: 0x288, have: 0x3e0, distance: 0xa, oneway: true}, + 56: {want: 0x28c, have: 0x1f7, distance: 0xa, oneway: true}, + 57: {want: 0x2a1, have: 0x138, distance: 0xa, oneway: true}, + 58: {want: 0x2b3, have: 0x15d, distance: 0xa, oneway: true}, + 59: {want: 0x2b6, have: 0x138, distance: 0xa, oneway: true}, + 60: {want: 0x2bc, have: 0x138, distance: 0xa, oneway: true}, + 61: {want: 0x2c1, have: 0x15d, distance: 0xa, oneway: true}, + 62: {want: 0x2eb, have: 0x138, distance: 0xa, oneway: true}, + 63: {want: 0x2ef, have: 0x15d, distance: 0xa, oneway: true}, + 64: {want: 0x2f8, have: 0x138, distance: 0xa, oneway: true}, + 65: {want: 0x2fd, have: 0x7e, distance: 0xa, oneway: true}, + 66: {want: 0x302, have: 0x138, distance: 0xa, oneway: true}, + 67: {want: 0x309, have: 0x3e0, distance: 0xa, oneway: true}, + 68: {want: 0x319, have: 0x1bc, distance: 0xa, oneway: true}, + 69: {want: 0x31d, have: 0x1df, distance: 0xa, oneway: true}, + 70: {want: 0x31e, have: 0x138, distance: 0xa, oneway: true}, + 71: {want: 0x32f, have: 0x138, distance: 0xa, oneway: true}, + 72: {want: 0x34f, have: 0x138, distance: 0xa, oneway: true}, + 73: {want: 0x368, have: 0x345, distance: 0xa, oneway: false}, + 74: {want: 0x368, have: 0x36d, distance: 0xa, oneway: true}, + 75: {want: 0x378, have: 0x138, distance: 0xa, oneway: true}, + 76: {want: 0x385, have: 0x138, distance: 0xa, oneway: true}, + 77: {want: 0x387, have: 0x138, distance: 0xa, oneway: true}, + 78: {want: 0x389, have: 0x15d, distance: 0xa, oneway: true}, + 79: {want: 0x38e, have: 0x138, distance: 0xa, oneway: true}, + 80: {want: 0x393, have: 0x138, distance: 0xa, oneway: true}, + 81: {want: 0x39b, have: 0x138, distance: 0xa, oneway: true}, + 82: {want: 0x3a3, have: 0x138, distance: 0xa, oneway: true}, + 83: {want: 0x3bc, have: 0x138, distance: 0xa, oneway: true}, + 84: {want: 0x3c2, have: 0x13d, distance: 0xa, oneway: true}, + 85: {want: 0x3d2, have: 0x10c, distance: 0xa, oneway: true}, + 86: {want: 0x3d7, have: 0x138, distance: 0xa, oneway: true}, + 87: {want: 0x3e3, have: 0x15d, distance: 0xa, oneway: true}, + 88: {want: 0x3e7, have: 0x1bc, distance: 0xa, oneway: true}, + 89: {want: 0x3f8, have: 0x138, distance: 0xa, oneway: true}, + 90: {want: 0x40a, have: 0x138, distance: 0xa, oneway: true}, + 91: {want: 0x421, have: 0x138, distance: 0xa, oneway: true}, + 92: {want: 0x427, have: 0x138, distance: 0xa, oneway: true}, + 93: {want: 0x42f, have: 0x138, distance: 0xa, oneway: true}, + 94: {want: 0x439, have: 0x138, distance: 0xa, oneway: true}, + 95: {want: 0x43c, have: 0x1df, distance: 0xa, oneway: true}, + 96: {want: 0x443, have: 0x138, distance: 0xa, oneway: true}, + 97: {want: 0x44e, have: 0x138, distance: 0xa, oneway: true}, + 98: {want: 0x45f, have: 0x138, distance: 0xa, oneway: true}, + 99: {want: 0x465, have: 0x3e0, distance: 0xa, oneway: true}, + 100: {want: 0x46d, have: 0x138, distance: 0xa, oneway: true}, + 101: {want: 0x474, have: 0x3e0, distance: 0xa, oneway: true}, + 102: {want: 0x3880, have: 0x138, distance: 0xa, oneway: true}, + 103: {want: 0x47e, have: 0x138, distance: 0xa, oneway: true}, + 104: {want: 0x480, have: 0x138, distance: 0xa, oneway: true}, + 105: {want: 0x492, have: 0x3e0, distance: 0xa, oneway: true}, + 106: {want: 0x49b, have: 0x138, distance: 0xa, oneway: true}, + 107: {want: 0x4aa, have: 0x527, distance: 0xa, oneway: true}, + 108: {want: 0x4b2, have: 0x138, distance: 0xa, oneway: true}, + 109: {want: 0x4ba, have: 0x3e0, distance: 0xa, oneway: true}, + 110: {want: 0x4e3, have: 0x15d, distance: 0xa, oneway: true}, + 111: {want: 0x4f0, have: 0x138, distance: 0xa, oneway: true}, + 112: {want: 0x510, have: 0x138, distance: 0xa, oneway: true}, + 113: {want: 0x516, have: 0x138, distance: 0xa, oneway: true}, + 114: {want: 0x52c, have: 0x138, distance: 0xa, oneway: true}, } // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. -// Size: 24 bytes, 4 elements -var matchScript = [4]scriptIntelligibility{ - 0: {lang: 0x23b, want: 0x52, have: 0x1e, conf: 0x2}, - 1: {lang: 0x23b, want: 0x1e, have: 0x52, conf: 0x2}, - 2: {lang: 0x0, want: 0x34, have: 0x35, conf: 0x1}, - 3: {lang: 0x0, want: 0x35, have: 0x34, conf: 0x1}, +// Size: 208 bytes, 26 elements +var matchScript = [26]scriptIntelligibility{ + 0: {wantLang: 0x430, haveLang: 0x430, wantScript: 0x52, haveScript: 0x1e, distance: 0x5}, + 1: {wantLang: 0x430, haveLang: 0x430, wantScript: 0x1e, haveScript: 0x52, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e0, wantScript: 0x52, haveScript: 0x1e, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x138, wantScript: 0xe, haveScript: 0x52, distance: 0xa}, + 4: {wantLang: 0x1d5, haveLang: 0x3e0, wantScript: 0x8, haveScript: 0x1e, distance: 0xa}, + 5: {wantLang: 0x20e, haveLang: 0x138, wantScript: 0x29, haveScript: 0x52, distance: 0xa}, + 6: {wantLang: 0x248, haveLang: 0x138, wantScript: 0x46, haveScript: 0x52, distance: 0xa}, + 7: {wantLang: 0x24f, haveLang: 0x138, wantScript: 0x4a, haveScript: 0x52, distance: 0xa}, + 8: {wantLang: 0x2b6, haveLang: 0x138, wantScript: 0x4f, haveScript: 0x52, distance: 0xa}, + 9: {wantLang: 0x302, haveLang: 0x138, wantScript: 0x64, haveScript: 0x52, distance: 0xa}, + 10: {wantLang: 0x32f, haveLang: 0x138, wantScript: 0x6b, haveScript: 0x52, distance: 0xa}, + 11: {wantLang: 0x34f, haveLang: 0x138, wantScript: 0x20, haveScript: 0x52, distance: 0xa}, + 12: {wantLang: 0x393, haveLang: 0x138, wantScript: 0x75, haveScript: 0x52, distance: 0xa}, + 13: {wantLang: 0x39b, haveLang: 0x138, wantScript: 0x2f, haveScript: 0x52, distance: 0xa}, + 14: {wantLang: 0x3bc, haveLang: 0x138, wantScript: 0x5, haveScript: 0x52, distance: 0xa}, + 15: {wantLang: 0x3f8, haveLang: 0x138, wantScript: 0x5, haveScript: 0x52, distance: 0xa}, + 16: {wantLang: 0x40a, haveLang: 0x138, wantScript: 0xc1, haveScript: 0x52, distance: 0xa}, + 17: {wantLang: 0x44e, haveLang: 0x138, wantScript: 0xcd, haveScript: 0x52, distance: 0xa}, + 18: {wantLang: 0x45f, haveLang: 0x138, wantScript: 0xd0, haveScript: 0x52, distance: 0xa}, + 19: {wantLang: 0x46d, haveLang: 0x138, wantScript: 0x27, haveScript: 0x52, distance: 0xa}, + 20: {wantLang: 0x474, haveLang: 0x3e0, wantScript: 0x52, haveScript: 0x1e, distance: 0xa}, + 21: {wantLang: 0x4b2, haveLang: 0x138, wantScript: 0x5, haveScript: 0x52, distance: 0xa}, + 22: {wantLang: 0x4ba, haveLang: 0x3e0, wantScript: 0x52, haveScript: 0x1e, distance: 0xa}, + 23: {wantLang: 0x510, haveLang: 0x138, wantScript: 0x37, haveScript: 0x52, distance: 0xa}, + 24: {wantLang: 0x527, haveLang: 0x527, wantScript: 0x34, haveScript: 0x35, distance: 0xf}, + 25: {wantLang: 0x527, haveLang: 0x527, wantScript: 0x35, haveScript: 0x34, distance: 0x13}, +} + +// Size: 90 bytes, 15 elements +var matchRegion = [15]regionIntelligibility{ + 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, + 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, + 2: {lang: 0x138, script: 0x0, group: 0x1, distance: 0x4}, + 3: {lang: 0x138, script: 0x0, group: 0x81, distance: 0x4}, + 4: {lang: 0x13d, script: 0x0, group: 0x3, distance: 0x4}, + 5: {lang: 0x13d, script: 0x0, group: 0x83, distance: 0x4}, + 6: {lang: 0x3be, script: 0x0, group: 0x3, distance: 0x4}, + 7: {lang: 0x3be, script: 0x0, group: 0x83, distance: 0x4}, + 8: {lang: 0x527, script: 0x35, group: 0x2, distance: 0x4}, + 9: {lang: 0x527, script: 0x35, group: 0x82, distance: 0x4}, + 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, + 11: {lang: 0x138, script: 0x0, group: 0x80, distance: 0x5}, + 12: {lang: 0x13d, script: 0x0, group: 0x80, distance: 0x5}, + 13: {lang: 0x3be, script: 0x0, group: 0x80, distance: 0x5}, + 14: {lang: 0x527, script: 0x35, group: 0x80, distance: 0x5}, } // Size: 128 bytes, 32 elements @@ -2671,8 +3534,8 @@ var regionContainment = [32]uint32{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 355 bytes, 355 elements -var regionInclusion = [355]uint8{ +// Size: 357 bytes, 357 elements +var regionInclusion = [357]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -2689,41 +3552,41 @@ var regionInclusion = [355]uint8{ 0x25, 0x2c, 0x25, 0x21, 0x36, 0x2d, 0x34, 0x29, 0x21, 0x2e, 0x37, 0x25, 0x25, 0x20, 0x38, 0x38, 0x27, 0x37, 0x38, 0x38, 0x2e, 0x39, 0x2e, 0x1f, - 0x37, 0x3a, 0x27, 0x3b, 0x2b, 0x20, 0x29, 0x34, - 0x26, 0x37, 0x25, 0x23, 0x27, 0x2b, 0x2c, 0x22, + 0x20, 0x37, 0x3a, 0x27, 0x3b, 0x2b, 0x20, 0x29, + 0x34, 0x26, 0x37, 0x25, 0x23, 0x27, 0x2b, 0x2c, // Entry 80 - BF - 0x2f, 0x2c, 0x2c, 0x25, 0x26, 0x39, 0x21, 0x33, - 0x3b, 0x2c, 0x27, 0x35, 0x21, 0x33, 0x39, 0x25, - 0x2d, 0x20, 0x38, 0x30, 0x37, 0x23, 0x2b, 0x24, - 0x21, 0x23, 0x24, 0x2b, 0x39, 0x2b, 0x25, 0x23, - 0x35, 0x20, 0x2e, 0x3c, 0x30, 0x3b, 0x2e, 0x25, - 0x35, 0x35, 0x23, 0x25, 0x3c, 0x30, 0x23, 0x25, - 0x34, 0x24, 0x2c, 0x31, 0x37, 0x29, 0x37, 0x38, - 0x38, 0x34, 0x32, 0x22, 0x25, 0x2e, 0x3b, 0x20, + 0x22, 0x2f, 0x2c, 0x2c, 0x25, 0x26, 0x39, 0x21, + 0x33, 0x3b, 0x2c, 0x27, 0x35, 0x21, 0x33, 0x39, + 0x25, 0x2d, 0x20, 0x38, 0x30, 0x37, 0x23, 0x2b, + 0x24, 0x21, 0x23, 0x24, 0x2b, 0x39, 0x2b, 0x25, + 0x23, 0x35, 0x20, 0x2e, 0x3c, 0x30, 0x3b, 0x2e, + 0x25, 0x35, 0x35, 0x23, 0x25, 0x3c, 0x30, 0x23, + 0x25, 0x34, 0x24, 0x2c, 0x31, 0x37, 0x29, 0x37, + 0x38, 0x38, 0x34, 0x32, 0x22, 0x25, 0x2e, 0x3b, // Entry C0 - FF - 0x22, 0x2c, 0x30, 0x35, 0x35, 0x3b, 0x25, 0x2c, - 0x25, 0x39, 0x2e, 0x24, 0x2e, 0x33, 0x30, 0x2e, - 0x31, 0x3a, 0x2c, 0x2a, 0x2c, 0x20, 0x33, 0x29, - 0x2b, 0x24, 0x20, 0x3b, 0x23, 0x28, 0x2a, 0x23, - 0x33, 0x20, 0x27, 0x28, 0x3a, 0x30, 0x24, 0x2d, - 0x2f, 0x28, 0x25, 0x23, 0x39, 0x20, 0x3b, 0x27, - 0x20, 0x23, 0x20, 0x20, 0x1e, 0x20, 0x20, 0x20, + 0x20, 0x22, 0x2c, 0x30, 0x35, 0x35, 0x3b, 0x25, + 0x2c, 0x25, 0x39, 0x2e, 0x24, 0x2e, 0x33, 0x30, + 0x2e, 0x31, 0x3a, 0x2c, 0x2a, 0x2c, 0x20, 0x33, + 0x29, 0x2b, 0x24, 0x20, 0x3b, 0x23, 0x28, 0x2a, + 0x23, 0x33, 0x20, 0x27, 0x28, 0x3a, 0x30, 0x24, + 0x2d, 0x2f, 0x28, 0x25, 0x23, 0x39, 0x20, 0x3b, + 0x27, 0x20, 0x23, 0x20, 0x20, 0x1e, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, // Entry 100 - 13F - 0x2e, 0x20, 0x2d, 0x22, 0x32, 0x2e, 0x23, 0x3a, - 0x2e, 0x38, 0x37, 0x30, 0x2c, 0x39, 0x2b, 0x2d, - 0x2c, 0x22, 0x2c, 0x2e, 0x27, 0x2e, 0x26, 0x32, - 0x33, 0x25, 0x23, 0x31, 0x21, 0x25, 0x26, 0x21, - 0x2c, 0x30, 0x3c, 0x28, 0x30, 0x3c, 0x38, 0x28, - 0x30, 0x23, 0x25, 0x28, 0x35, 0x2e, 0x32, 0x2e, - 0x20, 0x21, 0x2f, 0x27, 0x3c, 0x22, 0x25, 0x20, - 0x27, 0x25, 0x25, 0x30, 0x3a, 0x28, 0x20, 0x28, + 0x20, 0x2e, 0x20, 0x2d, 0x22, 0x32, 0x2e, 0x23, + 0x3a, 0x2e, 0x38, 0x37, 0x30, 0x2c, 0x39, 0x2b, + 0x2d, 0x2c, 0x22, 0x2c, 0x2e, 0x27, 0x2e, 0x26, + 0x32, 0x33, 0x25, 0x23, 0x31, 0x21, 0x25, 0x26, + 0x21, 0x2c, 0x30, 0x3c, 0x28, 0x30, 0x3c, 0x38, + 0x28, 0x30, 0x23, 0x25, 0x28, 0x35, 0x2e, 0x32, + 0x2e, 0x20, 0x21, 0x20, 0x2f, 0x27, 0x3c, 0x22, + 0x25, 0x20, 0x27, 0x25, 0x25, 0x30, 0x3a, 0x28, // Entry 140 - 17F + 0x20, 0x28, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, + 0x20, 0x20, 0x20, 0x20, 0x22, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, - 0x20, 0x20, 0x22, 0x20, 0x20, 0x20, 0x20, 0x20, - 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, - 0x20, 0x20, 0x23, 0x23, 0x2e, 0x22, 0x31, 0x2e, - 0x26, 0x2e, 0x20, + 0x20, 0x20, 0x20, 0x20, 0x23, 0x23, 0x2e, 0x22, + 0x31, 0x2e, 0x26, 0x2e, 0x20, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -2779,13 +3642,13 @@ type parentRel struct { fromRegion []uint16 } -// Size: 412 bytes, 5 elements +// Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x9b, script: 0x0, maxScript: 0x52, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x24, 0x25, 0x2e, 0x33, 0x35, 0x3c, 0x41, 0x45, 0x47, 0x48, 0x49, 0x4f, 0x51, 0x5b, 0x5c, 0x60, 0x63, 0x6c, 0x71, 0x72, 0x73, 0x79, 0x7a, 0x7d, 0x7e, 0x7f, 0x81, 0x8a, 0x8b, 0x94, 0x95, 0x96, 0x97, 0x98, 0x9d, 0x9e, 0xa2, 0xa5, 0xa7, 0xab, 0xaf, 0xb2, 0xb3, 0xbd, 0xc4, 0xc8, 0xc9, 0xca, 0xcc, 0xce, 0xd0, 0xd3, 0xd4, 0xdb, 0xdd, 0xde, 0xe4, 0xe5, 0xe6, 0xe9, 0xee, 0x105, 0x107, 0x108, 0x109, 0x10b, 0x10c, 0x110, 0x115, 0x119, 0x11b, 0x11d, 0x123, 0x127, 0x12a, 0x12b, 0x12d, 0x12f, 0x136, 0x139, 0x13c, 0x13f, 0x15e, 0x15f, 0x161}}, - 1: {lang: 0x9b, script: 0x0, maxScript: 0x52, toRegion: 0x1a, fromRegion: []uint16{0x2d, 0x4d, 0x5f, 0x62, 0x70, 0xd7, 0x10a, 0x10d}}, - 2: {lang: 0x9d, script: 0x0, maxScript: 0x52, toRegion: 0x1e, fromRegion: []uint16{0x2b, 0x3e, 0x40, 0x50, 0x53, 0x55, 0x58, 0x64, 0x68, 0x87, 0x8d, 0xcd, 0xd6, 0xe0, 0xe2, 0xea, 0xef, 0x118, 0x132, 0x133, 0x138}}, - 3: {lang: 0x1ef, script: 0x0, maxScript: 0x52, toRegion: 0xec, fromRegion: []uint16{0x29, 0x4d, 0x59, 0x84, 0x89, 0xb5, 0xc4, 0xcf, 0x116, 0x124}}, - 4: {lang: 0x2c4, script: 0x35, maxScript: 0x35, toRegion: 0x8b, fromRegion: []uint16{0xc4}}, + 0: {lang: 0x138, script: 0x0, maxScript: 0x52, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x24, 0x25, 0x2e, 0x33, 0x35, 0x3c, 0x41, 0x45, 0x47, 0x48, 0x49, 0x4f, 0x51, 0x5b, 0x5c, 0x60, 0x63, 0x6c, 0x72, 0x73, 0x74, 0x7a, 0x7b, 0x7e, 0x7f, 0x80, 0x82, 0x8b, 0x8c, 0x95, 0x96, 0x97, 0x98, 0x99, 0x9e, 0x9f, 0xa3, 0xa6, 0xa8, 0xac, 0xb0, 0xb3, 0xb4, 0xbe, 0xc5, 0xc9, 0xca, 0xcb, 0xcd, 0xcf, 0xd1, 0xd4, 0xd5, 0xdc, 0xde, 0xdf, 0xe5, 0xe6, 0xe7, 0xea, 0xef, 0x106, 0x108, 0x109, 0x10a, 0x10c, 0x10d, 0x111, 0x116, 0x11a, 0x11c, 0x11e, 0x124, 0x128, 0x12b, 0x12c, 0x12e, 0x130, 0x138, 0x13b, 0x13e, 0x141, 0x160, 0x161, 0x163}}, + 1: {lang: 0x138, script: 0x0, maxScript: 0x52, toRegion: 0x1a, fromRegion: []uint16{0x2d, 0x4d, 0x5f, 0x62, 0x71, 0xd8, 0x10b, 0x10e}}, + 2: {lang: 0x13d, script: 0x0, maxScript: 0x52, toRegion: 0x1e, fromRegion: []uint16{0x2b, 0x3e, 0x40, 0x47, 0x50, 0x53, 0x55, 0x58, 0x64, 0x68, 0x88, 0x8e, 0xce, 0xd7, 0xe1, 0xe3, 0xeb, 0xf0, 0x119, 0x134, 0x135, 0x13a}}, + 3: {lang: 0x3be, script: 0x0, maxScript: 0x52, toRegion: 0xed, fromRegion: []uint16{0x29, 0x4d, 0x59, 0x85, 0x8a, 0xb6, 0xc5, 0xd0, 0x117, 0x125}}, + 4: {lang: 0x527, script: 0x35, maxScript: 0x35, toRegion: 0x8c, fromRegion: []uint16{0xc5}}, } -// Total table size 20315 bytes (19KiB); checksum: C16EF251 +// Total table size 26496 bytes (25KiB); checksum: 6E24B15A diff --git a/vendor/golang.org/x/text/runes/cond.go b/vendor/golang.org/x/text/runes/cond.go index ae7a921585b..df7aa02db6d 100644 --- a/vendor/golang.org/x/text/runes/cond.go +++ b/vendor/golang.org/x/text/runes/cond.go @@ -41,20 +41,35 @@ func If(s Set, tIn, tNotIn transform.Transformer) Transformer { if tNotIn == nil { tNotIn = transform.Nop } + sIn, ok := tIn.(transform.SpanningTransformer) + if !ok { + sIn = dummySpan{tIn} + } + sNotIn, ok := tNotIn.(transform.SpanningTransformer) + if !ok { + sNotIn = dummySpan{tNotIn} + } + a := &cond{ - tIn: tIn, - tNotIn: tNotIn, + tIn: sIn, + tNotIn: sNotIn, f: s.Contains, } a.Reset() return Transformer{a} } +type dummySpan struct{ transform.Transformer } + +func (d dummySpan) Span(src []byte, atEOF bool) (n int, err error) { + return 0, transform.ErrEndOfSpan +} + type cond struct { - tIn, tNotIn transform.Transformer + tIn, tNotIn transform.SpanningTransformer f func(rune) bool - check func(rune) bool // current check to perform - t transform.Transformer // current transformer to use + check func(rune) bool // current check to perform + t transform.SpanningTransformer // current transformer to use } // Reset implements transform.Transformer. @@ -84,6 +99,51 @@ func (t *cond) isNot(r rune) bool { return false } +// This implementation of Span doesn't help all too much, but it needs to be +// there to satisfy this package's Transformer interface. +// TODO: there are certainly room for improvements, though. For example, if +// t.t == transform.Nop (which will a common occurrence) it will save a bundle +// to special-case that loop. +func (t *cond) Span(src []byte, atEOF bool) (n int, err error) { + p := 0 + for n < len(src) && err == nil { + // Don't process too much at a time as the Spanner that will be + // called on this block may terminate early. + const maxChunk = 4096 + max := len(src) + if v := n + maxChunk; v < max { + max = v + } + atEnd := false + size := 0 + current := t.t + for ; p < max; p += size { + r := rune(src[p]) + if r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[p:]); size == 1 { + if !atEOF && !utf8.FullRune(src[p:]) { + err = transform.ErrShortSrc + break + } + } + if !t.check(r) { + // The next rune will be the start of a new run. + atEnd = true + break + } + } + n2, err2 := current.Span(src[n:p], atEnd || (atEOF && p == len(src))) + n += n2 + if err2 != nil { + return n, err2 + } + // At this point either err != nil or t.check will pass for the rune at p. + p = n + size + } + return n, err +} + func (t *cond) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { p := 0 for nSrc < len(src) && err == nil { @@ -99,9 +159,10 @@ func (t *cond) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error size := 0 current := t.t for ; p < max; p += size { - var r rune - r, size = utf8.DecodeRune(src[p:]) - if r == utf8.RuneError && size == 1 { + r := rune(src[p]) + if r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[p:]); size == 1 { if !atEOF && !utf8.FullRune(src[p:]) { err = transform.ErrShortSrc break diff --git a/vendor/golang.org/x/text/runes/runes.go b/vendor/golang.org/x/text/runes/runes.go index 291de656b27..6a3195cf3d2 100644 --- a/vendor/golang.org/x/text/runes/runes.go +++ b/vendor/golang.org/x/text/runes/runes.go @@ -46,9 +46,19 @@ func Predicate(f func(rune) bool) Set { // Transformer implements the transform.Transformer interface. type Transformer struct { - transform.Transformer + t transform.SpanningTransformer } +func (t Transformer) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + return t.t.Transform(dst, src, atEOF) +} + +func (t Transformer) Span(b []byte, atEOF bool) (n int, err error) { + return t.t.Span(b, atEOF) +} + +func (t Transformer) Reset() { t.t.Reset() } + // Bytes returns a new byte slice with the result of converting b using t. It // calls Reset on t. It returns nil if any error was found. This can only happen // if an error-producing Transformer is passed to If. @@ -96,39 +106,57 @@ type remove func(r rune) bool func (remove) Reset() {} +// Span implements transform.Spanner. +func (t remove) Span(src []byte, atEOF bool) (n int, err error) { + for r, size := rune(0), 0; n < len(src); { + if r = rune(src[n]); r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[n:]); size == 1 { + // Invalid rune. + if !atEOF && !utf8.FullRune(src[n:]) { + err = transform.ErrShortSrc + } else { + err = transform.ErrEndOfSpan + } + break + } + if t(r) { + err = transform.ErrEndOfSpan + break + } + n += size + } + return +} + // Transform implements transform.Transformer. func (t remove) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { for r, size := rune(0), 0; nSrc < len(src); { if r = rune(src[nSrc]); r < utf8.RuneSelf { size = 1 - } else { - r, size = utf8.DecodeRune(src[nSrc:]) - - if size == 1 { - // Invalid rune. - if !atEOF && !utf8.FullRune(src[nSrc:]) { - err = transform.ErrShortSrc + } else if r, size = utf8.DecodeRune(src[nSrc:]); size == 1 { + // Invalid rune. + if !atEOF && !utf8.FullRune(src[nSrc:]) { + err = transform.ErrShortSrc + break + } + // We replace illegal bytes with RuneError. Not doing so might + // otherwise turn a sequence of invalid UTF-8 into valid UTF-8. + // The resulting byte sequence may subsequently contain runes + // for which t(r) is true that were passed unnoticed. + if !t(utf8.RuneError) { + if nDst+3 > len(dst) { + err = transform.ErrShortDst break } - // We replace illegal bytes with RuneError. Not doing so might - // otherwise turn a sequence of invalid UTF-8 into valid UTF-8. - // The resulting byte sequence may subsequently contain runes - // for which t(r) is true that were passed unnoticed. - if !t(utf8.RuneError) { - if nDst+3 > len(dst) { - err = transform.ErrShortDst - break - } - dst[nDst+0] = runeErrorString[0] - dst[nDst+1] = runeErrorString[1] - dst[nDst+2] = runeErrorString[2] - nDst += 3 - } - nSrc++ - continue + dst[nDst+0] = runeErrorString[0] + dst[nDst+1] = runeErrorString[1] + dst[nDst+2] = runeErrorString[2] + nDst += 3 } + nSrc++ + continue } - if t(r) { nSrc += size continue @@ -157,6 +185,28 @@ type mapper func(rune) rune func (mapper) Reset() {} +// Span implements transform.Spanner. +func (t mapper) Span(src []byte, atEOF bool) (n int, err error) { + for r, size := rune(0), 0; n < len(src); n += size { + if r = rune(src[n]); r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[n:]); size == 1 { + // Invalid rune. + if !atEOF && !utf8.FullRune(src[n:]) { + err = transform.ErrShortSrc + } else { + err = transform.ErrEndOfSpan + } + break + } + if t(r) != r { + err = transform.ErrEndOfSpan + break + } + } + return n, err +} + // Transform implements transform.Transformer. func (t mapper) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { var replacement rune @@ -230,24 +280,51 @@ func ReplaceIllFormed() Transformer { type replaceIllFormed struct{ transform.NopResetter } +func (t replaceIllFormed) Span(src []byte, atEOF bool) (n int, err error) { + for n < len(src) { + // ASCII fast path. + if src[n] < utf8.RuneSelf { + n++ + continue + } + + r, size := utf8.DecodeRune(src[n:]) + + // Look for a valid non-ASCII rune. + if r != utf8.RuneError || size != 1 { + n += size + continue + } + + // Look for short source data. + if !atEOF && !utf8.FullRune(src[n:]) { + err = transform.ErrShortSrc + break + } + + // We have an invalid rune. + err = transform.ErrEndOfSpan + break + } + return n, err +} + func (t replaceIllFormed) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { for nSrc < len(src) { - r, size := utf8.DecodeRune(src[nSrc:]) - - // Look for an ASCII rune. - if r < utf8.RuneSelf { + // ASCII fast path. + if r := src[nSrc]; r < utf8.RuneSelf { if nDst == len(dst) { err = transform.ErrShortDst break } - dst[nDst] = byte(r) + dst[nDst] = r nDst++ nSrc++ continue } // Look for a valid non-ASCII rune. - if r != utf8.RuneError || size != 1 { + if _, size := utf8.DecodeRune(src[nSrc:]); size != 1 { if size != copy(dst[nDst:], src[nSrc:nSrc+size]) { err = transform.ErrShortDst break diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule.go b/vendor/golang.org/x/text/secure/bidirule/bidirule.go index 277257fd791..a7161bdd9b6 100644 --- a/vendor/golang.org/x/text/secure/bidirule/bidirule.go +++ b/vendor/golang.org/x/text/secure/bidirule/bidirule.go @@ -123,34 +123,64 @@ var transitions = [...][2]ruleTransition{ // vice versa. const exclusiveRTL = uint16(1<>2) + } + span := append(b.buf[x][:0], b.src[:n]...) + b.src, _, err = transform.Append(t, span, b.src[n:]) b.buf[x] = b.src b.next++ return err } -func (b *buffers) enforce(p *Profile, src []byte) (str []byte, err error) { +// Pre-allocate transformers when possible. In some cases this avoids allocation. +var ( + foldWidthT transform.SpanningTransformer = width.Fold + lowerCaseT transform.SpanningTransformer = cases.Lower(language.Und, cases.HandleFinalSigma(false)) +) + +// TODO: make this a method on profile. + +func (b *buffers) enforce(p *Profile, src []byte, comparing bool) (str []byte, err error) { b.src = src + ascii := true + for _, c := range src { + if c >= utf8.RuneSelf { + ascii = false + break + } + } + // ASCII fast path. + if ascii { + for _, f := range p.options.additional { + if err = b.apply(f()); err != nil { + return nil, err + } + } + switch { + case p.options.asciiLower || (comparing && p.options.ignorecase): + for i, c := range b.src { + if 'A' <= c && c <= 'Z' { + b.src[i] = c ^ 1<<5 + } + } + case p.options.cases != nil: + b.apply(p.options.cases) + } + c := checker{p: p} + if _, err := c.span(b.src, true); err != nil { + return nil, err + } + if p.disallow != nil { + for _, c := range b.src { + if p.disallow.Contains(rune(c)) { + return nil, errDisallowedRune + } + } + } + if p.options.disallowEmpty && len(b.src) == 0 { + return nil, errEmptyString + } + return b.src, nil + } + // These transforms are applied in the order defined in // https://tools.ietf.org/html/rfc7564#section-7 // TODO: allow different width transforms options. - if p.options.foldWidth { - // TODO: use Span, once available. - if err = b.apply(width.Fold); err != nil { - return nil, err - } + if p.options.foldWidth || (p.options.ignorecase && comparing) { + b.apply(foldWidthT) } for _, f := range p.options.additional { if err = b.apply(f()); err != nil { @@ -123,24 +174,14 @@ func (b *buffers) enforce(p *Profile, src []byte) (str []byte, err error) { } } if p.options.cases != nil { - if err = b.apply(p.options.cases); err != nil { - return nil, err - } + b.apply(p.options.cases) } - if n := p.norm.QuickSpan(b.src); n < len(b.src) { - x := b.next & 1 - n = copy(b.buf[x], b.src[:n]) - b.src, _, err = transform.Append(p.norm, b.buf[x][:n], b.src[n:]) - b.buf[x] = b.src - b.next++ - if err != nil { - return nil, err - } + if comparing && p.options.ignorecase { + b.apply(lowerCaseT) } - if p.options.bidiRule { - if err := b.apply(bidirule.New()); err != nil { - return nil, err - } + b.apply(p.norm) + if p.options.bidiRule && !bidirule.Valid(b.src) { + return nil, bidirule.ErrInvalid } c := checker{p: p} if _, err := c.span(b.src, true); err != nil { @@ -155,9 +196,6 @@ func (b *buffers) enforce(p *Profile, src []byte) (str []byte, err error) { i += size } } - - // TODO: Add the disallow empty rule with a dummy transformer? - if p.options.disallowEmpty && len(b.src) == 0 { return nil, errEmptyString } @@ -168,19 +206,16 @@ func (b *buffers) enforce(p *Profile, src []byte) (str []byte, err error) { // It returns an error if the input string is invalid. func (p *Profile) Append(dst, src []byte) ([]byte, error) { var buf buffers - buf.init(8 + len(src) + len(src)>>2) - b, err := buf.enforce(p, src) + b, err := buf.enforce(p, src, false) if err != nil { return nil, err } return append(dst, b...), nil } -// Bytes returns a new byte slice with the result of applying the profile to b. -func (p *Profile) Bytes(b []byte) ([]byte, error) { +func processBytes(p *Profile, b []byte, key bool) ([]byte, error) { var buf buffers - buf.init(8 + len(b) + len(b)>>2) - b, err := buf.enforce(p, b) + b, err := buf.enforce(p, b, key) if err != nil { return nil, err } @@ -192,39 +227,62 @@ func (p *Profile) Bytes(b []byte) ([]byte, error) { return b, nil } -// String returns a string with the result of applying the profile to s. -func (p *Profile) String(s string) (string, error) { +// Bytes returns a new byte slice with the result of applying the profile to b. +func (p *Profile) Bytes(b []byte) ([]byte, error) { + return processBytes(p, b, false) +} + +// AppendCompareKey appends the result of applying p to src (including any +// optional rules to make strings comparable or useful in a map key such as +// applying lowercasing) writing the result to dst. It returns an error if the +// input string is invalid. +func (p *Profile) AppendCompareKey(dst, src []byte) ([]byte, error) { var buf buffers - buf.init(8 + len(s) + len(s)>>2) - b, err := buf.enforce(p, []byte(s)) + b, err := buf.enforce(p, src, true) + if err != nil { + return nil, err + } + return append(dst, b...), nil +} + +func processString(p *Profile, s string, key bool) (string, error) { + var buf buffers + b, err := buf.enforce(p, []byte(s), key) if err != nil { return "", err } return string(b), nil } +// String returns a string with the result of applying the profile to s. +func (p *Profile) String(s string) (string, error) { + return processString(p, s, false) +} + +// CompareKey returns a string that can be used for comparison, hashing, or +// collation. +func (p *Profile) CompareKey(s string) (string, error) { + return processString(p, s, true) +} + // Compare enforces both strings, and then compares them for bit-string identity // (byte-for-byte equality). If either string cannot be enforced, the comparison // is false. func (p *Profile) Compare(a, b string) bool { - a, err := p.String(a) - if err != nil { - return false - } - b, err = p.String(b) + var buf buffers + + akey, err := buf.enforce(p, []byte(a), true) if err != nil { return false } - // TODO: This is out of order. Need to extract the transformation logic and - // put this in where the normal case folding would go (but only for - // comparison). - if p.options.ignorecase { - a = width.Fold.String(a) - b = width.Fold.String(a) + buf = buffers{} + bkey, err := buf.enforce(p, []byte(b), true) + if err != nil { + return false } - return a == b + return bytes.Compare(akey, bkey) == 0 } // Allowed returns a runes.Set containing every rune that is a member of the @@ -264,33 +322,35 @@ func (c *checker) span(src []byte, atEOF bool) (n int, err error) { } return n, errDisallowedRune } + doLookAhead := false if property(e) < c.p.class.validFrom { if d.rule == nil { return n, errDisallowedRune } - doLookAhead, err := d.rule(c.beforeBits) + doLookAhead, err = d.rule(c.beforeBits) if err != nil { return n, err } - if doLookAhead { - c.beforeBits &= d.keep - c.beforeBits |= d.set - // We may still have a lookahead rule which we will require to - // complete (by checking termBits == 0) before setting the new - // bits. - if c.termBits != 0 && (!c.checkLookahead() || c.termBits == 0) { - return n, err - } - c.termBits = d.term - c.acceptBits = d.accept - n += sz - continue - } } c.beforeBits &= d.keep c.beforeBits |= d.set - if c.termBits != 0 && !c.checkLookahead() { - return n, errContext + if c.termBits != 0 { + // We are currently in an unterminated lookahead. + if c.beforeBits&c.termBits != 0 { + c.termBits = 0 + c.acceptBits = 0 + } else if c.beforeBits&c.acceptBits == 0 { + // Invalid continuation of the unterminated lookahead sequence. + return n, errContext + } + } + if doLookAhead { + if c.termBits != 0 { + // A previous lookahead run has not been terminated yet. + return n, errContext + } + c.termBits = d.term + c.acceptBits = d.accept } n += sz } @@ -300,18 +360,6 @@ func (c *checker) span(src []byte, atEOF bool) (n int, err error) { return n, err } -func (c *checker) checkLookahead() bool { - switch { - case c.beforeBits&c.termBits != 0: - c.termBits = 0 - c.acceptBits = 0 - case c.beforeBits&c.acceptBits != 0: - default: - return false - } - return true -} - // TODO: we may get rid of this transform if transform.Chain understands // something like a Spanner interface. func (c checker) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { diff --git a/vendor/golang.org/x/text/secure/precis/profiles.go b/vendor/golang.org/x/text/secure/precis/profiles.go index ad50ae857d6..86010025c95 100644 --- a/vendor/golang.org/x/text/secure/precis/profiles.go +++ b/vendor/golang.org/x/text/secure/precis/profiles.go @@ -13,44 +13,66 @@ import ( ) var ( - Nickname *Profile = nickname // Implements the Nickname profile specified in RFC 7700. - UsernameCaseMapped *Profile = usernameCaseMap // Implements the UsernameCaseMapped profile specified in RFC 7613. - UsernameCasePreserved *Profile = usernameNoCaseMap // Implements the UsernameCasePreserved profile specified in RFC 7613. - OpaqueString *Profile = opaquestring // Implements the OpaqueString profile defined in RFC 7613 for passwords and other secure labels. + // Implements the Nickname profile specified in RFC 7700. + // The nickname profile is not idempotent and may need to be applied multiple + // times before being used for comparisons. + Nickname *Profile = nickname + + // Implements the UsernameCaseMapped profile specified in RFC 7613. + UsernameCaseMapped *Profile = usernameCaseMap + + // Implements the UsernameCasePreserved profile specified in RFC 7613. + UsernameCasePreserved *Profile = usernameNoCaseMap + + // Implements the OpaqueString profile defined in RFC 7613 for passwords and other secure labels. + OpaqueString *Profile = opaquestring ) -// TODO: mvl: "Ultimately, I would manually define the structs for the internal -// profiles. This avoid pulling in unneeded tables when they are not used." var ( - nickname = NewFreeform( - AdditionalMapping(func() transform.Transformer { - return &nickAdditionalMapping{} - }), - IgnoreCase, - Norm(norm.NFKC), - DisallowEmpty, - ) - usernameCaseMap = NewIdentifier( - FoldWidth, - FoldCase(), - Norm(norm.NFC), - BidiRule, - ) - usernameNoCaseMap = NewIdentifier( - FoldWidth, - Norm(norm.NFC), - BidiRule, - ) - opaquestring = NewFreeform( - AdditionalMapping(func() transform.Transformer { - return runes.Map(func(r rune) rune { - if unicode.Is(unicode.Zs, r) { - return ' ' - } - return r - }) - }), - Norm(norm.NFC), - DisallowEmpty, - ) + nickname = &Profile{ + options: getOpts( + AdditionalMapping(func() transform.Transformer { + return &nickAdditionalMapping{} + }), + IgnoreCase, + Norm(norm.NFKC), + DisallowEmpty, + ), + class: freeform, + } + usernameCaseMap = &Profile{ + options: getOpts( + FoldWidth, + LowerCase(), + Norm(norm.NFC), + BidiRule, + ), + class: identifier, + } + usernameNoCaseMap = &Profile{ + options: getOpts( + FoldWidth, + Norm(norm.NFC), + BidiRule, + ), + class: identifier, + } + opaquestring = &Profile{ + options: getOpts( + AdditionalMapping(func() transform.Transformer { + return mapSpaces + }), + Norm(norm.NFC), + DisallowEmpty, + ), + class: freeform, + } ) + +// mapSpaces is a shared value of a runes.Map transformer. +var mapSpaces transform.Transformer = runes.Map(func(r rune) rune { + if unicode.Is(unicode.Zs, r) { + return ' ' + } + return r +}) diff --git a/vendor/golang.org/x/text/secure/precis/tables.go b/vendor/golang.org/x/text/secure/precis/tables.go index a9b500deb0e..2f550c1efa1 100644 --- a/vendor/golang.org/x/text/secure/precis/tables.go +++ b/vendor/golang.org/x/text/secure/precis/tables.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package precis diff --git a/vendor/golang.org/x/text/secure/precis/trieval.go b/vendor/golang.org/x/text/secure/precis/trieval.go index fed7d759522..4833f9622a9 100644 --- a/vendor/golang.org/x/text/secure/precis/trieval.go +++ b/vendor/golang.org/x/text/secure/precis/trieval.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package precis diff --git a/vendor/golang.org/x/text/transform/transform.go b/vendor/golang.org/x/text/transform/transform.go index 51862b02bf5..24dcca6a8c0 100644 --- a/vendor/golang.org/x/text/transform/transform.go +++ b/vendor/golang.org/x/text/transform/transform.go @@ -24,6 +24,10 @@ var ( // complete the transformation. ErrShortSrc = errors.New("transform: short source buffer") + // ErrEndOfSpan means that the input and output (the transformed input) + // are not identical. + ErrEndOfSpan = errors.New("transform: input and output are not identical") + // errInconsistentByteCount means that Transform returned success (nil // error) but also returned nSrc inconsistent with the src argument. errInconsistentByteCount = errors.New("transform: inconsistent byte count returned") @@ -60,6 +64,41 @@ type Transformer interface { Reset() } +// SpanningTransformer extends the Transformer interface with a Span method +// that determines how much of the input already conforms to the Transformer. +type SpanningTransformer interface { + Transformer + + // Span returns a position in src such that transforming src[:n] results in + // identical output src[:n] for these bytes. It does not necessarily return + // the largest such n. The atEOF argument tells whether src represents the + // last bytes of the input. + // + // Callers should always account for the n bytes consumed before + // considering the error err. + // + // A nil error means that all input bytes are known to be identical to the + // output produced by the Transformer. A nil error can be be returned + // regardless of whether atEOF is true. If err is nil, then then n must + // equal len(src); the converse is not necessarily true. + // + // ErrEndOfSpan means that the Transformer output may differ from the + // input after n bytes. Note that n may be len(src), meaning that the output + // would contain additional bytes after otherwise identical output. + // ErrShortSrc means that src had insufficient data to determine whether the + // remaining bytes would change. Other than the error conditions listed + // here, implementations are free to report other errors that arise. + // + // Calling Span can modify the Transformer state as a side effect. In + // effect, it does the transformation just as calling Transform would, only + // without copying to a destination buffer and only up to a point it can + // determine the input and output bytes are the same. This is obviously more + // limited than calling Transform, but can be more efficient in terms of + // copying and allocating buffers. Calls to Span and Transform may be + // interleaved. + Span(src []byte, atEOF bool) (n int, err error) +} + // NopResetter can be embedded by implementations of Transformer to add a nop // Reset method. type NopResetter struct{} @@ -278,6 +317,10 @@ func (nop) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { return n, n, err } +func (nop) Span(src []byte, atEOF bool) (n int, err error) { + return len(src), nil +} + type discard struct{ NopResetter } func (discard) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { @@ -289,8 +332,8 @@ var ( // by consuming all bytes and writing nothing. Discard Transformer = discard{} - // Nop is a Transformer that copies src to dst. - Nop Transformer = nop{} + // Nop is a SpanningTransformer that copies src to dst. + Nop SpanningTransformer = nop{} ) // chain is a sequence of links. A chain with N Transformers has N+1 links and @@ -358,6 +401,8 @@ func (c *chain) Reset() { } } +// TODO: make chain use Span (is going to be fun to implement!) + // Transform applies the transformers of c in sequence. func (c *chain) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { // Set up src and dst in the chain. @@ -448,8 +493,7 @@ func (c *chain) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err erro return dstL.n, srcL.p, err } -// RemoveFunc returns a Transformer that removes from the input all runes r for -// which f(r) is true. Illegal bytes in the input are replaced by RuneError. +// Deprecated: use runes.Remove instead. func RemoveFunc(f func(r rune) bool) Transformer { return removeF(f) } diff --git a/vendor/golang.org/x/text/unicode/bidi/bracket.go b/vendor/golang.org/x/text/unicode/bidi/bracket.go index e88119d1b1d..601e259203e 100644 --- a/vendor/golang.org/x/text/unicode/bidi/bracket.go +++ b/vendor/golang.org/x/text/unicode/bidi/bracket.go @@ -84,7 +84,7 @@ func resolvePairedBrackets(s *isolatingRunSequence) { dirEmbed = R } p.locateBrackets(s.p.pairTypes, s.p.pairValues) - p.resolveBrackets(dirEmbed) + p.resolveBrackets(dirEmbed, s.p.initialTypes) } type bracketPairer struct { @@ -125,6 +125,8 @@ func (p *bracketPairer) matchOpener(pairValues []rune, opener, closer int) bool return pairValues[p.indexes[opener]] == pairValues[p.indexes[closer]] } +const maxPairingDepth = 63 + // locateBrackets locates matching bracket pairs according to BD16. // // This implementation uses a linked list instead of a stack, because, while @@ -136,11 +138,17 @@ func (p *bracketPairer) locateBrackets(pairTypes []bracketType, pairValues []run for i, index := range p.indexes { // look at the bracket type for each character - switch pairTypes[index] { - case bpNone: + if pairTypes[index] == bpNone || p.codesIsolatedRun[i] != ON { // continue scanning - + continue + } + switch pairTypes[index] { case bpOpen: + // check if maximum pairing depth reached + if p.openers.Len() == maxPairingDepth { + p.openers.Init() + return + } // remember opener location, most recent first p.openers.PushFront(i) @@ -270,7 +278,7 @@ func (p *bracketPairer) classBeforePair(loc bracketPair) Class { } // assignBracketType implements rule N0 for a single bracket pair. -func (p *bracketPairer) assignBracketType(loc bracketPair, dirEmbed Class) { +func (p *bracketPairer) assignBracketType(loc bracketPair, dirEmbed Class, initialTypes []Class) { // rule "N0, a", inspect contents of pair dirPair := p.classifyPairContent(loc, dirEmbed) @@ -295,13 +303,33 @@ func (p *bracketPairer) assignBracketType(loc bracketPair, dirEmbed Class) { // direction // set the bracket types to the type found + p.setBracketsToType(loc, dirPair, initialTypes) +} + +func (p *bracketPairer) setBracketsToType(loc bracketPair, dirPair Class, initialTypes []Class) { p.codesIsolatedRun[loc.opener] = dirPair p.codesIsolatedRun[loc.closer] = dirPair + + for i := loc.opener + 1; i < loc.closer; i++ { + index := p.indexes[i] + if initialTypes[index] != NSM { + break + } + p.codesIsolatedRun[i] = dirPair + } + + for i := loc.closer + 1; i < len(p.indexes); i++ { + index := p.indexes[i] + if initialTypes[index] != NSM { + break + } + p.codesIsolatedRun[i] = dirPair + } } // resolveBrackets implements rule N0 for a list of pairs. -func (p *bracketPairer) resolveBrackets(dirEmbed Class) { +func (p *bracketPairer) resolveBrackets(dirEmbed Class, initialTypes []Class) { for _, loc := range p.pairPositions { - p.assignBracketType(loc, dirEmbed) + p.assignBracketType(loc, dirEmbed, initialTypes) } } diff --git a/vendor/golang.org/x/text/unicode/bidi/core.go b/vendor/golang.org/x/text/unicode/bidi/core.go index 381f30ad0ae..d4c1399f0da 100644 --- a/vendor/golang.org/x/text/unicode/bidi/core.go +++ b/vendor/golang.org/x/text/unicode/bidi/core.go @@ -309,6 +309,9 @@ func (p *paragraph) determineExplicitEmbeddingLevels() { } if isIsolate { p.resultLevels[i] = stack.lastEmbeddingLevel() + if stack.lastDirectionalOverrideStatus() != ON { + p.resultTypes[i] = stack.lastDirectionalOverrideStatus() + } } var newLevel level @@ -723,7 +726,7 @@ loop: continue loop } } - log.Panicf("invalid bidi code %s present in assertOnly at position %d", t, s.indexes[i]) + log.Panicf("invalid bidi code %v present in assertOnly at position %d", t, s.indexes[i]) } } diff --git a/vendor/golang.org/x/text/unicode/bidi/tables.go b/vendor/golang.org/x/text/unicode/bidi/tables.go index 2d4dde07c54..7212d5add15 100644 --- a/vendor/golang.org/x/text/unicode/bidi/tables.go +++ b/vendor/golang.org/x/text/unicode/bidi/tables.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package bidi diff --git a/vendor/golang.org/x/text/unicode/bidi/trieval.go b/vendor/golang.org/x/text/unicode/bidi/trieval.go index bebd855efde..4c459c4b72e 100644 --- a/vendor/golang.org/x/text/unicode/bidi/trieval.go +++ b/vendor/golang.org/x/text/unicode/bidi/trieval.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package bidi diff --git a/vendor/golang.org/x/text/unicode/norm/composition.go b/vendor/golang.org/x/text/unicode/norm/composition.go index d17b278adc3..bab4c5de02f 100644 --- a/vendor/golang.org/x/text/unicode/norm/composition.go +++ b/vendor/golang.org/x/text/unicode/norm/composition.go @@ -33,17 +33,9 @@ const ( // streamSafe implements the policy of when a CGJ should be inserted. type streamSafe uint8 -// mkStreamSafe is a shorthand for declaring a streamSafe var and calling -// first on it. -func mkStreamSafe(p Properties) streamSafe { - return streamSafe(p.nTrailingNonStarters()) -} - -// first inserts the first rune of a segment. +// first inserts the first rune of a segment. It is a faster version of next if +// it is known p represents the first rune in a segment. func (ss *streamSafe) first(p Properties) { - if *ss != 0 { - panic("!= 0") - } *ss = streamSafe(p.nTrailingNonStarters()) } @@ -66,7 +58,7 @@ func (ss *streamSafe) next(p Properties) ssState { // be a non-starter. Note that it always hold that if nLead > 0 then // nLead == nTrail. if n == 0 { - *ss = 0 + *ss = streamSafe(p.nTrailingNonStarters()) return ssStarter } return ssSuccess @@ -142,7 +134,6 @@ func (rb *reorderBuffer) setFlusher(out []byte, f func(*reorderBuffer) bool) { func (rb *reorderBuffer) reset() { rb.nrune = 0 rb.nbyte = 0 - rb.ss = 0 } func (rb *reorderBuffer) doFlush() bool { @@ -257,6 +248,9 @@ func (rb *reorderBuffer) insertUnsafe(src input, i int, info Properties) { // It flushes the buffer on each new segment start. func (rb *reorderBuffer) insertDecomposed(dcomp []byte) insertErr { rb.tmpBytes.setBytes(dcomp) + // As the streamSafe accounting already handles the counting for modifiers, + // we don't have to call next. However, we do need to keep the accounting + // intact when flushing the buffer. for i := 0; i < len(dcomp); { info := rb.f.info(rb.tmpBytes, i) if info.BoundaryBefore() && rb.nrune > 0 && !rb.doFlush() { diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go index 15a67c653a3..e67e7655c54 100644 --- a/vendor/golang.org/x/text/unicode/norm/forminfo.go +++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go @@ -10,7 +10,7 @@ package norm // and its corresponding decomposing form share the same trie. Each trie maps // a rune to a uint16. The values take two forms. For v >= 0x8000: // bits -// 15: 1 (inverse of NFD_QD bit of qcInfo) +// 15: 1 (inverse of NFD_QC bit of qcInfo) // 13..7: qcInfo (see below). isYesD is always true (no decompostion). // 6..0: ccc (compressed CCC value). // For v < 0x8000, the respective rune has a decomposition and v is an index @@ -56,28 +56,31 @@ type formInfo struct { nextMain iterFunc } -var formTable []*formInfo - -func init() { - formTable = make([]*formInfo, 4) - - for i := range formTable { - f := &formInfo{} - formTable[i] = f - f.form = Form(i) - if Form(i) == NFKD || Form(i) == NFKC { - f.compatibility = true - f.info = lookupInfoNFKC - } else { - f.info = lookupInfoNFC - } - f.nextMain = nextDecomposed - if Form(i) == NFC || Form(i) == NFKC { - f.nextMain = nextComposed - f.composing = true - } - } -} +var formTable = []*formInfo{{ + form: NFC, + composing: true, + compatibility: false, + info: lookupInfoNFC, + nextMain: nextComposed, +}, { + form: NFD, + composing: false, + compatibility: false, + info: lookupInfoNFC, + nextMain: nextDecomposed, +}, { + form: NFKC, + composing: true, + compatibility: true, + info: lookupInfoNFKC, + nextMain: nextComposed, +}, { + form: NFKD, + composing: false, + compatibility: true, + info: lookupInfoNFKC, + nextMain: nextDecomposed, +}} // We do not distinguish between boundaries for NFC, NFD, etc. to avoid // unexpected behavior for the user. For example, in NFD, there is a boundary diff --git a/vendor/golang.org/x/text/unicode/norm/input.go b/vendor/golang.org/x/text/unicode/norm/input.go index 045d4ccce2e..479e35bc258 100644 --- a/vendor/golang.org/x/text/unicode/norm/input.go +++ b/vendor/golang.org/x/text/unicode/norm/input.go @@ -90,16 +90,20 @@ func (in *input) charinfoNFKC(p int) (uint16, int) { } func (in *input) hangul(p int) (r rune) { + var size int if in.bytes == nil { if !isHangulString(in.str[p:]) { return 0 } - r, _ = utf8.DecodeRuneInString(in.str[p:]) + r, size = utf8.DecodeRuneInString(in.str[p:]) } else { if !isHangul(in.bytes[p:]) { return 0 } - r, _ = utf8.DecodeRune(in.bytes[p:]) + r, size = utf8.DecodeRune(in.bytes[p:]) + } + if size != hangulUTF8Size { + return 0 } return r } diff --git a/vendor/golang.org/x/text/unicode/norm/iter.go b/vendor/golang.org/x/text/unicode/norm/iter.go index 0a42a72de81..ce17f96c2e0 100644 --- a/vendor/golang.org/x/text/unicode/norm/iter.go +++ b/vendor/golang.org/x/text/unicode/norm/iter.go @@ -41,6 +41,7 @@ func (i *Iter) Init(f Form, src []byte) { i.next = i.rb.f.nextMain i.asciiF = nextASCIIBytes i.info = i.rb.f.info(i.rb.src, i.p) + i.rb.ss.first(i.info) } // InitString initializes i to iterate over src after normalizing it to Form f. @@ -56,11 +57,12 @@ func (i *Iter) InitString(f Form, src string) { i.next = i.rb.f.nextMain i.asciiF = nextASCIIString i.info = i.rb.f.info(i.rb.src, i.p) + i.rb.ss.first(i.info) } // Seek sets the segment to be returned by the next call to Next to start // at position p. It is the responsibility of the caller to set p to the -// start of a UTF8 rune. +// start of a segment. func (i *Iter) Seek(offset int64, whence int) (int64, error) { var abs int64 switch whence { @@ -84,6 +86,7 @@ func (i *Iter) Seek(offset int64, whence int) (int64, error) { i.multiSeg = nil i.next = i.rb.f.nextMain i.info = i.rb.f.info(i.rb.src, i.p) + i.rb.ss.first(i.info) return abs, nil } @@ -161,6 +164,7 @@ func nextHangul(i *Iter) []byte { if next >= i.rb.nsrc { i.setDone() } else if i.rb.src.hangul(next) == 0 { + i.rb.ss.next(i.info) i.info = i.rb.f.info(i.rb.src, i.p) i.next = i.rb.f.nextMain return i.next(i) @@ -204,12 +208,10 @@ func nextMultiNorm(i *Iter) []byte { if info.BoundaryBefore() { i.rb.compose() seg := i.buf[:i.rb.flushCopy(i.buf[:])] - i.rb.ss.first(info) i.rb.insertUnsafe(input{bytes: d}, j, info) i.multiSeg = d[j+int(info.size):] return seg } - i.rb.ss.next(info) i.rb.insertUnsafe(input{bytes: d}, j, info) j += int(info.size) } @@ -222,9 +224,9 @@ func nextMultiNorm(i *Iter) []byte { func nextDecomposed(i *Iter) (next []byte) { outp := 0 inCopyStart, outCopyStart := i.p, 0 - ss := mkStreamSafe(i.info) for { if sz := int(i.info.size); sz <= 1 { + i.rb.ss = 0 p := i.p i.p++ // ASCII or illegal byte. Either way, advance by 1. if i.p >= i.rb.nsrc { @@ -243,6 +245,8 @@ func nextDecomposed(i *Iter) (next []byte) { p := outp + len(d) if outp > 0 { i.rb.src.copySlice(i.buf[outCopyStart:], inCopyStart, i.p) + // TODO: this condition should not be possible, but we leave it + // in for defensive purposes. if p > len(i.buf) { return i.buf[:outp] } @@ -266,7 +270,7 @@ func nextDecomposed(i *Iter) (next []byte) { } else { i.info = i.rb.f.info(i.rb.src, i.p) } - switch ss.next(i.info) { + switch i.rb.ss.next(i.info) { case ssOverflow: i.next = nextCGJDecompose fallthrough @@ -309,7 +313,7 @@ func nextDecomposed(i *Iter) (next []byte) { } prevCC := i.info.tccc i.info = i.rb.f.info(i.rb.src, i.p) - if v := ss.next(i.info); v == ssStarter { + if v := i.rb.ss.next(i.info); v == ssStarter { break } else if v == ssOverflow { i.next = nextCGJDecompose @@ -335,10 +339,6 @@ doNorm: func doNormDecomposed(i *Iter) []byte { for { - if s := i.rb.ss.next(i.info); s == ssOverflow { - i.next = nextCGJDecompose - break - } i.rb.insertUnsafe(i.rb.src, i.p, i.info) if i.p += int(i.info.size); i.p >= i.rb.nsrc { i.setDone() @@ -348,6 +348,10 @@ func doNormDecomposed(i *Iter) []byte { if i.info.ccc == 0 { break } + if s := i.rb.ss.next(i.info); s == ssOverflow { + i.next = nextCGJDecompose + break + } } // new segment or too many combining characters: exit normalization return i.buf[:i.rb.flushCopy(i.buf[:])] @@ -357,6 +361,7 @@ func nextCGJDecompose(i *Iter) []byte { i.rb.ss = 0 i.rb.insertCGJ() i.next = nextDecomposed + i.rb.ss.first(i.info) buf := doNormDecomposed(i) return buf } @@ -365,7 +370,6 @@ func nextCGJDecompose(i *Iter) []byte { func nextComposed(i *Iter) []byte { outp, startp := 0, i.p var prevCC uint8 - ss := mkStreamSafe(i.info) for { if !i.info.isYesC() { goto doNorm @@ -385,11 +389,12 @@ func nextComposed(i *Iter) []byte { i.setDone() break } else if i.rb.src._byte(i.p) < utf8.RuneSelf { + i.rb.ss = 0 i.next = i.asciiF break } i.info = i.rb.f.info(i.rb.src, i.p) - if v := ss.next(i.info); v == ssStarter { + if v := i.rb.ss.next(i.info); v == ssStarter { break } else if v == ssOverflow { i.next = nextCGJCompose @@ -401,8 +406,10 @@ func nextComposed(i *Iter) []byte { } return i.returnSlice(startp, i.p) doNorm: + // reset to start position i.p = startp i.info = i.rb.f.info(i.rb.src, i.p) + i.rb.ss.first(i.info) if i.info.multiSegment() { d := i.info.Decomposition() info := i.rb.f.info(input{bytes: d}, 0) diff --git a/vendor/golang.org/x/text/unicode/norm/maketables.go b/vendor/golang.org/x/text/unicode/norm/maketables.go index 07bdff6bdcd..8d418160cad 100644 --- a/vendor/golang.org/x/text/unicode/norm/maketables.go +++ b/vendor/golang.org/x/text/unicode/norm/maketables.go @@ -35,12 +35,9 @@ func main() { computeNonStarterCounts() verifyComputed() printChars() - if *test { - testDerived() - printTestdata() - } else { - makeTables() - } + testDerived() + printTestdata() + makeTables() } var ( @@ -602,6 +599,7 @@ func printCharInfoTables(w io.Writer) int { } index := normalDecomp nTrail := chars[r].nTrailingNonStarters + nLead := chars[r].nLeadingNonStarters if tccc > 0 || lccc > 0 || nTrail > 0 { tccc <<= 2 tccc |= nTrail @@ -612,7 +610,7 @@ func printCharInfoTables(w io.Writer) int { index = firstCCC } } - if lccc > 0 { + if lccc > 0 || nLead > 0 { s += string([]byte{lccc}) if index == firstCCC { log.Fatalf("%U: multi-segment decomposition not supported for decompositions with leading CCC != 0", r) diff --git a/vendor/golang.org/x/text/unicode/norm/normalize.go b/vendor/golang.org/x/text/unicode/norm/normalize.go index a70805c2660..2747f6c9a4d 100644 --- a/vendor/golang.org/x/text/unicode/norm/normalize.go +++ b/vendor/golang.org/x/text/unicode/norm/normalize.go @@ -2,13 +2,18 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. +// Note: the file data_test.go that is generated should not be checked in. //go:generate go run maketables.go triegen.go -//go:generate go run maketables.go triegen.go -test +//go:generate go test -tags test // Package norm contains types and functions for normalizing Unicode strings. package norm -import "unicode/utf8" +import ( + "unicode/utf8" + + "golang.org/x/text/transform" +) // A Form denotes a canonical representation of Unicode code points. // The Unicode-defined normalization and equivalence forms are: @@ -263,6 +268,34 @@ func (f Form) QuickSpan(b []byte) int { return n } +// Span implements transform.SpanningTransformer. It returns a boundary n such +// that b[0:n] == f(b[0:n]). It is not guaranteed to return the largest such n. +func (f Form) Span(b []byte, atEOF bool) (n int, err error) { + n, ok := formTable[f].quickSpan(inputBytes(b), 0, len(b), atEOF) + if n < len(b) { + if !ok { + err = transform.ErrEndOfSpan + } else { + err = transform.ErrShortSrc + } + } + return n, err +} + +// SpanString returns a boundary n such that s[0:n] == f(s[0:n]). +// It is not guaranteed to return the largest such n. +func (f Form) SpanString(s string, atEOF bool) (n int, err error) { + n, ok := formTable[f].quickSpan(inputString(s), 0, len(s), atEOF) + if n < len(s) { + if !ok { + err = transform.ErrEndOfSpan + } else { + err = transform.ErrShortSrc + } + } + return n, err +} + // quickSpan returns a boundary n such that src[0:n] == f(src[0:n]) and // whether any non-normalized parts were found. If atEOF is false, n will // not point past the last segment if this segment might be become @@ -291,7 +324,6 @@ func (f *formInfo) quickSpan(src input, i, end int, atEOF bool) (n int, ok bool) // have an overflow for runes that are starters (e.g. with U+FF9E). switch ss.next(info) { case ssStarter: - ss.first(info) lastSegStart = i case ssOverflow: return lastSegStart, false @@ -321,7 +353,7 @@ func (f *formInfo) quickSpan(src input, i, end int, atEOF bool) (n int, ok bool) return lastSegStart, false } -// QuickSpanString returns a boundary n such that b[0:n] == f(s[0:n]). +// QuickSpanString returns a boundary n such that s[0:n] == f(s[0:n]). // It is not guaranteed to return the largest such n. func (f Form) QuickSpanString(s string) int { n, _ := formTable[f].quickSpan(inputString(s), 0, len(s), true) @@ -408,6 +440,8 @@ func (f Form) nextBoundary(src input, nsrc int, atEOF bool) int { } return -1 } + // TODO: Using streamSafe to determine the boundary isn't the same as + // using BoundaryBefore. Determine which should be used. if s := ss.next(info); s != ssSuccess { return i } @@ -472,15 +506,14 @@ func decomposeSegment(rb *reorderBuffer, sp int, atEOF bool) int { if info.size == 0 { return 0 } - if rb.nrune > 0 { - if s := rb.ss.next(info); s == ssStarter { - goto end - } else if s == ssOverflow { - rb.insertCGJ() + if s := rb.ss.next(info); s == ssStarter { + // TODO: this could be removed if we don't support merging. + if rb.nrune > 0 { goto end } - } else { - rb.ss.first(info) + } else if s == ssOverflow { + rb.insertCGJ() + goto end } if err := rb.insertFlush(rb.src, sp, info); err != iSuccess { return int(err) diff --git a/vendor/golang.org/x/text/unicode/norm/readwriter.go b/vendor/golang.org/x/text/unicode/norm/readwriter.go index 4fa0e04b21f..d926ee903e5 100644 --- a/vendor/golang.org/x/text/unicode/norm/readwriter.go +++ b/vendor/golang.org/x/text/unicode/norm/readwriter.go @@ -112,7 +112,6 @@ func (r *normReader) Read(p []byte) (int, error) { } } } - panic("should not reach here") } // Reader returns a new reader that implements Read diff --git a/vendor/golang.org/x/text/unicode/norm/tables.go b/vendor/golang.org/x/text/unicode/norm/tables.go index a56697b571b..bf9ff8038c4 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables.go +++ b/vendor/golang.org/x/text/unicode/norm/tables.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package norm @@ -27,14 +27,14 @@ const ( firstMulti = 0x186D firstCCC = 0x2C9E endMulti = 0x2F60 - firstLeadingCCC = 0x4A44 - firstCCCZeroExcept = 0x4A5A - firstStarterWithNLead = 0x4A81 - lastDecomp = 0x4A83 + firstLeadingCCC = 0x49AE + firstCCCZeroExcept = 0x4A78 + firstStarterWithNLead = 0x4A9F + lastDecomp = 0x4AA1 maxDecomp = 0x8000 ) -// decomps: 19075 bytes +// decomps: 19105 bytes var decomps = [...]byte{ // Bytes 0 - 3f 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, @@ -2443,283 +2443,287 @@ var decomps = [...]byte{ 0xD9, 0x8F, 0x69, 0x43, 0x20, 0xD9, 0x90, 0x6D, 0x43, 0x20, 0xD9, 0x91, 0x71, 0x43, 0x20, 0xD9, 0x92, 0x75, 0x43, 0x41, 0xCC, 0x8A, 0xC9, 0x43, - 0x73, 0xCC, 0x87, 0xC9, 0x43, 0xE1, 0x85, 0xA1, - 0x01, 0x43, 0xE1, 0x85, 0xA2, 0x01, 0x43, 0xE1, - 0x85, 0xA3, 0x01, 0x43, 0xE1, 0x85, 0xA4, 0x01, - 0x43, 0xE1, 0x85, 0xA5, 0x01, 0x43, 0xE1, 0x85, - 0xA6, 0x01, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x43, + 0x73, 0xCC, 0x87, 0xC9, 0x44, 0x20, 0xE3, 0x82, + 0x99, 0x0D, 0x44, 0x20, 0xE3, 0x82, 0x9A, 0x0D, + 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCA, 0x44, 0xCE, + 0x91, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0x95, 0xCC, + 0x81, 0xC9, 0x44, 0xCE, 0x97, 0xCC, 0x81, 0xC9, // Bytes 4300 - 433f - 0xE1, 0x85, 0xA8, 0x01, 0x43, 0xE1, 0x85, 0xA9, - 0x01, 0x43, 0xE1, 0x85, 0xAA, 0x01, 0x43, 0xE1, - 0x85, 0xAB, 0x01, 0x43, 0xE1, 0x85, 0xAC, 0x01, - 0x43, 0xE1, 0x85, 0xAD, 0x01, 0x43, 0xE1, 0x85, - 0xAE, 0x01, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x43, - 0xE1, 0x85, 0xB0, 0x01, 0x43, 0xE1, 0x85, 0xB1, - 0x01, 0x43, 0xE1, 0x85, 0xB2, 0x01, 0x43, 0xE1, - 0x85, 0xB3, 0x01, 0x43, 0xE1, 0x85, 0xB4, 0x01, + 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xC9, 0x44, 0xCE, + 0x9F, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC, + 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC, 0x88, 0xC9, + 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xC9, 0x44, 0xCE, + 0xB1, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xB5, 0xCC, + 0x81, 0xC9, 0x44, 0xCE, 0xB7, 0xCC, 0x81, 0xC9, + 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xC9, 0x44, 0xCE, + 0xBF, 0xCC, 0x81, 0xC9, 0x44, 0xCF, 0x85, 0xCC, // Bytes 4340 - 437f - 0x43, 0xE1, 0x85, 0xB5, 0x01, 0x43, 0xE1, 0x86, - 0xAA, 0x01, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x43, - 0xE1, 0x86, 0xAD, 0x01, 0x43, 0xE1, 0x86, 0xB0, - 0x01, 0x43, 0xE1, 0x86, 0xB1, 0x01, 0x43, 0xE1, - 0x86, 0xB2, 0x01, 0x43, 0xE1, 0x86, 0xB3, 0x01, - 0x43, 0xE1, 0x86, 0xB4, 0x01, 0x43, 0xE1, 0x86, - 0xB5, 0x01, 0x44, 0x20, 0xE3, 0x82, 0x99, 0x0D, - 0x44, 0x20, 0xE3, 0x82, 0x9A, 0x0D, 0x44, 0xC2, + 0x81, 0xC9, 0x44, 0xCF, 0x89, 0xCC, 0x81, 0xC9, + 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x31, 0x44, 0xD7, + 0x90, 0xD6, 0xB8, 0x35, 0x44, 0xD7, 0x90, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x91, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x49, 0x44, 0xD7, + 0x92, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x93, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x94, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x39, 0x44, 0xD7, // Bytes 4380 - 43bf - 0xA8, 0xCC, 0x81, 0xCA, 0x44, 0xCE, 0x91, 0xCC, - 0x81, 0xC9, 0x44, 0xCE, 0x95, 0xCC, 0x81, 0xC9, - 0x44, 0xCE, 0x97, 0xCC, 0x81, 0xC9, 0x44, 0xCE, - 0x99, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0x9F, 0xCC, - 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC, 0x81, 0xC9, - 0x44, 0xCE, 0xA5, 0xCC, 0x88, 0xC9, 0x44, 0xCE, - 0xA9, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xB1, 0xCC, - 0x81, 0xC9, 0x44, 0xCE, 0xB5, 0xCC, 0x81, 0xC9, + 0x95, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x96, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x98, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x25, 0x44, 0xD7, + 0x99, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x9A, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x49, 0x44, 0xD7, + 0x9C, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x9E, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, 0x41, // Bytes 43c0 - 43ff - 0x44, 0xCE, 0xB7, 0xCC, 0x81, 0xC9, 0x44, 0xCE, - 0xB9, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xBF, 0xCC, - 0x81, 0xC9, 0x44, 0xCF, 0x85, 0xCC, 0x81, 0xC9, - 0x44, 0xCF, 0x89, 0xCC, 0x81, 0xC9, 0x44, 0xD7, - 0x90, 0xD6, 0xB7, 0x31, 0x44, 0xD7, 0x90, 0xD6, - 0xB8, 0x35, 0x44, 0xD7, 0x90, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0x91, 0xD6, 0xBC, 0x41, 0x44, 0xD7, - 0x91, 0xD6, 0xBF, 0x49, 0x44, 0xD7, 0x92, 0xD6, + 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x41, 0x44, 0xD7, + 0xA3, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, 0x49, + 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x41, 0x44, 0xD7, + 0xA7, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA8, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x4D, 0x44, 0xD7, + 0xA9, 0xD7, 0x82, 0x51, 0x44, 0xD7, 0xAA, 0xD6, // Bytes 4400 - 443f - 0xBC, 0x41, 0x44, 0xD7, 0x93, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0x94, 0xD6, 0xBC, 0x41, 0x44, 0xD7, - 0x95, 0xD6, 0xB9, 0x39, 0x44, 0xD7, 0x95, 0xD6, - 0xBC, 0x41, 0x44, 0xD7, 0x96, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0x98, 0xD6, 0xBC, 0x41, 0x44, 0xD7, - 0x99, 0xD6, 0xB4, 0x25, 0x44, 0xD7, 0x99, 0xD6, - 0xBC, 0x41, 0x44, 0xD7, 0x9A, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0x9B, 0xD6, 0xBC, 0x41, 0x44, 0xD7, + 0xBC, 0x41, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, 0x31, + 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x59, 0x44, 0xD8, + 0xA7, 0xD9, 0x93, 0xC9, 0x44, 0xD8, 0xA7, 0xD9, + 0x94, 0xC9, 0x44, 0xD8, 0xA7, 0xD9, 0x95, 0xB5, + 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x79, 0x44, 0xD8, + 0xB1, 0xD9, 0xB0, 0x79, 0x44, 0xD9, 0x80, 0xD9, + 0x8B, 0x59, 0x44, 0xD9, 0x80, 0xD9, 0x8E, 0x65, + 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x69, 0x44, 0xD9, // Bytes 4440 - 447f - 0x9B, 0xD6, 0xBF, 0x49, 0x44, 0xD7, 0x9C, 0xD6, - 0xBC, 0x41, 0x44, 0xD7, 0x9E, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0xA0, 0xD6, 0xBC, 0x41, 0x44, 0xD7, - 0xA1, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA3, 0xD6, - 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0xA4, 0xD6, 0xBF, 0x49, 0x44, 0xD7, - 0xA6, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA7, 0xD6, - 0xBC, 0x41, 0x44, 0xD7, 0xA8, 0xD6, 0xBC, 0x41, + 0x80, 0xD9, 0x90, 0x6D, 0x44, 0xD9, 0x80, 0xD9, + 0x91, 0x71, 0x44, 0xD9, 0x80, 0xD9, 0x92, 0x75, + 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x79, 0x44, 0xD9, + 0x88, 0xD9, 0x94, 0xC9, 0x44, 0xD9, 0x89, 0xD9, + 0xB0, 0x79, 0x44, 0xD9, 0x8A, 0xD9, 0x94, 0xC9, + 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xC9, 0x44, 0xDB, + 0x95, 0xD9, 0x94, 0xC9, 0x45, 0x20, 0xCC, 0x88, + 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCC, // Bytes 4480 - 44bf - 0x44, 0xD7, 0xA9, 0xD6, 0xBC, 0x41, 0x44, 0xD7, - 0xA9, 0xD7, 0x81, 0x4D, 0x44, 0xD7, 0xA9, 0xD7, - 0x82, 0x51, 0x44, 0xD7, 0xAA, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0xB2, 0xD6, 0xB7, 0x31, 0x44, 0xD8, - 0xA7, 0xD9, 0x8B, 0x59, 0x44, 0xD8, 0xA7, 0xD9, - 0x93, 0xC9, 0x44, 0xD8, 0xA7, 0xD9, 0x94, 0xC9, - 0x44, 0xD8, 0xA7, 0xD9, 0x95, 0xB5, 0x44, 0xD8, - 0xB0, 0xD9, 0xB0, 0x79, 0x44, 0xD8, 0xB1, 0xD9, + 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCD, 0x82, + 0xCA, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x45, + 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x45, 0x20, + 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC, + 0x94, 0xCC, 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x94, + 0xCD, 0x82, 0xCA, 0x45, 0x20, 0xD9, 0x8C, 0xD9, + 0x91, 0x72, 0x45, 0x20, 0xD9, 0x8D, 0xD9, 0x91, // Bytes 44c0 - 44ff - 0xB0, 0x79, 0x44, 0xD9, 0x80, 0xD9, 0x8B, 0x59, - 0x44, 0xD9, 0x80, 0xD9, 0x8E, 0x65, 0x44, 0xD9, - 0x80, 0xD9, 0x8F, 0x69, 0x44, 0xD9, 0x80, 0xD9, - 0x90, 0x6D, 0x44, 0xD9, 0x80, 0xD9, 0x91, 0x71, - 0x44, 0xD9, 0x80, 0xD9, 0x92, 0x75, 0x44, 0xD9, - 0x87, 0xD9, 0xB0, 0x79, 0x44, 0xD9, 0x88, 0xD9, - 0x94, 0xC9, 0x44, 0xD9, 0x89, 0xD9, 0xB0, 0x79, - 0x44, 0xD9, 0x8A, 0xD9, 0x94, 0xC9, 0x44, 0xDB, + 0x72, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, 0x72, + 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x72, 0x45, + 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x72, 0x45, 0x20, + 0xD9, 0x91, 0xD9, 0xB0, 0x7A, 0x45, 0xE2, 0xAB, + 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, 0xCC, + 0x88, 0xCC, 0x81, 0xCA, 0x46, 0xCF, 0x85, 0xCC, + 0x88, 0xCC, 0x81, 0xCA, 0x46, 0xD7, 0xA9, 0xD6, + 0xBC, 0xD7, 0x81, 0x4E, 0x46, 0xD7, 0xA9, 0xD6, // Bytes 4500 - 453f - 0x92, 0xD9, 0x94, 0xC9, 0x44, 0xDB, 0x95, 0xD9, - 0x94, 0xC9, 0x45, 0x20, 0xCC, 0x88, 0xCC, 0x80, - 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCC, 0x81, 0xCA, - 0x45, 0x20, 0xCC, 0x88, 0xCD, 0x82, 0xCA, 0x45, - 0x20, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x45, 0x20, - 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x45, 0x20, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x45, 0x20, 0xCC, 0x94, - 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC, 0x94, 0xCC, + 0xBC, 0xD7, 0x82, 0x52, 0x46, 0xD9, 0x80, 0xD9, + 0x8E, 0xD9, 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9, + 0x8F, 0xD9, 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9, + 0x90, 0xD9, 0x91, 0x72, 0x46, 0xE0, 0xA4, 0x95, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x96, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x97, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x9C, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA1, // Bytes 4540 - 457f - 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x94, 0xCD, 0x82, - 0xCA, 0x45, 0x20, 0xD9, 0x8C, 0xD9, 0x91, 0x72, - 0x45, 0x20, 0xD9, 0x8D, 0xD9, 0x91, 0x72, 0x45, - 0x20, 0xD9, 0x8E, 0xD9, 0x91, 0x72, 0x45, 0x20, - 0xD9, 0x8F, 0xD9, 0x91, 0x72, 0x45, 0x20, 0xD9, - 0x90, 0xD9, 0x91, 0x72, 0x45, 0x20, 0xD9, 0x91, - 0xD9, 0xB0, 0x7A, 0x45, 0xE2, 0xAB, 0x9D, 0xCC, - 0xB8, 0x05, 0x46, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA2, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAB, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAF, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA1, + 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA2, + 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xAF, + 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x96, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x97, // Bytes 4580 - 45bf - 0x81, 0xCA, 0x46, 0xCF, 0x85, 0xCC, 0x88, 0xCC, - 0x81, 0xCA, 0x46, 0xD7, 0xA9, 0xD6, 0xBC, 0xD7, - 0x81, 0x4E, 0x46, 0xD7, 0xA9, 0xD6, 0xBC, 0xD7, - 0x82, 0x52, 0x46, 0xD9, 0x80, 0xD9, 0x8E, 0xD9, - 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9, 0x8F, 0xD9, - 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9, 0x90, 0xD9, - 0x91, 0x72, 0x46, 0xE0, 0xA4, 0x95, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x96, 0xE0, 0xA4, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x9C, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xAB, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB2, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB8, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA1, + 0xE0, 0xAC, 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA2, + 0xE0, 0xAC, 0xBC, 0x09, 0x46, 0xE0, 0xBE, 0xB2, + 0xE0, 0xBE, 0x80, 0x9D, 0x46, 0xE0, 0xBE, 0xB3, // Bytes 45c0 - 45ff - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x97, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x9C, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA1, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA2, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAB, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAF, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA1, 0xE0, 0xA6, - 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA2, 0xE0, 0xA6, + 0xE0, 0xBE, 0x80, 0x9D, 0x46, 0xE3, 0x83, 0x86, + 0xE3, 0x82, 0x99, 0x0D, 0x48, 0xF0, 0x9D, 0x85, + 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, 0x48, 0xF0, + 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, + 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, + 0xA5, 0xAD, 0x48, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, + 0x9D, 0x85, 0xA5, 0xAD, 0x49, 0xE0, 0xBE, 0xB2, + 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x49, // Bytes 4600 - 463f - 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xAF, 0xE0, 0xA6, - 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x96, 0xE0, 0xA8, - 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x97, 0xE0, 0xA8, - 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x9C, 0xE0, 0xA8, - 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xAB, 0xE0, 0xA8, - 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB2, 0xE0, 0xA8, - 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB8, 0xE0, 0xA8, - 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA1, 0xE0, 0xAC, - // Bytes 4640 - 467f - 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA2, 0xE0, 0xAC, - 0xBC, 0x09, 0x46, 0xE0, 0xBE, 0xB2, 0xE0, 0xBE, - 0x80, 0x9D, 0x46, 0xE0, 0xBE, 0xB3, 0xE0, 0xBE, - 0x80, 0x9D, 0x46, 0xE3, 0x83, 0x86, 0xE3, 0x82, - 0x99, 0x0D, 0x48, 0xF0, 0x9D, 0x85, 0x97, 0xF0, - 0x9D, 0x85, 0xA5, 0xAD, 0x48, 0xF0, 0x9D, 0x85, - 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, 0x48, 0xF0, - 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, - // Bytes 4680 - 46bf - 0x48, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, 0x9D, 0x85, - 0xA5, 0xAD, 0x49, 0xE0, 0xBE, 0xB2, 0xE0, 0xBD, - 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x49, 0xE0, 0xBE, - 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, - 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, - 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, 0x4C, 0xF0, - 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, - 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, - // Bytes 46c0 - 46ff - 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, - 0xB0, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, - 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB1, 0xAE, - 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, - 0xA5, 0xF0, 0x9D, 0x85, 0xB2, 0xAE, 0x4C, 0xF0, - 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, - 0x9D, 0x85, 0xAE, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, - 0xB9, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, - // Bytes 4700 - 473f - 0xAF, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, + 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, + 0x80, 0x9E, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, - 0x4C, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, 0x9D, 0x85, - 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE, 0x83, 0x41, - 0xCC, 0x82, 0xC9, 0x83, 0x41, 0xCC, 0x86, 0xC9, - 0x83, 0x41, 0xCC, 0x87, 0xC9, 0x83, 0x41, 0xCC, - 0x88, 0xC9, 0x83, 0x41, 0xCC, 0x8A, 0xC9, 0x83, - 0x41, 0xCC, 0xA3, 0xB5, 0x83, 0x43, 0xCC, 0xA7, + 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, + 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0, + 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, + 0x9D, 0x85, 0xB0, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, + 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, + // Bytes 4640 - 467f + 0xB1, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, + 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, 0xAE, + 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, + 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, 0x4C, 0xF0, + 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, + 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, + 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, + 0xAE, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, + // Bytes 4680 - 46bf + 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE, + 0x83, 0x41, 0xCC, 0x82, 0xC9, 0x83, 0x41, 0xCC, + 0x86, 0xC9, 0x83, 0x41, 0xCC, 0x87, 0xC9, 0x83, + 0x41, 0xCC, 0x88, 0xC9, 0x83, 0x41, 0xCC, 0x8A, + 0xC9, 0x83, 0x41, 0xCC, 0xA3, 0xB5, 0x83, 0x43, + 0xCC, 0xA7, 0xA5, 0x83, 0x45, 0xCC, 0x82, 0xC9, + 0x83, 0x45, 0xCC, 0x84, 0xC9, 0x83, 0x45, 0xCC, + 0xA3, 0xB5, 0x83, 0x45, 0xCC, 0xA7, 0xA5, 0x83, + // Bytes 46c0 - 46ff + 0x49, 0xCC, 0x88, 0xC9, 0x83, 0x4C, 0xCC, 0xA3, + 0xB5, 0x83, 0x4F, 0xCC, 0x82, 0xC9, 0x83, 0x4F, + 0xCC, 0x83, 0xC9, 0x83, 0x4F, 0xCC, 0x84, 0xC9, + 0x83, 0x4F, 0xCC, 0x87, 0xC9, 0x83, 0x4F, 0xCC, + 0x88, 0xC9, 0x83, 0x4F, 0xCC, 0x9B, 0xAD, 0x83, + 0x4F, 0xCC, 0xA3, 0xB5, 0x83, 0x4F, 0xCC, 0xA8, + 0xA5, 0x83, 0x52, 0xCC, 0xA3, 0xB5, 0x83, 0x53, + 0xCC, 0x81, 0xC9, 0x83, 0x53, 0xCC, 0x8C, 0xC9, + // Bytes 4700 - 473f + 0x83, 0x53, 0xCC, 0xA3, 0xB5, 0x83, 0x55, 0xCC, + 0x83, 0xC9, 0x83, 0x55, 0xCC, 0x84, 0xC9, 0x83, + 0x55, 0xCC, 0x88, 0xC9, 0x83, 0x55, 0xCC, 0x9B, + 0xAD, 0x83, 0x61, 0xCC, 0x82, 0xC9, 0x83, 0x61, + 0xCC, 0x86, 0xC9, 0x83, 0x61, 0xCC, 0x87, 0xC9, + 0x83, 0x61, 0xCC, 0x88, 0xC9, 0x83, 0x61, 0xCC, + 0x8A, 0xC9, 0x83, 0x61, 0xCC, 0xA3, 0xB5, 0x83, + 0x63, 0xCC, 0xA7, 0xA5, 0x83, 0x65, 0xCC, 0x82, // Bytes 4740 - 477f - 0xA5, 0x83, 0x45, 0xCC, 0x82, 0xC9, 0x83, 0x45, - 0xCC, 0x84, 0xC9, 0x83, 0x45, 0xCC, 0xA3, 0xB5, - 0x83, 0x45, 0xCC, 0xA7, 0xA5, 0x83, 0x49, 0xCC, - 0x88, 0xC9, 0x83, 0x4C, 0xCC, 0xA3, 0xB5, 0x83, - 0x4F, 0xCC, 0x82, 0xC9, 0x83, 0x4F, 0xCC, 0x83, - 0xC9, 0x83, 0x4F, 0xCC, 0x84, 0xC9, 0x83, 0x4F, - 0xCC, 0x87, 0xC9, 0x83, 0x4F, 0xCC, 0x88, 0xC9, - 0x83, 0x4F, 0xCC, 0x9B, 0xAD, 0x83, 0x4F, 0xCC, + 0xC9, 0x83, 0x65, 0xCC, 0x84, 0xC9, 0x83, 0x65, + 0xCC, 0xA3, 0xB5, 0x83, 0x65, 0xCC, 0xA7, 0xA5, + 0x83, 0x69, 0xCC, 0x88, 0xC9, 0x83, 0x6C, 0xCC, + 0xA3, 0xB5, 0x83, 0x6F, 0xCC, 0x82, 0xC9, 0x83, + 0x6F, 0xCC, 0x83, 0xC9, 0x83, 0x6F, 0xCC, 0x84, + 0xC9, 0x83, 0x6F, 0xCC, 0x87, 0xC9, 0x83, 0x6F, + 0xCC, 0x88, 0xC9, 0x83, 0x6F, 0xCC, 0x9B, 0xAD, + 0x83, 0x6F, 0xCC, 0xA3, 0xB5, 0x83, 0x6F, 0xCC, // Bytes 4780 - 47bf - 0xA3, 0xB5, 0x83, 0x4F, 0xCC, 0xA8, 0xA5, 0x83, - 0x52, 0xCC, 0xA3, 0xB5, 0x83, 0x53, 0xCC, 0x81, - 0xC9, 0x83, 0x53, 0xCC, 0x8C, 0xC9, 0x83, 0x53, - 0xCC, 0xA3, 0xB5, 0x83, 0x55, 0xCC, 0x83, 0xC9, - 0x83, 0x55, 0xCC, 0x84, 0xC9, 0x83, 0x55, 0xCC, - 0x88, 0xC9, 0x83, 0x55, 0xCC, 0x9B, 0xAD, 0x83, - 0x61, 0xCC, 0x82, 0xC9, 0x83, 0x61, 0xCC, 0x86, - 0xC9, 0x83, 0x61, 0xCC, 0x87, 0xC9, 0x83, 0x61, + 0xA8, 0xA5, 0x83, 0x72, 0xCC, 0xA3, 0xB5, 0x83, + 0x73, 0xCC, 0x81, 0xC9, 0x83, 0x73, 0xCC, 0x8C, + 0xC9, 0x83, 0x73, 0xCC, 0xA3, 0xB5, 0x83, 0x75, + 0xCC, 0x83, 0xC9, 0x83, 0x75, 0xCC, 0x84, 0xC9, + 0x83, 0x75, 0xCC, 0x88, 0xC9, 0x83, 0x75, 0xCC, + 0x9B, 0xAD, 0x84, 0xCE, 0x91, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xC9, 0x84, 0xCE, + 0x95, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0x95, 0xCC, // Bytes 47c0 - 47ff - 0xCC, 0x88, 0xC9, 0x83, 0x61, 0xCC, 0x8A, 0xC9, - 0x83, 0x61, 0xCC, 0xA3, 0xB5, 0x83, 0x63, 0xCC, - 0xA7, 0xA5, 0x83, 0x65, 0xCC, 0x82, 0xC9, 0x83, - 0x65, 0xCC, 0x84, 0xC9, 0x83, 0x65, 0xCC, 0xA3, - 0xB5, 0x83, 0x65, 0xCC, 0xA7, 0xA5, 0x83, 0x69, - 0xCC, 0x88, 0xC9, 0x83, 0x6C, 0xCC, 0xA3, 0xB5, - 0x83, 0x6F, 0xCC, 0x82, 0xC9, 0x83, 0x6F, 0xCC, - 0x83, 0xC9, 0x83, 0x6F, 0xCC, 0x84, 0xC9, 0x83, + 0x94, 0xC9, 0x84, 0xCE, 0x97, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xC9, 0x84, 0xCE, + 0x99, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0x99, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0x9F, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xC9, 0x84, 0xCE, + 0xA5, 0xCC, 0x94, 0xC9, 0x84, 0xCE, 0xA9, 0xCC, + 0x93, 0xC9, 0x84, 0xCE, 0xA9, 0xCC, 0x94, 0xC9, + 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xC9, 0x84, 0xCE, // Bytes 4800 - 483f - 0x6F, 0xCC, 0x87, 0xC9, 0x83, 0x6F, 0xCC, 0x88, - 0xC9, 0x83, 0x6F, 0xCC, 0x9B, 0xAD, 0x83, 0x6F, - 0xCC, 0xA3, 0xB5, 0x83, 0x6F, 0xCC, 0xA8, 0xA5, - 0x83, 0x72, 0xCC, 0xA3, 0xB5, 0x83, 0x73, 0xCC, - 0x81, 0xC9, 0x83, 0x73, 0xCC, 0x8C, 0xC9, 0x83, - 0x73, 0xCC, 0xA3, 0xB5, 0x83, 0x75, 0xCC, 0x83, - 0xC9, 0x83, 0x75, 0xCC, 0x84, 0xC9, 0x83, 0x75, - 0xCC, 0x88, 0xC9, 0x83, 0x75, 0xCC, 0x9B, 0xAD, + 0xB1, 0xCC, 0x81, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, + 0x93, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, 0x94, 0xC9, + 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xC9, 0x84, 0xCE, + 0xB5, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB5, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, 0x80, 0xC9, + 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xC9, 0x84, 0xCE, + 0xB7, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0xB7, 0xCD, 0x82, 0xC9, // Bytes 4840 - 487f - 0x84, 0xCE, 0x91, 0xCC, 0x93, 0xC9, 0x84, 0xCE, - 0x91, 0xCC, 0x94, 0xC9, 0x84, 0xCE, 0x95, 0xCC, - 0x93, 0xC9, 0x84, 0xCE, 0x95, 0xCC, 0x94, 0xC9, - 0x84, 0xCE, 0x97, 0xCC, 0x93, 0xC9, 0x84, 0xCE, - 0x97, 0xCC, 0x94, 0xC9, 0x84, 0xCE, 0x99, 0xCC, - 0x93, 0xC9, 0x84, 0xCE, 0x99, 0xCC, 0x94, 0xC9, - 0x84, 0xCE, 0x9F, 0xCC, 0x93, 0xC9, 0x84, 0xCE, - 0x9F, 0xCC, 0x94, 0xC9, 0x84, 0xCE, 0xA5, 0xCC, + 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xC9, 0x84, 0xCE, + 0xB9, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB9, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0xBF, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xC9, 0x84, 0xCF, + 0x85, 0xCC, 0x88, 0xC9, 0x84, 0xCF, 0x85, 0xCC, + 0x93, 0xC9, 0x84, 0xCF, 0x85, 0xCC, 0x94, 0xC9, + 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xC9, 0x84, 0xCF, + 0x89, 0xCC, 0x81, 0xC9, 0x84, 0xCF, 0x89, 0xCC, // Bytes 4880 - 48bf - 0x94, 0xC9, 0x84, 0xCE, 0xA9, 0xCC, 0x93, 0xC9, - 0x84, 0xCE, 0xA9, 0xCC, 0x94, 0xC9, 0x84, 0xCE, - 0xB1, 0xCC, 0x80, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, - 0x81, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, 0x93, 0xC9, - 0x84, 0xCE, 0xB1, 0xCC, 0x94, 0xC9, 0x84, 0xCE, - 0xB1, 0xCD, 0x82, 0xC9, 0x84, 0xCE, 0xB5, 0xCC, - 0x93, 0xC9, 0x84, 0xCE, 0xB5, 0xCC, 0x94, 0xC9, - 0x84, 0xCE, 0xB7, 0xCC, 0x80, 0xC9, 0x84, 0xCE, + 0x93, 0xC9, 0x84, 0xCF, 0x89, 0xCC, 0x94, 0xC9, + 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xC9, 0x86, 0xCE, + 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, // Bytes 48c0 - 48ff - 0xB7, 0xCC, 0x81, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, - 0x93, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, 0x94, 0xC9, - 0x84, 0xCE, 0xB7, 0xCD, 0x82, 0xC9, 0x84, 0xCE, - 0xB9, 0xCC, 0x88, 0xC9, 0x84, 0xCE, 0xB9, 0xCC, - 0x93, 0xC9, 0x84, 0xCE, 0xB9, 0xCC, 0x94, 0xC9, - 0x84, 0xCE, 0xBF, 0xCC, 0x93, 0xC9, 0x84, 0xCE, - 0xBF, 0xCC, 0x94, 0xC9, 0x84, 0xCF, 0x85, 0xCC, - 0x88, 0xC9, 0x84, 0xCF, 0x85, 0xCC, 0x93, 0xC9, + 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, // Bytes 4900 - 493f - 0x84, 0xCF, 0x85, 0xCC, 0x94, 0xC9, 0x84, 0xCF, - 0x89, 0xCC, 0x80, 0xC9, 0x84, 0xCF, 0x89, 0xCC, - 0x81, 0xC9, 0x84, 0xCF, 0x89, 0xCC, 0x93, 0xC9, - 0x84, 0xCF, 0x89, 0xCC, 0x94, 0xC9, 0x84, 0xCF, - 0x89, 0xCD, 0x82, 0xC9, 0x86, 0xCE, 0x91, 0xCC, - 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0x91, 0xCC, - 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0x91, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0x91, 0xCC, + 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, // Bytes 4940 - 497f - 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0x91, 0xCC, - 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0x91, 0xCC, - 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0x97, 0xCC, - 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0x97, 0xCC, - 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0x97, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0x97, 0xCC, - 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0x97, 0xCC, - 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0x97, 0xCC, + 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCF, // Bytes 4980 - 49bf - 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0xA9, 0xCC, - 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0xA9, 0xCC, - 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0xA9, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0xA9, 0xCC, - 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0xA9, 0xCC, - 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0xA9, 0xCC, - 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0xB1, 0xCC, - 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0xB1, 0xCC, + 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x42, 0xCC, + 0x80, 0xC9, 0x32, 0x42, 0xCC, 0x81, 0xC9, 0x32, + 0x42, 0xCC, 0x93, 0xC9, 0x32, 0x43, 0xE1, 0x85, // Bytes 49c0 - 49ff - 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0xB1, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0xB1, 0xCC, - 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0xB1, 0xCC, - 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0xB1, 0xCC, - 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0xB7, 0xCC, - 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0xB7, 0xCC, - 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0xB7, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0xB7, 0xCC, + 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, 0x43, // Bytes 4a00 - 4a3f - 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0xB7, 0xCC, - 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0xB7, 0xCC, - 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCF, 0x89, 0xCC, - 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCF, 0x89, 0xCC, - 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCF, 0x89, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCF, 0x89, 0xCC, - 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCF, 0x89, 0xCC, - 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCF, 0x89, 0xCC, + 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, 0x01, // Bytes 4a40 - 4a7f - 0x94, 0xCD, 0x82, 0xCA, 0x42, 0xCC, 0x80, 0xC9, - 0x32, 0x42, 0xCC, 0x81, 0xC9, 0x32, 0x42, 0xCC, - 0x93, 0xC9, 0x32, 0x44, 0xCC, 0x88, 0xCC, 0x81, - 0xCA, 0x32, 0x43, 0xE3, 0x82, 0x99, 0x0D, 0x03, - 0x43, 0xE3, 0x82, 0x9A, 0x0D, 0x03, 0x46, 0xE0, - 0xBD, 0xB1, 0xE0, 0xBD, 0xB2, 0x9E, 0x26, 0x46, - 0xE0, 0xBD, 0xB1, 0xE0, 0xBD, 0xB4, 0xA2, 0x26, - 0x46, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, + 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, 0x43, + 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x86, + 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, 0x01, + 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, 0x43, + 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, 0x86, + 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, 0x01, + 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x32, + 0x43, 0xE3, 0x82, 0x99, 0x0D, 0x03, 0x43, 0xE3, // Bytes 4a80 - 4abf - 0x26, 0x00, 0x01, + 0x82, 0x9A, 0x0D, 0x03, 0x46, 0xE0, 0xBD, 0xB1, + 0xE0, 0xBD, 0xB2, 0x9E, 0x26, 0x46, 0xE0, 0xBD, + 0xB1, 0xE0, 0xBD, 0xB4, 0xA2, 0x26, 0x46, 0xE0, + 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x26, 0x00, + 0x01, } // lookup returns the trie value for the first UTF-8 encoding in s and @@ -2892,7 +2896,7 @@ func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { return 0 } -// nfcTrie. Total size: 10332 bytes (10.09 KiB). Checksum: ad355b768fddb1b6. +// nfcTrie. Total size: 10332 bytes (10.09 KiB). Checksum: 51cc525b297fc970. type nfcTrie struct{} func newNfcTrie(i int) *nfcTrie { @@ -2928,22 +2932,22 @@ var nfcValues = [2944]uint16{ 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, // Block 0x2, offset 0x80 // Block 0x3, offset 0xc0 - 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x471e, 0xc3: 0x2f79, 0xc4: 0x472d, 0xc5: 0x4732, - 0xc6: 0xa000, 0xc7: 0x473c, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x4741, 0xcb: 0x2ffb, - 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x4755, 0xd1: 0x3104, - 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x475f, 0xd5: 0x4764, 0xd6: 0x4773, - 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x47a5, 0xdd: 0x3235, - 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x47af, 0xe3: 0x3285, - 0xe4: 0x47be, 0xe5: 0x47c3, 0xe6: 0xa000, 0xe7: 0x47cd, 0xe8: 0x32ee, 0xe9: 0x32f3, - 0xea: 0x47d2, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x47e6, - 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x47f0, 0xf5: 0x47f5, - 0xf6: 0x4804, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3, - 0xfc: 0x4836, 0xfd: 0x3550, 0xff: 0x3569, + 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x4688, 0xc3: 0x2f79, 0xc4: 0x4697, 0xc5: 0x469c, + 0xc6: 0xa000, 0xc7: 0x46a6, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x46ab, 0xcb: 0x2ffb, + 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x46bf, 0xd1: 0x3104, + 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x46c9, 0xd5: 0x46ce, 0xd6: 0x46dd, + 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x470f, 0xdd: 0x3235, + 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x4719, 0xe3: 0x3285, + 0xe4: 0x4728, 0xe5: 0x472d, 0xe6: 0xa000, 0xe7: 0x4737, 0xe8: 0x32ee, 0xe9: 0x32f3, + 0xea: 0x473c, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x4750, + 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x475a, 0xf5: 0x475f, + 0xf6: 0x476e, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3, + 0xfc: 0x47a0, 0xfd: 0x3550, 0xff: 0x3569, // Block 0x4, offset 0x100 - 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x4723, 0x103: 0x47b4, 0x104: 0x2f9c, 0x105: 0x32a8, + 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x468d, 0x103: 0x471e, 0x104: 0x2f9c, 0x105: 0x32a8, 0x106: 0x2fb0, 0x107: 0x32bc, 0x108: 0x2fb5, 0x109: 0x32c1, 0x10a: 0x2fba, 0x10b: 0x32c6, 0x10c: 0x2fbf, 0x10d: 0x32cb, 0x10e: 0x2fc9, 0x10f: 0x32d5, - 0x112: 0x4746, 0x113: 0x47d7, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302, + 0x112: 0x46b0, 0x113: 0x4741, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302, 0x118: 0x3014, 0x119: 0x3320, 0x11a: 0x3005, 0x11b: 0x3311, 0x11c: 0x302d, 0x11d: 0x3339, 0x11e: 0x3037, 0x11f: 0x3343, 0x120: 0x303c, 0x121: 0x3348, 0x122: 0x3046, 0x123: 0x3352, 0x124: 0x304b, 0x125: 0x3357, 0x128: 0x307d, 0x129: 0x338e, @@ -2954,12 +2958,12 @@ var nfcValues = [2944]uint16{ // Block 0x5, offset 0x140 0x143: 0x30ff, 0x144: 0x3410, 0x145: 0x3118, 0x146: 0x3429, 0x147: 0x310e, 0x148: 0x341f, - 0x14c: 0x4769, 0x14d: 0x47fa, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c, + 0x14c: 0x46d3, 0x14d: 0x4764, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c, 0x154: 0x3159, 0x155: 0x346a, 0x156: 0x3172, 0x157: 0x3483, - 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x478c, 0x15b: 0x481d, 0x15c: 0x317c, 0x15d: 0x348d, - 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x4791, 0x161: 0x4822, 0x162: 0x31a4, 0x163: 0x34ba, - 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x479b, 0x169: 0x482c, - 0x16a: 0x47a0, 0x16b: 0x4831, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2, + 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x46f6, 0x15b: 0x4787, 0x15c: 0x317c, 0x15d: 0x348d, + 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x46fb, 0x161: 0x478c, 0x162: 0x31a4, 0x163: 0x34ba, + 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x4705, 0x169: 0x4796, + 0x16a: 0x470a, 0x16b: 0x479b, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2, 0x170: 0x31d1, 0x171: 0x34e7, 0x172: 0x31ef, 0x173: 0x3505, 0x174: 0x3212, 0x175: 0x3528, 0x176: 0x323a, 0x177: 0x3555, 0x178: 0x324e, 0x179: 0x325d, 0x17a: 0x357d, 0x17b: 0x3267, 0x17c: 0x3587, 0x17d: 0x326c, 0x17e: 0x358c, 0x17f: 0xa000, @@ -2971,7 +2975,7 @@ var nfcValues = [2944]uint16{ 0x198: 0x3b57, 0x199: 0x39d6, 0x19a: 0x3b65, 0x19b: 0x39c1, 0x19c: 0x3b50, 0x19e: 0x38b0, 0x19f: 0x3a3f, 0x1a0: 0x38a9, 0x1a1: 0x3a38, 0x1a2: 0x35b3, 0x1a3: 0x35c5, 0x1a6: 0x3041, 0x1a7: 0x334d, 0x1a8: 0x30be, 0x1a9: 0x33cf, - 0x1aa: 0x4782, 0x1ab: 0x4813, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd, + 0x1aa: 0x46ec, 0x1ab: 0x477d, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd, 0x1b0: 0x33c5, 0x1b4: 0x3028, 0x1b5: 0x3334, 0x1b8: 0x30fa, 0x1b9: 0x340b, 0x1ba: 0x38b7, 0x1bb: 0x3a46, 0x1bc: 0x35ad, 0x1bd: 0x35bf, 0x1be: 0x35b9, 0x1bf: 0x35cb, @@ -2982,8 +2986,8 @@ var nfcValues = [2944]uint16{ 0x1d2: 0x316d, 0x1d3: 0x347e, 0x1d4: 0x31db, 0x1d5: 0x34f1, 0x1d6: 0x31e0, 0x1d7: 0x34f6, 0x1d8: 0x3186, 0x1d9: 0x3497, 0x1da: 0x319f, 0x1db: 0x34b5, 0x1de: 0x305a, 0x1df: 0x3366, - 0x1e6: 0x4728, 0x1e7: 0x47b9, 0x1e8: 0x4750, 0x1e9: 0x47e1, - 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x476e, 0x1ef: 0x47ff, + 0x1e6: 0x4692, 0x1e7: 0x4723, 0x1e8: 0x46ba, 0x1e9: 0x474b, + 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x46d8, 0x1ef: 0x4769, 0x1f0: 0x3958, 0x1f1: 0x3ae7, 0x1f2: 0x3244, 0x1f3: 0x355f, // Block 0x8, offset 0x200 0x200: 0x9932, 0x201: 0x9932, 0x202: 0x9932, 0x203: 0x9932, 0x204: 0x9932, 0x205: 0x8132, @@ -2998,7 +3002,7 @@ var nfcValues = [2944]uint16{ 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812d, 0x23a: 0x812d, 0x23b: 0x812d, 0x23c: 0x812d, 0x23d: 0x8132, 0x23e: 0x8132, 0x23f: 0x8132, // Block 0x9, offset 0x240 - 0x240: 0x4a44, 0x241: 0x4a49, 0x242: 0x9932, 0x243: 0x4a4e, 0x244: 0x4a53, 0x245: 0x9936, + 0x240: 0x49ae, 0x241: 0x49b3, 0x242: 0x9932, 0x243: 0x49b8, 0x244: 0x4a71, 0x245: 0x9936, 0x246: 0x8132, 0x247: 0x812d, 0x248: 0x812d, 0x249: 0x812d, 0x24a: 0x8132, 0x24b: 0x8132, 0x24c: 0x8132, 0x24d: 0x812d, 0x24e: 0x812d, 0x250: 0x8132, 0x251: 0x8132, 0x252: 0x8132, 0x253: 0x812d, 0x254: 0x812d, 0x255: 0x812d, 0x256: 0x812d, 0x257: 0x8132, @@ -3017,7 +3021,7 @@ var nfcValues = [2944]uint16{ 0x299: 0xa000, 0x29f: 0xa000, 0x2a1: 0xa000, 0x2a5: 0xa000, 0x2a9: 0xa000, - 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x4894, 0x2ad: 0x3697, 0x2ae: 0x48be, 0x2af: 0x36a9, + 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x47fe, 0x2ad: 0x3697, 0x2ae: 0x4828, 0x2af: 0x36a9, 0x2b0: 0x3e70, 0x2b1: 0xa000, 0x2b5: 0xa000, 0x2b7: 0xa000, 0x2b9: 0xa000, 0x2bf: 0xa000, @@ -3078,15 +3082,15 @@ var nfcValues = [2944]uint16{ 0x424: 0x305f, 0x425: 0x336b, 0x426: 0x3055, 0x427: 0x3361, 0x428: 0x3064, 0x429: 0x3370, 0x42a: 0x3069, 0x42b: 0x3375, 0x42c: 0x30af, 0x42d: 0x33bb, 0x42e: 0x390b, 0x42f: 0x3a9a, 0x430: 0x30b9, 0x431: 0x33ca, 0x432: 0x30c3, 0x433: 0x33d4, 0x434: 0x30cd, 0x435: 0x33de, - 0x436: 0x475a, 0x437: 0x47eb, 0x438: 0x3912, 0x439: 0x3aa1, 0x43a: 0x30e6, 0x43b: 0x33f7, + 0x436: 0x46c4, 0x437: 0x4755, 0x438: 0x3912, 0x439: 0x3aa1, 0x43a: 0x30e6, 0x43b: 0x33f7, 0x43c: 0x30e1, 0x43d: 0x33f2, 0x43e: 0x30eb, 0x43f: 0x33fc, // Block 0x11, offset 0x440 0x440: 0x30f0, 0x441: 0x3401, 0x442: 0x30f5, 0x443: 0x3406, 0x444: 0x3109, 0x445: 0x341a, 0x446: 0x3113, 0x447: 0x3424, 0x448: 0x3122, 0x449: 0x3433, 0x44a: 0x311d, 0x44b: 0x342e, 0x44c: 0x3935, 0x44d: 0x3ac4, 0x44e: 0x3943, 0x44f: 0x3ad2, 0x450: 0x394a, 0x451: 0x3ad9, 0x452: 0x3951, 0x453: 0x3ae0, 0x454: 0x314f, 0x455: 0x3460, 0x456: 0x3154, 0x457: 0x3465, - 0x458: 0x315e, 0x459: 0x346f, 0x45a: 0x4787, 0x45b: 0x4818, 0x45c: 0x3997, 0x45d: 0x3b26, - 0x45e: 0x3177, 0x45f: 0x3488, 0x460: 0x3181, 0x461: 0x3492, 0x462: 0x4796, 0x463: 0x4827, + 0x458: 0x315e, 0x459: 0x346f, 0x45a: 0x46f1, 0x45b: 0x4782, 0x45c: 0x3997, 0x45d: 0x3b26, + 0x45e: 0x3177, 0x45f: 0x3488, 0x460: 0x3181, 0x461: 0x3492, 0x462: 0x4700, 0x463: 0x4791, 0x464: 0x399e, 0x465: 0x3b2d, 0x466: 0x39a5, 0x467: 0x3b34, 0x468: 0x39ac, 0x469: 0x3b3b, 0x46a: 0x3190, 0x46b: 0x34a1, 0x46c: 0x319a, 0x46d: 0x34b0, 0x46e: 0x31ae, 0x46f: 0x34c4, 0x470: 0x31a9, 0x471: 0x34bf, 0x472: 0x31ea, 0x473: 0x3500, 0x474: 0x31f9, 0x475: 0x350f, @@ -3098,16 +3102,16 @@ var nfcValues = [2944]uint16{ 0x48c: 0x322b, 0x48d: 0x3546, 0x48e: 0x3249, 0x48f: 0x3564, 0x490: 0x3262, 0x491: 0x3582, 0x492: 0x3271, 0x493: 0x3591, 0x494: 0x3276, 0x495: 0x3596, 0x496: 0x337a, 0x497: 0x34a6, 0x498: 0x3537, 0x499: 0x3573, 0x49b: 0x35d1, - 0x4a0: 0x4737, 0x4a1: 0x47c8, 0x4a2: 0x2f83, 0x4a3: 0x328f, + 0x4a0: 0x46a1, 0x4a1: 0x4732, 0x4a2: 0x2f83, 0x4a3: 0x328f, 0x4a4: 0x3878, 0x4a5: 0x3a07, 0x4a6: 0x3871, 0x4a7: 0x3a00, 0x4a8: 0x3886, 0x4a9: 0x3a15, 0x4aa: 0x387f, 0x4ab: 0x3a0e, 0x4ac: 0x38be, 0x4ad: 0x3a4d, 0x4ae: 0x3894, 0x4af: 0x3a23, 0x4b0: 0x388d, 0x4b1: 0x3a1c, 0x4b2: 0x38a2, 0x4b3: 0x3a31, 0x4b4: 0x389b, 0x4b5: 0x3a2a, - 0x4b6: 0x38c5, 0x4b7: 0x3a54, 0x4b8: 0x474b, 0x4b9: 0x47dc, 0x4ba: 0x3000, 0x4bb: 0x330c, + 0x4b6: 0x38c5, 0x4b7: 0x3a54, 0x4b8: 0x46b5, 0x4b9: 0x4746, 0x4ba: 0x3000, 0x4bb: 0x330c, 0x4bc: 0x2fec, 0x4bd: 0x32f8, 0x4be: 0x38da, 0x4bf: 0x3a69, // Block 0x13, offset 0x4c0 0x4c0: 0x38d3, 0x4c1: 0x3a62, 0x4c2: 0x38e8, 0x4c3: 0x3a77, 0x4c4: 0x38e1, 0x4c5: 0x3a70, 0x4c6: 0x38fd, 0x4c7: 0x3a8c, 0x4c8: 0x3091, 0x4c9: 0x339d, 0x4ca: 0x30a5, 0x4cb: 0x33b1, - 0x4cc: 0x477d, 0x4cd: 0x480e, 0x4ce: 0x3136, 0x4cf: 0x3447, 0x4d0: 0x3920, 0x4d1: 0x3aaf, + 0x4cc: 0x46e7, 0x4cd: 0x4778, 0x4ce: 0x3136, 0x4cf: 0x3447, 0x4d0: 0x3920, 0x4d1: 0x3aaf, 0x4d2: 0x3919, 0x4d3: 0x3aa8, 0x4d4: 0x392e, 0x4d5: 0x3abd, 0x4d6: 0x3927, 0x4d7: 0x3ab6, 0x4d8: 0x3989, 0x4d9: 0x3b18, 0x4da: 0x396d, 0x4db: 0x3afc, 0x4dc: 0x3966, 0x4dd: 0x3af5, 0x4de: 0x397b, 0x4df: 0x3b0a, 0x4e0: 0x3974, 0x4e1: 0x3b03, 0x4e2: 0x3982, 0x4e3: 0x3b11, @@ -3116,29 +3120,29 @@ var nfcValues = [2944]uint16{ 0x4f0: 0x39f9, 0x4f1: 0x3b88, 0x4f2: 0x3230, 0x4f3: 0x354b, 0x4f4: 0x3258, 0x4f5: 0x3578, 0x4f6: 0x3253, 0x4f7: 0x356e, 0x4f8: 0x323f, 0x4f9: 0x355a, // Block 0x14, offset 0x500 - 0x500: 0x489a, 0x501: 0x48a0, 0x502: 0x49b4, 0x503: 0x49cc, 0x504: 0x49bc, 0x505: 0x49d4, - 0x506: 0x49c4, 0x507: 0x49dc, 0x508: 0x4840, 0x509: 0x4846, 0x50a: 0x4924, 0x50b: 0x493c, - 0x50c: 0x492c, 0x50d: 0x4944, 0x50e: 0x4934, 0x50f: 0x494c, 0x510: 0x48ac, 0x511: 0x48b2, + 0x500: 0x4804, 0x501: 0x480a, 0x502: 0x491e, 0x503: 0x4936, 0x504: 0x4926, 0x505: 0x493e, + 0x506: 0x492e, 0x507: 0x4946, 0x508: 0x47aa, 0x509: 0x47b0, 0x50a: 0x488e, 0x50b: 0x48a6, + 0x50c: 0x4896, 0x50d: 0x48ae, 0x50e: 0x489e, 0x50f: 0x48b6, 0x510: 0x4816, 0x511: 0x481c, 0x512: 0x3db8, 0x513: 0x3dc8, 0x514: 0x3dc0, 0x515: 0x3dd0, - 0x518: 0x484c, 0x519: 0x4852, 0x51a: 0x3ce8, 0x51b: 0x3cf8, 0x51c: 0x3cf0, 0x51d: 0x3d00, - 0x520: 0x48c4, 0x521: 0x48ca, 0x522: 0x49e4, 0x523: 0x49fc, - 0x524: 0x49ec, 0x525: 0x4a04, 0x526: 0x49f4, 0x527: 0x4a0c, 0x528: 0x4858, 0x529: 0x485e, - 0x52a: 0x4954, 0x52b: 0x496c, 0x52c: 0x495c, 0x52d: 0x4974, 0x52e: 0x4964, 0x52f: 0x497c, - 0x530: 0x48dc, 0x531: 0x48e2, 0x532: 0x3e18, 0x533: 0x3e30, 0x534: 0x3e20, 0x535: 0x3e38, - 0x536: 0x3e28, 0x537: 0x3e40, 0x538: 0x4864, 0x539: 0x486a, 0x53a: 0x3d18, 0x53b: 0x3d30, + 0x518: 0x47b6, 0x519: 0x47bc, 0x51a: 0x3ce8, 0x51b: 0x3cf8, 0x51c: 0x3cf0, 0x51d: 0x3d00, + 0x520: 0x482e, 0x521: 0x4834, 0x522: 0x494e, 0x523: 0x4966, + 0x524: 0x4956, 0x525: 0x496e, 0x526: 0x495e, 0x527: 0x4976, 0x528: 0x47c2, 0x529: 0x47c8, + 0x52a: 0x48be, 0x52b: 0x48d6, 0x52c: 0x48c6, 0x52d: 0x48de, 0x52e: 0x48ce, 0x52f: 0x48e6, + 0x530: 0x4846, 0x531: 0x484c, 0x532: 0x3e18, 0x533: 0x3e30, 0x534: 0x3e20, 0x535: 0x3e38, + 0x536: 0x3e28, 0x537: 0x3e40, 0x538: 0x47ce, 0x539: 0x47d4, 0x53a: 0x3d18, 0x53b: 0x3d30, 0x53c: 0x3d20, 0x53d: 0x3d38, 0x53e: 0x3d28, 0x53f: 0x3d40, // Block 0x15, offset 0x540 - 0x540: 0x48e8, 0x541: 0x48ee, 0x542: 0x3e48, 0x543: 0x3e58, 0x544: 0x3e50, 0x545: 0x3e60, - 0x548: 0x4870, 0x549: 0x4876, 0x54a: 0x3d48, 0x54b: 0x3d58, - 0x54c: 0x3d50, 0x54d: 0x3d60, 0x550: 0x48fa, 0x551: 0x4900, + 0x540: 0x4852, 0x541: 0x4858, 0x542: 0x3e48, 0x543: 0x3e58, 0x544: 0x3e50, 0x545: 0x3e60, + 0x548: 0x47da, 0x549: 0x47e0, 0x54a: 0x3d48, 0x54b: 0x3d58, + 0x54c: 0x3d50, 0x54d: 0x3d60, 0x550: 0x4864, 0x551: 0x486a, 0x552: 0x3e80, 0x553: 0x3e98, 0x554: 0x3e88, 0x555: 0x3ea0, 0x556: 0x3e90, 0x557: 0x3ea8, - 0x559: 0x487c, 0x55b: 0x3d68, 0x55d: 0x3d70, - 0x55f: 0x3d78, 0x560: 0x4912, 0x561: 0x4918, 0x562: 0x4a14, 0x563: 0x4a2c, - 0x564: 0x4a1c, 0x565: 0x4a34, 0x566: 0x4a24, 0x567: 0x4a3c, 0x568: 0x4882, 0x569: 0x4888, - 0x56a: 0x4984, 0x56b: 0x499c, 0x56c: 0x498c, 0x56d: 0x49a4, 0x56e: 0x4994, 0x56f: 0x49ac, - 0x570: 0x488e, 0x571: 0x43b4, 0x572: 0x3691, 0x573: 0x43ba, 0x574: 0x48b8, 0x575: 0x43c0, - 0x576: 0x36a3, 0x577: 0x43c6, 0x578: 0x36c1, 0x579: 0x43cc, 0x57a: 0x36d9, 0x57b: 0x43d2, - 0x57c: 0x4906, 0x57d: 0x43d8, + 0x559: 0x47e6, 0x55b: 0x3d68, 0x55d: 0x3d70, + 0x55f: 0x3d78, 0x560: 0x487c, 0x561: 0x4882, 0x562: 0x497e, 0x563: 0x4996, + 0x564: 0x4986, 0x565: 0x499e, 0x566: 0x498e, 0x567: 0x49a6, 0x568: 0x47ec, 0x569: 0x47f2, + 0x56a: 0x48ee, 0x56b: 0x4906, 0x56c: 0x48f6, 0x56d: 0x490e, 0x56e: 0x48fe, 0x56f: 0x4916, + 0x570: 0x47f8, 0x571: 0x431e, 0x572: 0x3691, 0x573: 0x4324, 0x574: 0x4822, 0x575: 0x432a, + 0x576: 0x36a3, 0x577: 0x4330, 0x578: 0x36c1, 0x579: 0x4336, 0x57a: 0x36d9, 0x57b: 0x433c, + 0x57c: 0x4870, 0x57d: 0x4342, // Block 0x16, offset 0x580 0x580: 0x3da0, 0x581: 0x3da8, 0x582: 0x4184, 0x583: 0x41a2, 0x584: 0x418e, 0x585: 0x41ac, 0x586: 0x4198, 0x587: 0x41b6, 0x588: 0x3cd8, 0x589: 0x3ce0, 0x58a: 0x40d0, 0x58b: 0x40ee, @@ -3149,19 +3153,19 @@ var nfcValues = [2944]uint16{ 0x5a4: 0x4206, 0x5a5: 0x4224, 0x5a6: 0x4210, 0x5a7: 0x422e, 0x5a8: 0x3d80, 0x5a9: 0x3d88, 0x5aa: 0x4148, 0x5ab: 0x4166, 0x5ac: 0x4152, 0x5ad: 0x4170, 0x5ae: 0x415c, 0x5af: 0x417a, 0x5b0: 0x3685, 0x5b1: 0x367f, 0x5b2: 0x3d90, 0x5b3: 0x368b, 0x5b4: 0x3d98, - 0x5b6: 0x48a6, 0x5b7: 0x3db0, 0x5b8: 0x35f5, 0x5b9: 0x35ef, 0x5ba: 0x35e3, 0x5bb: 0x4384, + 0x5b6: 0x4810, 0x5b7: 0x3db0, 0x5b8: 0x35f5, 0x5b9: 0x35ef, 0x5ba: 0x35e3, 0x5bb: 0x42ee, 0x5bc: 0x35fb, 0x5bd: 0x8100, 0x5be: 0x01d3, 0x5bf: 0xa100, // Block 0x17, offset 0x5c0 0x5c0: 0x8100, 0x5c1: 0x35a7, 0x5c2: 0x3dd8, 0x5c3: 0x369d, 0x5c4: 0x3de0, - 0x5c6: 0x48d0, 0x5c7: 0x3df8, 0x5c8: 0x3601, 0x5c9: 0x438a, 0x5ca: 0x360d, 0x5cb: 0x4390, + 0x5c6: 0x483a, 0x5c7: 0x3df8, 0x5c8: 0x3601, 0x5c9: 0x42f4, 0x5ca: 0x360d, 0x5cb: 0x42fa, 0x5cc: 0x3619, 0x5cd: 0x3b8f, 0x5ce: 0x3b96, 0x5cf: 0x3b9d, 0x5d0: 0x36b5, 0x5d1: 0x36af, - 0x5d2: 0x3e00, 0x5d3: 0x457a, 0x5d6: 0x36bb, 0x5d7: 0x3e10, - 0x5d8: 0x3631, 0x5d9: 0x362b, 0x5da: 0x361f, 0x5db: 0x4396, 0x5dd: 0x3ba4, - 0x5de: 0x3bab, 0x5df: 0x3bb2, 0x5e0: 0x36eb, 0x5e1: 0x36e5, 0x5e2: 0x3e68, 0x5e3: 0x4582, + 0x5d2: 0x3e00, 0x5d3: 0x44e4, 0x5d6: 0x36bb, 0x5d7: 0x3e10, + 0x5d8: 0x3631, 0x5d9: 0x362b, 0x5da: 0x361f, 0x5db: 0x4300, 0x5dd: 0x3ba4, + 0x5de: 0x3bab, 0x5df: 0x3bb2, 0x5e0: 0x36eb, 0x5e1: 0x36e5, 0x5e2: 0x3e68, 0x5e3: 0x44ec, 0x5e4: 0x36cd, 0x5e5: 0x36d3, 0x5e6: 0x36f1, 0x5e7: 0x3e78, 0x5e8: 0x3661, 0x5e9: 0x365b, - 0x5ea: 0x364f, 0x5eb: 0x43a2, 0x5ec: 0x3649, 0x5ed: 0x359b, 0x5ee: 0x437e, 0x5ef: 0x0081, + 0x5ea: 0x364f, 0x5eb: 0x430c, 0x5ec: 0x3649, 0x5ed: 0x359b, 0x5ee: 0x42e8, 0x5ef: 0x0081, 0x5f2: 0x3eb0, 0x5f3: 0x36f7, 0x5f4: 0x3eb8, - 0x5f6: 0x491e, 0x5f7: 0x3ed0, 0x5f8: 0x363d, 0x5f9: 0x439c, 0x5fa: 0x366d, 0x5fb: 0x43ae, + 0x5f6: 0x4888, 0x5f7: 0x3ed0, 0x5f8: 0x363d, 0x5f9: 0x4306, 0x5fa: 0x366d, 0x5fb: 0x4318, 0x5fc: 0x3679, 0x5fd: 0x4256, 0x5fe: 0xa100, // Block 0x18, offset 0x600 0x601: 0x3c06, 0x603: 0xa000, 0x604: 0x3c0d, 0x605: 0xa000, @@ -3519,8 +3523,8 @@ var nfcSparseValues = [688]valueRange{ {value: 0x8100, lo: 0xb8, hi: 0xb8}, // Block 0x1, offset 0x5 {value: 0x0091, lo: 0x03}, - {value: 0x4778, lo: 0xa0, hi: 0xa1}, - {value: 0x47aa, lo: 0xaf, hi: 0xb0}, + {value: 0x46e2, lo: 0xa0, hi: 0xa1}, + {value: 0x4714, lo: 0xaf, hi: 0xb0}, {value: 0xa000, lo: 0xb7, hi: 0xb7}, // Block 0x2, offset 0x9 {value: 0x0000, lo: 0x01}, @@ -3533,11 +3537,11 @@ var nfcSparseValues = [688]valueRange{ {value: 0xa000, lo: 0x81, hi: 0x81}, {value: 0xa000, lo: 0x85, hi: 0x85}, {value: 0xa000, lo: 0x89, hi: 0x89}, - {value: 0x48d6, lo: 0x8a, hi: 0x8a}, - {value: 0x48f4, lo: 0x8b, hi: 0x8b}, + {value: 0x4840, lo: 0x8a, hi: 0x8a}, + {value: 0x485e, lo: 0x8b, hi: 0x8b}, {value: 0x36c7, lo: 0x8c, hi: 0x8c}, {value: 0x36df, lo: 0x8d, hi: 0x8d}, - {value: 0x490c, lo: 0x8e, hi: 0x8e}, + {value: 0x4876, lo: 0x8e, hi: 0x8e}, {value: 0xa000, lo: 0x92, hi: 0x92}, {value: 0x36fd, lo: 0x93, hi: 0x94}, // Block 0x5, offset 0x18 @@ -3665,7 +3669,7 @@ var nfcSparseValues = [688]valueRange{ {value: 0x812d, lo: 0x92, hi: 0x92}, {value: 0x8132, lo: 0x93, hi: 0x93}, {value: 0x8132, lo: 0x94, hi: 0x94}, - {value: 0x45b2, lo: 0x98, hi: 0x9f}, + {value: 0x451c, lo: 0x98, hi: 0x9f}, // Block 0x12, offset 0x89 {value: 0x0000, lo: 0x02}, {value: 0x8102, lo: 0xbc, hi: 0xbc}, @@ -3676,18 +3680,18 @@ var nfcSparseValues = [688]valueRange{ {value: 0x2c9e, lo: 0x8b, hi: 0x8c}, {value: 0x8104, lo: 0x8d, hi: 0x8d}, {value: 0x9900, lo: 0x97, hi: 0x97}, - {value: 0x45f2, lo: 0x9c, hi: 0x9d}, - {value: 0x4602, lo: 0x9f, hi: 0x9f}, + {value: 0x455c, lo: 0x9c, hi: 0x9d}, + {value: 0x456c, lo: 0x9f, hi: 0x9f}, // Block 0x14, offset 0x93 {value: 0x0000, lo: 0x03}, - {value: 0x462a, lo: 0xb3, hi: 0xb3}, - {value: 0x4632, lo: 0xb6, hi: 0xb6}, + {value: 0x4594, lo: 0xb3, hi: 0xb3}, + {value: 0x459c, lo: 0xb6, hi: 0xb6}, {value: 0x8102, lo: 0xbc, hi: 0xbc}, // Block 0x15, offset 0x97 {value: 0x0008, lo: 0x03}, {value: 0x8104, lo: 0x8d, hi: 0x8d}, - {value: 0x460a, lo: 0x99, hi: 0x9b}, - {value: 0x4622, lo: 0x9e, hi: 0x9e}, + {value: 0x4574, lo: 0x99, hi: 0x9b}, + {value: 0x458c, lo: 0x9e, hi: 0x9e}, // Block 0x16, offset 0x9b {value: 0x0000, lo: 0x01}, {value: 0x8102, lo: 0xbc, hi: 0xbc}, @@ -3702,8 +3706,8 @@ var nfcSparseValues = [688]valueRange{ {value: 0x2cbe, lo: 0x8c, hi: 0x8c}, {value: 0x8104, lo: 0x8d, hi: 0x8d}, {value: 0x9900, lo: 0x96, hi: 0x97}, - {value: 0x463a, lo: 0x9c, hi: 0x9c}, - {value: 0x4642, lo: 0x9d, hi: 0x9d}, + {value: 0x45a4, lo: 0x9c, hi: 0x9c}, + {value: 0x45ac, lo: 0x9d, hi: 0x9d}, // Block 0x19, offset 0xa8 {value: 0x0000, lo: 0x03}, {value: 0xa000, lo: 0x92, hi: 0x92}, @@ -3787,18 +3791,18 @@ var nfcSparseValues = [688]valueRange{ {value: 0x263d, lo: 0xa9, hi: 0xa9}, {value: 0x8126, lo: 0xb1, hi: 0xb1}, {value: 0x8127, lo: 0xb2, hi: 0xb2}, - {value: 0x4a66, lo: 0xb3, hi: 0xb3}, + {value: 0x4a84, lo: 0xb3, hi: 0xb3}, {value: 0x8128, lo: 0xb4, hi: 0xb4}, - {value: 0x4a6f, lo: 0xb5, hi: 0xb5}, - {value: 0x464a, lo: 0xb6, hi: 0xb6}, + {value: 0x4a8d, lo: 0xb5, hi: 0xb5}, + {value: 0x45b4, lo: 0xb6, hi: 0xb6}, {value: 0x8200, lo: 0xb7, hi: 0xb7}, - {value: 0x4652, lo: 0xb8, hi: 0xb8}, + {value: 0x45bc, lo: 0xb8, hi: 0xb8}, {value: 0x8200, lo: 0xb9, hi: 0xb9}, {value: 0x8127, lo: 0xba, hi: 0xbd}, // Block 0x27, offset 0xf5 {value: 0x0000, lo: 0x0b}, {value: 0x8127, lo: 0x80, hi: 0x80}, - {value: 0x4a78, lo: 0x81, hi: 0x81}, + {value: 0x4a96, lo: 0x81, hi: 0x81}, {value: 0x8132, lo: 0x82, hi: 0x83}, {value: 0x8104, lo: 0x84, hi: 0x84}, {value: 0x8132, lo: 0x86, hi: 0x87}, @@ -3975,7 +3979,7 @@ var nfcSparseValues = [688]valueRange{ {value: 0x048b, lo: 0xa9, hi: 0xaa}, // Block 0x45, offset 0x189 {value: 0x0000, lo: 0x01}, - {value: 0x4573, lo: 0x9c, hi: 0x9c}, + {value: 0x44dd, lo: 0x9c, hi: 0x9c}, // Block 0x46, offset 0x18b {value: 0x0000, lo: 0x01}, {value: 0x8132, lo: 0xaf, hi: 0xb1}, @@ -3994,12 +3998,12 @@ var nfcSparseValues = [688]valueRange{ {value: 0x812f, lo: 0xae, hi: 0xaf}, // Block 0x4a, offset 0x197 {value: 0x0000, lo: 0x03}, - {value: 0x4a81, lo: 0xb3, hi: 0xb3}, - {value: 0x4a81, lo: 0xb5, hi: 0xb6}, - {value: 0x4a81, lo: 0xba, hi: 0xbf}, + {value: 0x4a9f, lo: 0xb3, hi: 0xb3}, + {value: 0x4a9f, lo: 0xb5, hi: 0xb6}, + {value: 0x4a9f, lo: 0xba, hi: 0xbf}, // Block 0x4b, offset 0x19b {value: 0x0000, lo: 0x01}, - {value: 0x4a81, lo: 0x8f, hi: 0xa3}, + {value: 0x4a9f, lo: 0x8f, hi: 0xa3}, // Block 0x4c, offset 0x19d {value: 0x0000, lo: 0x01}, {value: 0x8100, lo: 0xae, hi: 0xbe}, @@ -4119,29 +4123,29 @@ var nfcSparseValues = [688]valueRange{ {value: 0xc600, lo: 0x89, hi: 0xa3}, // Block 0x63, offset 0x1fb {value: 0x0006, lo: 0x0d}, - {value: 0x4426, lo: 0x9d, hi: 0x9d}, + {value: 0x4390, lo: 0x9d, hi: 0x9d}, {value: 0x8115, lo: 0x9e, hi: 0x9e}, - {value: 0x4498, lo: 0x9f, hi: 0x9f}, - {value: 0x4486, lo: 0xaa, hi: 0xab}, - {value: 0x458a, lo: 0xac, hi: 0xac}, - {value: 0x4592, lo: 0xad, hi: 0xad}, - {value: 0x43de, lo: 0xae, hi: 0xb1}, - {value: 0x43fc, lo: 0xb2, hi: 0xb4}, - {value: 0x4414, lo: 0xb5, hi: 0xb6}, - {value: 0x4420, lo: 0xb8, hi: 0xb8}, - {value: 0x442c, lo: 0xb9, hi: 0xbb}, - {value: 0x4444, lo: 0xbc, hi: 0xbc}, - {value: 0x444a, lo: 0xbe, hi: 0xbe}, + {value: 0x4402, lo: 0x9f, hi: 0x9f}, + {value: 0x43f0, lo: 0xaa, hi: 0xab}, + {value: 0x44f4, lo: 0xac, hi: 0xac}, + {value: 0x44fc, lo: 0xad, hi: 0xad}, + {value: 0x4348, lo: 0xae, hi: 0xb1}, + {value: 0x4366, lo: 0xb2, hi: 0xb4}, + {value: 0x437e, lo: 0xb5, hi: 0xb6}, + {value: 0x438a, lo: 0xb8, hi: 0xb8}, + {value: 0x4396, lo: 0xb9, hi: 0xbb}, + {value: 0x43ae, lo: 0xbc, hi: 0xbc}, + {value: 0x43b4, lo: 0xbe, hi: 0xbe}, // Block 0x64, offset 0x209 {value: 0x0006, lo: 0x08}, - {value: 0x4450, lo: 0x80, hi: 0x81}, - {value: 0x445c, lo: 0x83, hi: 0x84}, - {value: 0x446e, lo: 0x86, hi: 0x89}, - {value: 0x4492, lo: 0x8a, hi: 0x8a}, - {value: 0x440e, lo: 0x8b, hi: 0x8b}, - {value: 0x43f6, lo: 0x8c, hi: 0x8c}, - {value: 0x443e, lo: 0x8d, hi: 0x8d}, - {value: 0x4468, lo: 0x8e, hi: 0x8e}, + {value: 0x43ba, lo: 0x80, hi: 0x81}, + {value: 0x43c6, lo: 0x83, hi: 0x84}, + {value: 0x43d8, lo: 0x86, hi: 0x89}, + {value: 0x43fc, lo: 0x8a, hi: 0x8a}, + {value: 0x4378, lo: 0x8b, hi: 0x8b}, + {value: 0x4360, lo: 0x8c, hi: 0x8c}, + {value: 0x43a8, lo: 0x8d, hi: 0x8d}, + {value: 0x43d2, lo: 0x8e, hi: 0x8e}, // Block 0x65, offset 0x212 {value: 0x0000, lo: 0x02}, {value: 0x8100, lo: 0xa4, hi: 0xa5}, @@ -4179,16 +4183,16 @@ var nfcSparseValues = [688]valueRange{ {value: 0x8100, lo: 0xb5, hi: 0xba}, // Block 0x6e, offset 0x22c {value: 0x0000, lo: 0x04}, - {value: 0x4a81, lo: 0x9e, hi: 0x9f}, - {value: 0x4a81, lo: 0xa3, hi: 0xa3}, - {value: 0x4a81, lo: 0xa5, hi: 0xa6}, - {value: 0x4a81, lo: 0xaa, hi: 0xaf}, + {value: 0x4a9f, lo: 0x9e, hi: 0x9f}, + {value: 0x4a9f, lo: 0xa3, hi: 0xa3}, + {value: 0x4a9f, lo: 0xa5, hi: 0xa6}, + {value: 0x4a9f, lo: 0xaa, hi: 0xaf}, // Block 0x6f, offset 0x231 {value: 0x0000, lo: 0x05}, - {value: 0x4a81, lo: 0x82, hi: 0x87}, - {value: 0x4a81, lo: 0x8a, hi: 0x8f}, - {value: 0x4a81, lo: 0x92, hi: 0x97}, - {value: 0x4a81, lo: 0x9a, hi: 0x9c}, + {value: 0x4a9f, lo: 0x82, hi: 0x87}, + {value: 0x4a9f, lo: 0x8a, hi: 0x8f}, + {value: 0x4a9f, lo: 0x92, hi: 0x97}, + {value: 0x4a9f, lo: 0x9a, hi: 0x9c}, {value: 0x8100, lo: 0xa3, hi: 0xa3}, // Block 0x70, offset 0x237 {value: 0x0000, lo: 0x01}, @@ -4295,13 +4299,13 @@ var nfcSparseValues = [688]valueRange{ {value: 0x8101, lo: 0x9e, hi: 0x9e}, // Block 0x86, offset 0x288 {value: 0x0000, lo: 0x0c}, - {value: 0x4662, lo: 0x9e, hi: 0x9e}, - {value: 0x466c, lo: 0x9f, hi: 0x9f}, - {value: 0x46a0, lo: 0xa0, hi: 0xa0}, - {value: 0x46ae, lo: 0xa1, hi: 0xa1}, - {value: 0x46bc, lo: 0xa2, hi: 0xa2}, - {value: 0x46ca, lo: 0xa3, hi: 0xa3}, - {value: 0x46d8, lo: 0xa4, hi: 0xa4}, + {value: 0x45cc, lo: 0x9e, hi: 0x9e}, + {value: 0x45d6, lo: 0x9f, hi: 0x9f}, + {value: 0x460a, lo: 0xa0, hi: 0xa0}, + {value: 0x4618, lo: 0xa1, hi: 0xa1}, + {value: 0x4626, lo: 0xa2, hi: 0xa2}, + {value: 0x4634, lo: 0xa3, hi: 0xa3}, + {value: 0x4642, lo: 0xa4, hi: 0xa4}, {value: 0x812b, lo: 0xa5, hi: 0xa6}, {value: 0x8101, lo: 0xa7, hi: 0xa9}, {value: 0x8130, lo: 0xad, hi: 0xad}, @@ -4313,14 +4317,14 @@ var nfcSparseValues = [688]valueRange{ {value: 0x8132, lo: 0x85, hi: 0x89}, {value: 0x812d, lo: 0x8a, hi: 0x8b}, {value: 0x8132, lo: 0xaa, hi: 0xad}, - {value: 0x4676, lo: 0xbb, hi: 0xbb}, - {value: 0x4680, lo: 0xbc, hi: 0xbc}, - {value: 0x46e6, lo: 0xbd, hi: 0xbd}, - {value: 0x4702, lo: 0xbe, hi: 0xbe}, - {value: 0x46f4, lo: 0xbf, hi: 0xbf}, + {value: 0x45e0, lo: 0xbb, hi: 0xbb}, + {value: 0x45ea, lo: 0xbc, hi: 0xbc}, + {value: 0x4650, lo: 0xbd, hi: 0xbd}, + {value: 0x466c, lo: 0xbe, hi: 0xbe}, + {value: 0x465e, lo: 0xbf, hi: 0xbf}, // Block 0x88, offset 0x29f {value: 0x0000, lo: 0x01}, - {value: 0x4710, lo: 0x80, hi: 0x80}, + {value: 0x467a, lo: 0x80, hi: 0x80}, // Block 0x89, offset 0x2a1 {value: 0x0000, lo: 0x01}, {value: 0x8132, lo: 0x82, hi: 0x84}, @@ -4513,7 +4517,7 @@ func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { return 0 } -// nfkcTrie. Total size: 16994 bytes (16.60 KiB). Checksum: 146925fc21092b17. +// nfkcTrie. Total size: 16994 bytes (16.60 KiB). Checksum: c3ed54ee046f3c46. type nfkcTrie struct{} func newNfkcTrie(i int) *nfkcTrie { @@ -4549,22 +4553,22 @@ var nfkcValues = [5888]uint16{ 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, // Block 0x2, offset 0x80 // Block 0x3, offset 0xc0 - 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x471e, 0xc3: 0x2f79, 0xc4: 0x472d, 0xc5: 0x4732, - 0xc6: 0xa000, 0xc7: 0x473c, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x4741, 0xcb: 0x2ffb, - 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x4755, 0xd1: 0x3104, - 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x475f, 0xd5: 0x4764, 0xd6: 0x4773, - 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x47a5, 0xdd: 0x3235, - 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x47af, 0xe3: 0x3285, - 0xe4: 0x47be, 0xe5: 0x47c3, 0xe6: 0xa000, 0xe7: 0x47cd, 0xe8: 0x32ee, 0xe9: 0x32f3, - 0xea: 0x47d2, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x47e6, - 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x47f0, 0xf5: 0x47f5, - 0xf6: 0x4804, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3, - 0xfc: 0x4836, 0xfd: 0x3550, 0xff: 0x3569, + 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x4688, 0xc3: 0x2f79, 0xc4: 0x4697, 0xc5: 0x469c, + 0xc6: 0xa000, 0xc7: 0x46a6, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x46ab, 0xcb: 0x2ffb, + 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x46bf, 0xd1: 0x3104, + 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x46c9, 0xd5: 0x46ce, 0xd6: 0x46dd, + 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x470f, 0xdd: 0x3235, + 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x4719, 0xe3: 0x3285, + 0xe4: 0x4728, 0xe5: 0x472d, 0xe6: 0xa000, 0xe7: 0x4737, 0xe8: 0x32ee, 0xe9: 0x32f3, + 0xea: 0x473c, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x4750, + 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x475a, 0xf5: 0x475f, + 0xf6: 0x476e, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3, + 0xfc: 0x47a0, 0xfd: 0x3550, 0xff: 0x3569, // Block 0x4, offset 0x100 - 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x4723, 0x103: 0x47b4, 0x104: 0x2f9c, 0x105: 0x32a8, + 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x468d, 0x103: 0x471e, 0x104: 0x2f9c, 0x105: 0x32a8, 0x106: 0x2fb0, 0x107: 0x32bc, 0x108: 0x2fb5, 0x109: 0x32c1, 0x10a: 0x2fba, 0x10b: 0x32c6, 0x10c: 0x2fbf, 0x10d: 0x32cb, 0x10e: 0x2fc9, 0x10f: 0x32d5, - 0x112: 0x4746, 0x113: 0x47d7, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302, + 0x112: 0x46b0, 0x113: 0x4741, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302, 0x118: 0x3014, 0x119: 0x3320, 0x11a: 0x3005, 0x11b: 0x3311, 0x11c: 0x302d, 0x11d: 0x3339, 0x11e: 0x3037, 0x11f: 0x3343, 0x120: 0x303c, 0x121: 0x3348, 0x122: 0x3046, 0x123: 0x3352, 0x124: 0x304b, 0x125: 0x3357, 0x128: 0x307d, 0x129: 0x338e, @@ -4575,12 +4579,12 @@ var nfkcValues = [5888]uint16{ // Block 0x5, offset 0x140 0x140: 0x1c34, 0x143: 0x30ff, 0x144: 0x3410, 0x145: 0x3118, 0x146: 0x3429, 0x147: 0x310e, 0x148: 0x341f, 0x149: 0x1c5c, - 0x14c: 0x4769, 0x14d: 0x47fa, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c, + 0x14c: 0x46d3, 0x14d: 0x4764, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c, 0x154: 0x3159, 0x155: 0x346a, 0x156: 0x3172, 0x157: 0x3483, - 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x478c, 0x15b: 0x481d, 0x15c: 0x317c, 0x15d: 0x348d, - 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x4791, 0x161: 0x4822, 0x162: 0x31a4, 0x163: 0x34ba, - 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x479b, 0x169: 0x482c, - 0x16a: 0x47a0, 0x16b: 0x4831, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2, + 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x46f6, 0x15b: 0x4787, 0x15c: 0x317c, 0x15d: 0x348d, + 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x46fb, 0x161: 0x478c, 0x162: 0x31a4, 0x163: 0x34ba, + 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x4705, 0x169: 0x4796, + 0x16a: 0x470a, 0x16b: 0x479b, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2, 0x170: 0x31d1, 0x171: 0x34e7, 0x172: 0x31ef, 0x173: 0x3505, 0x174: 0x3212, 0x175: 0x3528, 0x176: 0x323a, 0x177: 0x3555, 0x178: 0x324e, 0x179: 0x325d, 0x17a: 0x357d, 0x17b: 0x3267, 0x17c: 0x3587, 0x17d: 0x326c, 0x17e: 0x358c, 0x17f: 0x00a7, @@ -4592,7 +4596,7 @@ var nfkcValues = [5888]uint16{ 0x198: 0x3b57, 0x199: 0x39d6, 0x19a: 0x3b65, 0x19b: 0x39c1, 0x19c: 0x3b50, 0x19e: 0x38b0, 0x19f: 0x3a3f, 0x1a0: 0x38a9, 0x1a1: 0x3a38, 0x1a2: 0x35b3, 0x1a3: 0x35c5, 0x1a6: 0x3041, 0x1a7: 0x334d, 0x1a8: 0x30be, 0x1a9: 0x33cf, - 0x1aa: 0x4782, 0x1ab: 0x4813, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd, + 0x1aa: 0x46ec, 0x1ab: 0x477d, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd, 0x1b0: 0x33c5, 0x1b1: 0x1942, 0x1b2: 0x1945, 0x1b3: 0x19cf, 0x1b4: 0x3028, 0x1b5: 0x3334, 0x1b8: 0x30fa, 0x1b9: 0x340b, 0x1ba: 0x38b7, 0x1bb: 0x3a46, 0x1bc: 0x35ad, 0x1bd: 0x35bf, 0x1be: 0x35b9, 0x1bf: 0x35cb, @@ -4603,8 +4607,8 @@ var nfkcValues = [5888]uint16{ 0x1d2: 0x316d, 0x1d3: 0x347e, 0x1d4: 0x31db, 0x1d5: 0x34f1, 0x1d6: 0x31e0, 0x1d7: 0x34f6, 0x1d8: 0x3186, 0x1d9: 0x3497, 0x1da: 0x319f, 0x1db: 0x34b5, 0x1de: 0x305a, 0x1df: 0x3366, - 0x1e6: 0x4728, 0x1e7: 0x47b9, 0x1e8: 0x4750, 0x1e9: 0x47e1, - 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x476e, 0x1ef: 0x47ff, + 0x1e6: 0x4692, 0x1e7: 0x4723, 0x1e8: 0x46ba, 0x1e9: 0x474b, + 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x46d8, 0x1ef: 0x4769, 0x1f0: 0x3958, 0x1f1: 0x3ae7, 0x1f2: 0x3244, 0x1f3: 0x355f, // Block 0x8, offset 0x200 0x200: 0x9932, 0x201: 0x9932, 0x202: 0x9932, 0x203: 0x9932, 0x204: 0x9932, 0x205: 0x8132, @@ -4619,7 +4623,7 @@ var nfkcValues = [5888]uint16{ 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812d, 0x23a: 0x812d, 0x23b: 0x812d, 0x23c: 0x812d, 0x23d: 0x8132, 0x23e: 0x8132, 0x23f: 0x8132, // Block 0x9, offset 0x240 - 0x240: 0x4a44, 0x241: 0x4a49, 0x242: 0x9932, 0x243: 0x4a4e, 0x244: 0x4a53, 0x245: 0x9936, + 0x240: 0x49ae, 0x241: 0x49b3, 0x242: 0x9932, 0x243: 0x49b8, 0x244: 0x4a71, 0x245: 0x9936, 0x246: 0x8132, 0x247: 0x812d, 0x248: 0x812d, 0x249: 0x812d, 0x24a: 0x8132, 0x24b: 0x8132, 0x24c: 0x8132, 0x24d: 0x812d, 0x24e: 0x812d, 0x250: 0x8132, 0x251: 0x8132, 0x252: 0x8132, 0x253: 0x812d, 0x254: 0x812d, 0x255: 0x812d, 0x256: 0x812d, 0x257: 0x8132, @@ -4631,22 +4635,22 @@ var nfkcValues = [5888]uint16{ 0x27a: 0x42a5, 0x27e: 0x0037, // Block 0xa, offset 0x280 - 0x284: 0x425a, 0x285: 0x4511, + 0x284: 0x425a, 0x285: 0x447b, 0x286: 0x35e9, 0x287: 0x00ce, 0x288: 0x3607, 0x289: 0x3613, 0x28a: 0x3625, 0x28c: 0x3643, 0x28e: 0x3655, 0x28f: 0x3673, 0x290: 0x3e08, 0x291: 0xa000, 0x295: 0xa000, 0x297: 0xa000, 0x299: 0xa000, 0x29f: 0xa000, 0x2a1: 0xa000, 0x2a5: 0xa000, 0x2a9: 0xa000, - 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x4894, 0x2ad: 0x3697, 0x2ae: 0x48be, 0x2af: 0x36a9, + 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x47fe, 0x2ad: 0x3697, 0x2ae: 0x4828, 0x2af: 0x36a9, 0x2b0: 0x3e70, 0x2b1: 0xa000, 0x2b5: 0xa000, 0x2b7: 0xa000, 0x2b9: 0xa000, 0x2bf: 0xa000, // Block 0xb, offset 0x2c0 0x2c1: 0xa000, 0x2c5: 0xa000, - 0x2c9: 0xa000, 0x2ca: 0x48d6, 0x2cb: 0x48f4, - 0x2cc: 0x36c7, 0x2cd: 0x36df, 0x2ce: 0x490c, 0x2d0: 0x01be, 0x2d1: 0x01d0, - 0x2d2: 0x01ac, 0x2d3: 0x43a2, 0x2d4: 0x43a8, 0x2d5: 0x01fa, 0x2d6: 0x01e8, + 0x2c9: 0xa000, 0x2ca: 0x4840, 0x2cb: 0x485e, + 0x2cc: 0x36c7, 0x2cd: 0x36df, 0x2ce: 0x4876, 0x2d0: 0x01be, 0x2d1: 0x01d0, + 0x2d2: 0x01ac, 0x2d3: 0x430c, 0x2d4: 0x4312, 0x2d5: 0x01fa, 0x2d6: 0x01e8, 0x2f0: 0x01d6, 0x2f1: 0x01eb, 0x2f2: 0x01ee, 0x2f4: 0x0188, 0x2f5: 0x01c7, 0x2f9: 0x01a6, // Block 0xc, offset 0x300 @@ -4726,15 +4730,15 @@ var nfkcValues = [5888]uint16{ 0x4e4: 0x305f, 0x4e5: 0x336b, 0x4e6: 0x3055, 0x4e7: 0x3361, 0x4e8: 0x3064, 0x4e9: 0x3370, 0x4ea: 0x3069, 0x4eb: 0x3375, 0x4ec: 0x30af, 0x4ed: 0x33bb, 0x4ee: 0x390b, 0x4ef: 0x3a9a, 0x4f0: 0x30b9, 0x4f1: 0x33ca, 0x4f2: 0x30c3, 0x4f3: 0x33d4, 0x4f4: 0x30cd, 0x4f5: 0x33de, - 0x4f6: 0x475a, 0x4f7: 0x47eb, 0x4f8: 0x3912, 0x4f9: 0x3aa1, 0x4fa: 0x30e6, 0x4fb: 0x33f7, + 0x4f6: 0x46c4, 0x4f7: 0x4755, 0x4f8: 0x3912, 0x4f9: 0x3aa1, 0x4fa: 0x30e6, 0x4fb: 0x33f7, 0x4fc: 0x30e1, 0x4fd: 0x33f2, 0x4fe: 0x30eb, 0x4ff: 0x33fc, // Block 0x14, offset 0x500 0x500: 0x30f0, 0x501: 0x3401, 0x502: 0x30f5, 0x503: 0x3406, 0x504: 0x3109, 0x505: 0x341a, 0x506: 0x3113, 0x507: 0x3424, 0x508: 0x3122, 0x509: 0x3433, 0x50a: 0x311d, 0x50b: 0x342e, 0x50c: 0x3935, 0x50d: 0x3ac4, 0x50e: 0x3943, 0x50f: 0x3ad2, 0x510: 0x394a, 0x511: 0x3ad9, 0x512: 0x3951, 0x513: 0x3ae0, 0x514: 0x314f, 0x515: 0x3460, 0x516: 0x3154, 0x517: 0x3465, - 0x518: 0x315e, 0x519: 0x346f, 0x51a: 0x4787, 0x51b: 0x4818, 0x51c: 0x3997, 0x51d: 0x3b26, - 0x51e: 0x3177, 0x51f: 0x3488, 0x520: 0x3181, 0x521: 0x3492, 0x522: 0x4796, 0x523: 0x4827, + 0x518: 0x315e, 0x519: 0x346f, 0x51a: 0x46f1, 0x51b: 0x4782, 0x51c: 0x3997, 0x51d: 0x3b26, + 0x51e: 0x3177, 0x51f: 0x3488, 0x520: 0x3181, 0x521: 0x3492, 0x522: 0x4700, 0x523: 0x4791, 0x524: 0x399e, 0x525: 0x3b2d, 0x526: 0x39a5, 0x527: 0x3b34, 0x528: 0x39ac, 0x529: 0x3b3b, 0x52a: 0x3190, 0x52b: 0x34a1, 0x52c: 0x319a, 0x52d: 0x34b0, 0x52e: 0x31ae, 0x52f: 0x34c4, 0x530: 0x31a9, 0x531: 0x34bf, 0x532: 0x31ea, 0x533: 0x3500, 0x534: 0x31f9, 0x535: 0x350f, @@ -4746,16 +4750,16 @@ var nfkcValues = [5888]uint16{ 0x54c: 0x322b, 0x54d: 0x3546, 0x54e: 0x3249, 0x54f: 0x3564, 0x550: 0x3262, 0x551: 0x3582, 0x552: 0x3271, 0x553: 0x3591, 0x554: 0x3276, 0x555: 0x3596, 0x556: 0x337a, 0x557: 0x34a6, 0x558: 0x3537, 0x559: 0x3573, 0x55a: 0x1be0, 0x55b: 0x42d7, - 0x560: 0x4737, 0x561: 0x47c8, 0x562: 0x2f83, 0x563: 0x328f, + 0x560: 0x46a1, 0x561: 0x4732, 0x562: 0x2f83, 0x563: 0x328f, 0x564: 0x3878, 0x565: 0x3a07, 0x566: 0x3871, 0x567: 0x3a00, 0x568: 0x3886, 0x569: 0x3a15, 0x56a: 0x387f, 0x56b: 0x3a0e, 0x56c: 0x38be, 0x56d: 0x3a4d, 0x56e: 0x3894, 0x56f: 0x3a23, 0x570: 0x388d, 0x571: 0x3a1c, 0x572: 0x38a2, 0x573: 0x3a31, 0x574: 0x389b, 0x575: 0x3a2a, - 0x576: 0x38c5, 0x577: 0x3a54, 0x578: 0x474b, 0x579: 0x47dc, 0x57a: 0x3000, 0x57b: 0x330c, + 0x576: 0x38c5, 0x577: 0x3a54, 0x578: 0x46b5, 0x579: 0x4746, 0x57a: 0x3000, 0x57b: 0x330c, 0x57c: 0x2fec, 0x57d: 0x32f8, 0x57e: 0x38da, 0x57f: 0x3a69, // Block 0x16, offset 0x580 0x580: 0x38d3, 0x581: 0x3a62, 0x582: 0x38e8, 0x583: 0x3a77, 0x584: 0x38e1, 0x585: 0x3a70, 0x586: 0x38fd, 0x587: 0x3a8c, 0x588: 0x3091, 0x589: 0x339d, 0x58a: 0x30a5, 0x58b: 0x33b1, - 0x58c: 0x477d, 0x58d: 0x480e, 0x58e: 0x3136, 0x58f: 0x3447, 0x590: 0x3920, 0x591: 0x3aaf, + 0x58c: 0x46e7, 0x58d: 0x4778, 0x58e: 0x3136, 0x58f: 0x3447, 0x590: 0x3920, 0x591: 0x3aaf, 0x592: 0x3919, 0x593: 0x3aa8, 0x594: 0x392e, 0x595: 0x3abd, 0x596: 0x3927, 0x597: 0x3ab6, 0x598: 0x3989, 0x599: 0x3b18, 0x59a: 0x396d, 0x59b: 0x3afc, 0x59c: 0x3966, 0x59d: 0x3af5, 0x59e: 0x397b, 0x59f: 0x3b0a, 0x5a0: 0x3974, 0x5a1: 0x3b03, 0x5a2: 0x3982, 0x5a3: 0x3b11, @@ -4764,29 +4768,29 @@ var nfkcValues = [5888]uint16{ 0x5b0: 0x39f9, 0x5b1: 0x3b88, 0x5b2: 0x3230, 0x5b3: 0x354b, 0x5b4: 0x3258, 0x5b5: 0x3578, 0x5b6: 0x3253, 0x5b7: 0x356e, 0x5b8: 0x323f, 0x5b9: 0x355a, // Block 0x17, offset 0x5c0 - 0x5c0: 0x489a, 0x5c1: 0x48a0, 0x5c2: 0x49b4, 0x5c3: 0x49cc, 0x5c4: 0x49bc, 0x5c5: 0x49d4, - 0x5c6: 0x49c4, 0x5c7: 0x49dc, 0x5c8: 0x4840, 0x5c9: 0x4846, 0x5ca: 0x4924, 0x5cb: 0x493c, - 0x5cc: 0x492c, 0x5cd: 0x4944, 0x5ce: 0x4934, 0x5cf: 0x494c, 0x5d0: 0x48ac, 0x5d1: 0x48b2, + 0x5c0: 0x4804, 0x5c1: 0x480a, 0x5c2: 0x491e, 0x5c3: 0x4936, 0x5c4: 0x4926, 0x5c5: 0x493e, + 0x5c6: 0x492e, 0x5c7: 0x4946, 0x5c8: 0x47aa, 0x5c9: 0x47b0, 0x5ca: 0x488e, 0x5cb: 0x48a6, + 0x5cc: 0x4896, 0x5cd: 0x48ae, 0x5ce: 0x489e, 0x5cf: 0x48b6, 0x5d0: 0x4816, 0x5d1: 0x481c, 0x5d2: 0x3db8, 0x5d3: 0x3dc8, 0x5d4: 0x3dc0, 0x5d5: 0x3dd0, - 0x5d8: 0x484c, 0x5d9: 0x4852, 0x5da: 0x3ce8, 0x5db: 0x3cf8, 0x5dc: 0x3cf0, 0x5dd: 0x3d00, - 0x5e0: 0x48c4, 0x5e1: 0x48ca, 0x5e2: 0x49e4, 0x5e3: 0x49fc, - 0x5e4: 0x49ec, 0x5e5: 0x4a04, 0x5e6: 0x49f4, 0x5e7: 0x4a0c, 0x5e8: 0x4858, 0x5e9: 0x485e, - 0x5ea: 0x4954, 0x5eb: 0x496c, 0x5ec: 0x495c, 0x5ed: 0x4974, 0x5ee: 0x4964, 0x5ef: 0x497c, - 0x5f0: 0x48dc, 0x5f1: 0x48e2, 0x5f2: 0x3e18, 0x5f3: 0x3e30, 0x5f4: 0x3e20, 0x5f5: 0x3e38, - 0x5f6: 0x3e28, 0x5f7: 0x3e40, 0x5f8: 0x4864, 0x5f9: 0x486a, 0x5fa: 0x3d18, 0x5fb: 0x3d30, + 0x5d8: 0x47b6, 0x5d9: 0x47bc, 0x5da: 0x3ce8, 0x5db: 0x3cf8, 0x5dc: 0x3cf0, 0x5dd: 0x3d00, + 0x5e0: 0x482e, 0x5e1: 0x4834, 0x5e2: 0x494e, 0x5e3: 0x4966, + 0x5e4: 0x4956, 0x5e5: 0x496e, 0x5e6: 0x495e, 0x5e7: 0x4976, 0x5e8: 0x47c2, 0x5e9: 0x47c8, + 0x5ea: 0x48be, 0x5eb: 0x48d6, 0x5ec: 0x48c6, 0x5ed: 0x48de, 0x5ee: 0x48ce, 0x5ef: 0x48e6, + 0x5f0: 0x4846, 0x5f1: 0x484c, 0x5f2: 0x3e18, 0x5f3: 0x3e30, 0x5f4: 0x3e20, 0x5f5: 0x3e38, + 0x5f6: 0x3e28, 0x5f7: 0x3e40, 0x5f8: 0x47ce, 0x5f9: 0x47d4, 0x5fa: 0x3d18, 0x5fb: 0x3d30, 0x5fc: 0x3d20, 0x5fd: 0x3d38, 0x5fe: 0x3d28, 0x5ff: 0x3d40, // Block 0x18, offset 0x600 - 0x600: 0x48e8, 0x601: 0x48ee, 0x602: 0x3e48, 0x603: 0x3e58, 0x604: 0x3e50, 0x605: 0x3e60, - 0x608: 0x4870, 0x609: 0x4876, 0x60a: 0x3d48, 0x60b: 0x3d58, - 0x60c: 0x3d50, 0x60d: 0x3d60, 0x610: 0x48fa, 0x611: 0x4900, + 0x600: 0x4852, 0x601: 0x4858, 0x602: 0x3e48, 0x603: 0x3e58, 0x604: 0x3e50, 0x605: 0x3e60, + 0x608: 0x47da, 0x609: 0x47e0, 0x60a: 0x3d48, 0x60b: 0x3d58, + 0x60c: 0x3d50, 0x60d: 0x3d60, 0x610: 0x4864, 0x611: 0x486a, 0x612: 0x3e80, 0x613: 0x3e98, 0x614: 0x3e88, 0x615: 0x3ea0, 0x616: 0x3e90, 0x617: 0x3ea8, - 0x619: 0x487c, 0x61b: 0x3d68, 0x61d: 0x3d70, - 0x61f: 0x3d78, 0x620: 0x4912, 0x621: 0x4918, 0x622: 0x4a14, 0x623: 0x4a2c, - 0x624: 0x4a1c, 0x625: 0x4a34, 0x626: 0x4a24, 0x627: 0x4a3c, 0x628: 0x4882, 0x629: 0x4888, - 0x62a: 0x4984, 0x62b: 0x499c, 0x62c: 0x498c, 0x62d: 0x49a4, 0x62e: 0x4994, 0x62f: 0x49ac, - 0x630: 0x488e, 0x631: 0x43b4, 0x632: 0x3691, 0x633: 0x43ba, 0x634: 0x48b8, 0x635: 0x43c0, - 0x636: 0x36a3, 0x637: 0x43c6, 0x638: 0x36c1, 0x639: 0x43cc, 0x63a: 0x36d9, 0x63b: 0x43d2, - 0x63c: 0x4906, 0x63d: 0x43d8, + 0x619: 0x47e6, 0x61b: 0x3d68, 0x61d: 0x3d70, + 0x61f: 0x3d78, 0x620: 0x487c, 0x621: 0x4882, 0x622: 0x497e, 0x623: 0x4996, + 0x624: 0x4986, 0x625: 0x499e, 0x626: 0x498e, 0x627: 0x49a6, 0x628: 0x47ec, 0x629: 0x47f2, + 0x62a: 0x48ee, 0x62b: 0x4906, 0x62c: 0x48f6, 0x62d: 0x490e, 0x62e: 0x48fe, 0x62f: 0x4916, + 0x630: 0x47f8, 0x631: 0x431e, 0x632: 0x3691, 0x633: 0x4324, 0x634: 0x4822, 0x635: 0x432a, + 0x636: 0x36a3, 0x637: 0x4330, 0x638: 0x36c1, 0x639: 0x4336, 0x63a: 0x36d9, 0x63b: 0x433c, + 0x63c: 0x4870, 0x63d: 0x4342, // Block 0x19, offset 0x640 0x640: 0x3da0, 0x641: 0x3da8, 0x642: 0x4184, 0x643: 0x41a2, 0x644: 0x418e, 0x645: 0x41ac, 0x646: 0x4198, 0x647: 0x41b6, 0x648: 0x3cd8, 0x649: 0x3ce0, 0x64a: 0x40d0, 0x64b: 0x40ee, @@ -4797,19 +4801,19 @@ var nfkcValues = [5888]uint16{ 0x664: 0x4206, 0x665: 0x4224, 0x666: 0x4210, 0x667: 0x422e, 0x668: 0x3d80, 0x669: 0x3d88, 0x66a: 0x4148, 0x66b: 0x4166, 0x66c: 0x4152, 0x66d: 0x4170, 0x66e: 0x415c, 0x66f: 0x417a, 0x670: 0x3685, 0x671: 0x367f, 0x672: 0x3d90, 0x673: 0x368b, 0x674: 0x3d98, - 0x676: 0x48a6, 0x677: 0x3db0, 0x678: 0x35f5, 0x679: 0x35ef, 0x67a: 0x35e3, 0x67b: 0x4384, + 0x676: 0x4810, 0x677: 0x3db0, 0x678: 0x35f5, 0x679: 0x35ef, 0x67a: 0x35e3, 0x67b: 0x42ee, 0x67c: 0x35fb, 0x67d: 0x4287, 0x67e: 0x01d3, 0x67f: 0x4287, // Block 0x1a, offset 0x680 - 0x680: 0x42a0, 0x681: 0x4518, 0x682: 0x3dd8, 0x683: 0x369d, 0x684: 0x3de0, - 0x686: 0x48d0, 0x687: 0x3df8, 0x688: 0x3601, 0x689: 0x438a, 0x68a: 0x360d, 0x68b: 0x4390, - 0x68c: 0x3619, 0x68d: 0x451f, 0x68e: 0x4526, 0x68f: 0x452d, 0x690: 0x36b5, 0x691: 0x36af, - 0x692: 0x3e00, 0x693: 0x457a, 0x696: 0x36bb, 0x697: 0x3e10, - 0x698: 0x3631, 0x699: 0x362b, 0x69a: 0x361f, 0x69b: 0x4396, 0x69d: 0x4534, - 0x69e: 0x453b, 0x69f: 0x4542, 0x6a0: 0x36eb, 0x6a1: 0x36e5, 0x6a2: 0x3e68, 0x6a3: 0x4582, + 0x680: 0x42a0, 0x681: 0x4482, 0x682: 0x3dd8, 0x683: 0x369d, 0x684: 0x3de0, + 0x686: 0x483a, 0x687: 0x3df8, 0x688: 0x3601, 0x689: 0x42f4, 0x68a: 0x360d, 0x68b: 0x42fa, + 0x68c: 0x3619, 0x68d: 0x4489, 0x68e: 0x4490, 0x68f: 0x4497, 0x690: 0x36b5, 0x691: 0x36af, + 0x692: 0x3e00, 0x693: 0x44e4, 0x696: 0x36bb, 0x697: 0x3e10, + 0x698: 0x3631, 0x699: 0x362b, 0x69a: 0x361f, 0x69b: 0x4300, 0x69d: 0x449e, + 0x69e: 0x44a5, 0x69f: 0x44ac, 0x6a0: 0x36eb, 0x6a1: 0x36e5, 0x6a2: 0x3e68, 0x6a3: 0x44ec, 0x6a4: 0x36cd, 0x6a5: 0x36d3, 0x6a6: 0x36f1, 0x6a7: 0x3e78, 0x6a8: 0x3661, 0x6a9: 0x365b, - 0x6aa: 0x364f, 0x6ab: 0x43a2, 0x6ac: 0x3649, 0x6ad: 0x450a, 0x6ae: 0x4511, 0x6af: 0x0081, + 0x6aa: 0x364f, 0x6ab: 0x430c, 0x6ac: 0x3649, 0x6ad: 0x4474, 0x6ae: 0x447b, 0x6af: 0x0081, 0x6b2: 0x3eb0, 0x6b3: 0x36f7, 0x6b4: 0x3eb8, - 0x6b6: 0x491e, 0x6b7: 0x3ed0, 0x6b8: 0x363d, 0x6b9: 0x439c, 0x6ba: 0x366d, 0x6bb: 0x43ae, + 0x6b6: 0x4888, 0x6b7: 0x3ed0, 0x6b8: 0x363d, 0x6b9: 0x4306, 0x6ba: 0x366d, 0x6bb: 0x4318, 0x6bc: 0x3679, 0x6bd: 0x425a, 0x6be: 0x428c, // Block 0x1b, offset 0x6c0 0x6c0: 0x1bd8, 0x6c1: 0x1bdc, 0x6c2: 0x0047, 0x6c3: 0x1c54, 0x6c5: 0x1be8, @@ -4922,7 +4926,7 @@ var nfkcValues = [5888]uint16{ 0x93c: 0x3fc0, 0x93d: 0x3fc8, // Block 0x25, offset 0x940 0x954: 0x3f00, - 0x959: 0x9903, 0x95a: 0x9903, 0x95b: 0x4372, 0x95c: 0x4378, 0x95d: 0xa000, + 0x959: 0x9903, 0x95a: 0x9903, 0x95b: 0x42dc, 0x95c: 0x42e2, 0x95d: 0xa000, 0x95e: 0x3fd0, 0x95f: 0x26b4, 0x966: 0xa000, 0x96b: 0xa000, 0x96c: 0x3fe0, 0x96d: 0xa000, 0x96e: 0x3fe8, 0x96f: 0xa000, @@ -4942,10 +4946,10 @@ var nfkcValues = [5888]uint16{ // Block 0x27, offset 0x9c0 0x9c0: 0x0367, 0x9c1: 0x032b, 0x9c2: 0x032f, 0x9c3: 0x0333, 0x9c4: 0x037b, 0x9c5: 0x0337, 0x9c6: 0x033b, 0x9c7: 0x033f, 0x9c8: 0x0343, 0x9c9: 0x0347, 0x9ca: 0x034b, 0x9cb: 0x034f, - 0x9cc: 0x0353, 0x9cd: 0x0357, 0x9ce: 0x035b, 0x9cf: 0x42dc, 0x9d0: 0x42e1, 0x9d1: 0x42e6, - 0x9d2: 0x42eb, 0x9d3: 0x42f0, 0x9d4: 0x42f5, 0x9d5: 0x42fa, 0x9d6: 0x42ff, 0x9d7: 0x4304, - 0x9d8: 0x4309, 0x9d9: 0x430e, 0x9da: 0x4313, 0x9db: 0x4318, 0x9dc: 0x431d, 0x9dd: 0x4322, - 0x9de: 0x4327, 0x9df: 0x432c, 0x9e0: 0x4331, 0x9e1: 0x4336, 0x9e2: 0x433b, 0x9e3: 0x4340, + 0x9cc: 0x0353, 0x9cd: 0x0357, 0x9ce: 0x035b, 0x9cf: 0x49bd, 0x9d0: 0x49c3, 0x9d1: 0x49c9, + 0x9d2: 0x49cf, 0x9d3: 0x49d5, 0x9d4: 0x49db, 0x9d5: 0x49e1, 0x9d6: 0x49e7, 0x9d7: 0x49ed, + 0x9d8: 0x49f3, 0x9d9: 0x49f9, 0x9da: 0x49ff, 0x9db: 0x4a05, 0x9dc: 0x4a0b, 0x9dd: 0x4a11, + 0x9de: 0x4a17, 0x9df: 0x4a1d, 0x9e0: 0x4a23, 0x9e1: 0x4a29, 0x9e2: 0x4a2f, 0x9e3: 0x4a35, 0x9e4: 0x03c3, 0x9e5: 0x035f, 0x9e6: 0x0363, 0x9e7: 0x03e7, 0x9e8: 0x03eb, 0x9e9: 0x03ef, 0x9ea: 0x03f3, 0x9eb: 0x03f7, 0x9ec: 0x03fb, 0x9ed: 0x03ff, 0x9ee: 0x036b, 0x9ef: 0x0403, 0x9f0: 0x0407, 0x9f1: 0x036f, 0x9f2: 0x0373, 0x9f3: 0x0377, 0x9f4: 0x037f, 0x9f5: 0x0383, @@ -5148,17 +5152,17 @@ var nfkcValues = [5888]uint16{ 0xe40: 0x19d5, 0xe41: 0x19d8, 0xe42: 0x19db, 0xe43: 0x1c08, 0xe44: 0x1c0c, 0xe45: 0x1a5f, 0xe46: 0x1a5f, 0xe53: 0x1d75, 0xe54: 0x1d66, 0xe55: 0x1d6b, 0xe56: 0x1d7a, 0xe57: 0x1d70, - 0xe5d: 0x4426, - 0xe5e: 0x8115, 0xe5f: 0x4498, 0xe60: 0x022d, 0xe61: 0x0215, 0xe62: 0x021e, 0xe63: 0x0221, + 0xe5d: 0x4390, + 0xe5e: 0x8115, 0xe5f: 0x4402, 0xe60: 0x022d, 0xe61: 0x0215, 0xe62: 0x021e, 0xe63: 0x0221, 0xe64: 0x0224, 0xe65: 0x0227, 0xe66: 0x022a, 0xe67: 0x0230, 0xe68: 0x0233, 0xe69: 0x0017, - 0xe6a: 0x4486, 0xe6b: 0x448c, 0xe6c: 0x458a, 0xe6d: 0x4592, 0xe6e: 0x43de, 0xe6f: 0x43e4, - 0xe70: 0x43ea, 0xe71: 0x43f0, 0xe72: 0x43fc, 0xe73: 0x4402, 0xe74: 0x4408, 0xe75: 0x4414, - 0xe76: 0x441a, 0xe78: 0x4420, 0xe79: 0x442c, 0xe7a: 0x4432, 0xe7b: 0x4438, - 0xe7c: 0x4444, 0xe7e: 0x444a, + 0xe6a: 0x43f0, 0xe6b: 0x43f6, 0xe6c: 0x44f4, 0xe6d: 0x44fc, 0xe6e: 0x4348, 0xe6f: 0x434e, + 0xe70: 0x4354, 0xe71: 0x435a, 0xe72: 0x4366, 0xe73: 0x436c, 0xe74: 0x4372, 0xe75: 0x437e, + 0xe76: 0x4384, 0xe78: 0x438a, 0xe79: 0x4396, 0xe7a: 0x439c, 0xe7b: 0x43a2, + 0xe7c: 0x43ae, 0xe7e: 0x43b4, // Block 0x3a, offset 0xe80 - 0xe80: 0x4450, 0xe81: 0x4456, 0xe83: 0x445c, 0xe84: 0x4462, - 0xe86: 0x446e, 0xe87: 0x4474, 0xe88: 0x447a, 0xe89: 0x4480, 0xe8a: 0x4492, 0xe8b: 0x440e, - 0xe8c: 0x43f6, 0xe8d: 0x443e, 0xe8e: 0x4468, 0xe8f: 0x1d7f, 0xe90: 0x0299, 0xe91: 0x0299, + 0xe80: 0x43ba, 0xe81: 0x43c0, 0xe83: 0x43c6, 0xe84: 0x43cc, + 0xe86: 0x43d8, 0xe87: 0x43de, 0xe88: 0x43e4, 0xe89: 0x43ea, 0xe8a: 0x43fc, 0xe8b: 0x4378, + 0xe8c: 0x4360, 0xe8d: 0x43a8, 0xe8e: 0x43d2, 0xe8f: 0x1d7f, 0xe90: 0x0299, 0xe91: 0x0299, 0xe92: 0x02a2, 0xe93: 0x02a2, 0xe94: 0x02a2, 0xe95: 0x02a2, 0xe96: 0x02a5, 0xe97: 0x02a5, 0xe98: 0x02a5, 0xe99: 0x02a5, 0xe9a: 0x02ab, 0xe9b: 0x02ab, 0xe9c: 0x02ab, 0xe9d: 0x02ab, 0xe9e: 0x029f, 0xe9f: 0x029f, 0xea0: 0x029f, 0xea1: 0x029f, 0xea2: 0x02a8, 0xea3: 0x02a8, @@ -5174,9 +5178,9 @@ var nfkcValues = [5888]uint16{ 0xed2: 0x02db, 0xed3: 0x02db, 0xed4: 0x02db, 0xed5: 0x02db, 0xed6: 0x02e1, 0xed7: 0x02e1, 0xed8: 0x02e1, 0xed9: 0x02e1, 0xeda: 0x02de, 0xedb: 0x02de, 0xedc: 0x02de, 0xedd: 0x02de, 0xede: 0x02e4, 0xedf: 0x02e4, 0xee0: 0x02e7, 0xee1: 0x02e7, 0xee2: 0x02e7, 0xee3: 0x02e7, - 0xee4: 0x4504, 0xee5: 0x4504, 0xee6: 0x02ed, 0xee7: 0x02ed, 0xee8: 0x02ed, 0xee9: 0x02ed, + 0xee4: 0x446e, 0xee5: 0x446e, 0xee6: 0x02ed, 0xee7: 0x02ed, 0xee8: 0x02ed, 0xee9: 0x02ed, 0xeea: 0x02ea, 0xeeb: 0x02ea, 0xeec: 0x02ea, 0xeed: 0x02ea, 0xeee: 0x0308, 0xeef: 0x0308, - 0xef0: 0x44fe, 0xef1: 0x44fe, + 0xef0: 0x4468, 0xef1: 0x4468, // Block 0x3c, offset 0xf00 0xf13: 0x02d8, 0xf14: 0x02d8, 0xf15: 0x02d8, 0xf16: 0x02d8, 0xf17: 0x02f6, 0xf18: 0x02f6, 0xf19: 0x02f3, 0xf1a: 0x02f3, 0xf1b: 0x02f9, 0xf1c: 0x02f9, 0xf1d: 0x204f, @@ -5203,8 +5207,8 @@ var nfkcValues = [5888]uint16{ 0xf86: 0x1fb4, 0xf87: 0x1fb9, 0xf88: 0x1fbe, 0xf89: 0x1fc3, 0xf8a: 0x1fc8, 0xf8b: 0x1fcd, 0xf8c: 0x1fd2, 0xf8d: 0x1fd7, 0xf8e: 0x1fe6, 0xf8f: 0x1ff5, 0xf90: 0x1ffa, 0xf91: 0x1fff, 0xf92: 0x2004, 0xf93: 0x2009, 0xf94: 0x200e, 0xf95: 0x2018, 0xf96: 0x201d, 0xf97: 0x2022, - 0xf98: 0x2031, 0xf99: 0x2040, 0xf9a: 0x2045, 0xf9b: 0x44b6, 0xf9c: 0x44bc, 0xf9d: 0x44f2, - 0xf9e: 0x4549, 0xf9f: 0x4550, 0xfa0: 0x4557, 0xfa1: 0x455e, 0xfa2: 0x4565, 0xfa3: 0x456c, + 0xf98: 0x2031, 0xf99: 0x2040, 0xf9a: 0x2045, 0xf9b: 0x4420, 0xf9c: 0x4426, 0xf9d: 0x445c, + 0xf9e: 0x44b3, 0xf9f: 0x44ba, 0xfa0: 0x44c1, 0xfa1: 0x44c8, 0xfa2: 0x44cf, 0xfa3: 0x44d6, 0xfa4: 0x25c6, 0xfa5: 0x25cd, 0xfa6: 0x25d4, 0xfa7: 0x25db, 0xfa8: 0x25f0, 0xfa9: 0x25f7, 0xfaa: 0x1d98, 0xfab: 0x1d9d, 0xfac: 0x1da2, 0xfad: 0x1da7, 0xfae: 0x1db1, 0xfaf: 0x1db6, 0xfb0: 0x1dca, 0xfb1: 0x1dcf, 0xfb2: 0x1dd4, 0xfb3: 0x1dd9, 0xfb4: 0x1de3, 0xfb5: 0x1de8, @@ -5213,7 +5217,7 @@ var nfkcValues = [5888]uint16{ // Block 0x3f, offset 0xfc0 0xfc0: 0x1f5a, 0xfc1: 0x1f6e, 0xfc2: 0x1f73, 0xfc3: 0x1f78, 0xfc4: 0x1f7d, 0xfc5: 0x1f96, 0xfc6: 0x1fa0, 0xfc7: 0x1fa5, 0xfc8: 0x1faa, 0xfc9: 0x1fbe, 0xfca: 0x1fdc, 0xfcb: 0x1fe1, - 0xfcc: 0x1fe6, 0xfcd: 0x1feb, 0xfce: 0x1ff5, 0xfcf: 0x1ffa, 0xfd0: 0x44f2, 0xfd1: 0x2027, + 0xfcc: 0x1fe6, 0xfcd: 0x1feb, 0xfce: 0x1ff5, 0xfcf: 0x1ffa, 0xfd0: 0x445c, 0xfd1: 0x2027, 0xfd2: 0x202c, 0xfd3: 0x2031, 0xfd4: 0x2036, 0xfd5: 0x2040, 0xfd6: 0x2045, 0xfd7: 0x25b1, 0xfd8: 0x25b8, 0xfd9: 0x25bf, 0xfda: 0x25d4, 0xfdb: 0x25e2, 0xfdc: 0x1d89, 0xfdd: 0x1d8e, 0xfde: 0x1d93, 0xfdf: 0x1da2, 0xfe0: 0x1dac, 0xfe1: 0x1dbb, 0xfe2: 0x1dc0, 0xfe3: 0x1dc5, @@ -5227,11 +5231,11 @@ var nfkcValues = [5888]uint16{ 0x1006: 0x1f69, 0x1007: 0x1f6e, 0x1008: 0x1f73, 0x1009: 0x1f87, 0x100a: 0x1f8c, 0x100b: 0x1f91, 0x100c: 0x1f96, 0x100d: 0x1f9b, 0x100e: 0x1faf, 0x100f: 0x1fb4, 0x1010: 0x1fb9, 0x1011: 0x1fbe, 0x1012: 0x1fcd, 0x1013: 0x1fd2, 0x1014: 0x1fd7, 0x1015: 0x1fe6, 0x1016: 0x1ff0, 0x1017: 0x1fff, - 0x1018: 0x2004, 0x1019: 0x44e6, 0x101a: 0x2018, 0x101b: 0x201d, 0x101c: 0x2022, 0x101d: 0x2031, + 0x1018: 0x2004, 0x1019: 0x4450, 0x101a: 0x2018, 0x101b: 0x201d, 0x101c: 0x2022, 0x101d: 0x2031, 0x101e: 0x203b, 0x101f: 0x25d4, 0x1020: 0x25e2, 0x1021: 0x1da2, 0x1022: 0x1dac, 0x1023: 0x1dd4, 0x1024: 0x1dde, 0x1025: 0x1dfc, 0x1026: 0x1e06, 0x1027: 0x1e6a, 0x1028: 0x1e6f, 0x1029: 0x1e92, 0x102a: 0x1e97, 0x102b: 0x1f6e, 0x102c: 0x1f73, 0x102d: 0x1f96, 0x102e: 0x1fe6, 0x102f: 0x1ff0, - 0x1030: 0x2031, 0x1031: 0x203b, 0x1032: 0x459a, 0x1033: 0x45a2, 0x1034: 0x45aa, 0x1035: 0x1ef1, + 0x1030: 0x2031, 0x1031: 0x203b, 0x1032: 0x4504, 0x1033: 0x450c, 0x1034: 0x4514, 0x1035: 0x1ef1, 0x1036: 0x1ef6, 0x1037: 0x1f0a, 0x1038: 0x1f0f, 0x1039: 0x1f1e, 0x103a: 0x1f23, 0x103b: 0x1e74, 0x103c: 0x1e79, 0x103d: 0x1e9c, 0x103e: 0x1ea1, 0x103f: 0x1e33, // Block 0x41, offset 0x1040 @@ -5245,7 +5249,7 @@ var nfkcValues = [5888]uint16{ 0x106a: 0x1e65, 0x106b: 0x1eb0, 0x106c: 0x1ed3, 0x106d: 0x1e7e, 0x106e: 0x1e83, 0x106f: 0x1e88, 0x1070: 0x1e92, 0x1071: 0x1e6f, 0x1072: 0x1e97, 0x1073: 0x1eec, 0x1074: 0x1e56, 0x1075: 0x1e5b, 0x1076: 0x1e60, 0x1077: 0x1e7e, 0x1078: 0x1e83, 0x1079: 0x1e88, 0x107a: 0x1eec, 0x107b: 0x1efb, - 0x107c: 0x449e, 0x107d: 0x449e, + 0x107c: 0x4408, 0x107d: 0x4408, // Block 0x42, offset 0x1080 0x1090: 0x2311, 0x1091: 0x2326, 0x1092: 0x2326, 0x1093: 0x232d, 0x1094: 0x2334, 0x1095: 0x2349, 0x1096: 0x2350, 0x1097: 0x2357, @@ -5293,13 +5297,13 @@ var nfkcValues = [5888]uint16{ 0x119e: 0x04bb, 0x119f: 0x0007, 0x11a0: 0x000d, 0x11a1: 0x0015, 0x11a2: 0x0017, 0x11a3: 0x001b, 0x11a4: 0x0039, 0x11a5: 0x003d, 0x11a6: 0x003b, 0x11a8: 0x0079, 0x11a9: 0x0009, 0x11aa: 0x000b, 0x11ab: 0x0041, - 0x11b0: 0x42aa, 0x11b1: 0x44c2, 0x11b2: 0x42af, 0x11b4: 0x42b4, - 0x11b6: 0x42b9, 0x11b7: 0x44c8, 0x11b8: 0x42be, 0x11b9: 0x44ce, 0x11ba: 0x42c3, 0x11bb: 0x44d4, - 0x11bc: 0x42c8, 0x11bd: 0x44da, 0x11be: 0x42cd, 0x11bf: 0x44e0, + 0x11b0: 0x42aa, 0x11b1: 0x442c, 0x11b2: 0x42af, 0x11b4: 0x42b4, + 0x11b6: 0x42b9, 0x11b7: 0x4432, 0x11b8: 0x42be, 0x11b9: 0x4438, 0x11ba: 0x42c3, 0x11bb: 0x443e, + 0x11bc: 0x42c8, 0x11bd: 0x4444, 0x11be: 0x42cd, 0x11bf: 0x444a, // Block 0x47, offset 0x11c0 - 0x11c0: 0x0236, 0x11c1: 0x44a4, 0x11c2: 0x44a4, 0x11c3: 0x44aa, 0x11c4: 0x44aa, 0x11c5: 0x44ec, - 0x11c6: 0x44ec, 0x11c7: 0x44b0, 0x11c8: 0x44b0, 0x11c9: 0x44f8, 0x11ca: 0x44f8, 0x11cb: 0x44f8, - 0x11cc: 0x44f8, 0x11cd: 0x0239, 0x11ce: 0x0239, 0x11cf: 0x023c, 0x11d0: 0x023c, 0x11d1: 0x023c, + 0x11c0: 0x0236, 0x11c1: 0x440e, 0x11c2: 0x440e, 0x11c3: 0x4414, 0x11c4: 0x4414, 0x11c5: 0x4456, + 0x11c6: 0x4456, 0x11c7: 0x441a, 0x11c8: 0x441a, 0x11c9: 0x4462, 0x11ca: 0x4462, 0x11cb: 0x4462, + 0x11cc: 0x4462, 0x11cd: 0x0239, 0x11ce: 0x0239, 0x11cf: 0x023c, 0x11d0: 0x023c, 0x11d1: 0x023c, 0x11d2: 0x023c, 0x11d3: 0x023f, 0x11d4: 0x023f, 0x11d5: 0x0242, 0x11d6: 0x0242, 0x11d7: 0x0242, 0x11d8: 0x0242, 0x11d9: 0x0245, 0x11da: 0x0245, 0x11db: 0x0245, 0x11dc: 0x0245, 0x11dd: 0x0248, 0x11de: 0x0248, 0x11df: 0x0248, 0x11e0: 0x0248, 0x11e1: 0x024b, 0x11e2: 0x024b, 0x11e3: 0x024b, @@ -5338,18 +5342,18 @@ var nfkcValues = [5888]uint16{ 0x128c: 0x054b, 0x128d: 0x054f, 0x128e: 0x0553, 0x128f: 0x0557, 0x1290: 0x055b, 0x1291: 0x055f, 0x1292: 0x0563, 0x1293: 0x0567, 0x1294: 0x056f, 0x1295: 0x0577, 0x1296: 0x057f, 0x1297: 0x0583, 0x1298: 0x0587, 0x1299: 0x058b, 0x129a: 0x058f, 0x129b: 0x0593, 0x129c: 0x0597, 0x129d: 0x05a7, - 0x129e: 0x4a5a, 0x129f: 0x4a60, 0x12a0: 0x03c3, 0x12a1: 0x0313, 0x12a2: 0x0317, 0x12a3: 0x4345, - 0x12a4: 0x031b, 0x12a5: 0x434a, 0x12a6: 0x434f, 0x12a7: 0x031f, 0x12a8: 0x0323, 0x12a9: 0x0327, - 0x12aa: 0x4354, 0x12ab: 0x4359, 0x12ac: 0x435e, 0x12ad: 0x4363, 0x12ae: 0x4368, 0x12af: 0x436d, + 0x129e: 0x4a78, 0x129f: 0x4a7e, 0x12a0: 0x03c3, 0x12a1: 0x0313, 0x12a2: 0x0317, 0x12a3: 0x4a3b, + 0x12a4: 0x031b, 0x12a5: 0x4a41, 0x12a6: 0x4a47, 0x12a7: 0x031f, 0x12a8: 0x0323, 0x12a9: 0x0327, + 0x12aa: 0x4a4d, 0x12ab: 0x4a53, 0x12ac: 0x4a59, 0x12ad: 0x4a5f, 0x12ae: 0x4a65, 0x12af: 0x4a6b, 0x12b0: 0x0367, 0x12b1: 0x032b, 0x12b2: 0x032f, 0x12b3: 0x0333, 0x12b4: 0x037b, 0x12b5: 0x0337, 0x12b6: 0x033b, 0x12b7: 0x033f, 0x12b8: 0x0343, 0x12b9: 0x0347, 0x12ba: 0x034b, 0x12bb: 0x034f, 0x12bc: 0x0353, 0x12bd: 0x0357, 0x12be: 0x035b, // Block 0x4b, offset 0x12c0 - 0x12c2: 0x42dc, 0x12c3: 0x42e1, 0x12c4: 0x42e6, 0x12c5: 0x42eb, - 0x12c6: 0x42f0, 0x12c7: 0x42f5, 0x12ca: 0x42fa, 0x12cb: 0x42ff, - 0x12cc: 0x4304, 0x12cd: 0x4309, 0x12ce: 0x430e, 0x12cf: 0x4313, - 0x12d2: 0x4318, 0x12d3: 0x431d, 0x12d4: 0x4322, 0x12d5: 0x4327, 0x12d6: 0x432c, 0x12d7: 0x4331, - 0x12da: 0x4336, 0x12db: 0x433b, 0x12dc: 0x4340, + 0x12c2: 0x49bd, 0x12c3: 0x49c3, 0x12c4: 0x49c9, 0x12c5: 0x49cf, + 0x12c6: 0x49d5, 0x12c7: 0x49db, 0x12ca: 0x49e1, 0x12cb: 0x49e7, + 0x12cc: 0x49ed, 0x12cd: 0x49f3, 0x12ce: 0x49f9, 0x12cf: 0x49ff, + 0x12d2: 0x4a05, 0x12d3: 0x4a0b, 0x12d4: 0x4a11, 0x12d5: 0x4a17, 0x12d6: 0x4a1d, 0x12d7: 0x4a23, + 0x12da: 0x4a29, 0x12db: 0x4a2f, 0x12dc: 0x4a35, 0x12e0: 0x00bf, 0x12e1: 0x00c2, 0x12e2: 0x00cb, 0x12e3: 0x4264, 0x12e4: 0x00c8, 0x12e5: 0x00c5, 0x12e6: 0x0447, 0x12e8: 0x046b, 0x12e9: 0x044b, 0x12ea: 0x044f, 0x12eb: 0x0453, 0x12ec: 0x0457, 0x12ed: 0x046f, 0x12ee: 0x0473, @@ -5426,7 +5430,7 @@ var nfkcValues = [5888]uint16{ // Block 0x52, offset 0x1480 0x1480: 0x26ad, 0x1481: 0x26c2, 0x1482: 0x0503, 0x1490: 0x0c0f, 0x1491: 0x0a47, - 0x1492: 0x08d3, 0x1493: 0x465a, 0x1494: 0x071b, 0x1495: 0x09ef, 0x1496: 0x132f, 0x1497: 0x09ff, + 0x1492: 0x08d3, 0x1493: 0x45c4, 0x1494: 0x071b, 0x1495: 0x09ef, 0x1496: 0x132f, 0x1497: 0x09ff, 0x1498: 0x0727, 0x1499: 0x0cd7, 0x149a: 0x0eaf, 0x149b: 0x0caf, 0x149c: 0x0827, 0x149d: 0x0b6b, 0x149e: 0x07bf, 0x149f: 0x0cb7, 0x14a0: 0x0813, 0x14a1: 0x1117, 0x14a2: 0x0f83, 0x14a3: 0x138b, 0x14a4: 0x09d3, 0x14a5: 0x090b, 0x14a6: 0x0e63, 0x14a7: 0x0c1b, 0x14a8: 0x0c47, 0x14a9: 0x06bf, @@ -5665,8 +5669,8 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x22b2, lo: 0xbe, hi: 0xbe}, // Block 0x1, offset 0xe {value: 0x0091, lo: 0x03}, - {value: 0x4778, lo: 0xa0, hi: 0xa1}, - {value: 0x47aa, lo: 0xaf, hi: 0xb0}, + {value: 0x46e2, lo: 0xa0, hi: 0xa1}, + {value: 0x4714, lo: 0xaf, hi: 0xb0}, {value: 0xa000, lo: 0xb7, hi: 0xb7}, // Block 0x2, offset 0x12 {value: 0x0003, lo: 0x08}, @@ -5814,7 +5818,7 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x812d, lo: 0x92, hi: 0x92}, {value: 0x8132, lo: 0x93, hi: 0x93}, {value: 0x8132, lo: 0x94, hi: 0x94}, - {value: 0x45b2, lo: 0x98, hi: 0x9f}, + {value: 0x451c, lo: 0x98, hi: 0x9f}, // Block 0x11, offset 0x96 {value: 0x0000, lo: 0x02}, {value: 0x8102, lo: 0xbc, hi: 0xbc}, @@ -5825,18 +5829,18 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x2c9e, lo: 0x8b, hi: 0x8c}, {value: 0x8104, lo: 0x8d, hi: 0x8d}, {value: 0x9900, lo: 0x97, hi: 0x97}, - {value: 0x45f2, lo: 0x9c, hi: 0x9d}, - {value: 0x4602, lo: 0x9f, hi: 0x9f}, + {value: 0x455c, lo: 0x9c, hi: 0x9d}, + {value: 0x456c, lo: 0x9f, hi: 0x9f}, // Block 0x13, offset 0xa0 {value: 0x0000, lo: 0x03}, - {value: 0x462a, lo: 0xb3, hi: 0xb3}, - {value: 0x4632, lo: 0xb6, hi: 0xb6}, + {value: 0x4594, lo: 0xb3, hi: 0xb3}, + {value: 0x459c, lo: 0xb6, hi: 0xb6}, {value: 0x8102, lo: 0xbc, hi: 0xbc}, // Block 0x14, offset 0xa4 {value: 0x0008, lo: 0x03}, {value: 0x8104, lo: 0x8d, hi: 0x8d}, - {value: 0x460a, lo: 0x99, hi: 0x9b}, - {value: 0x4622, lo: 0x9e, hi: 0x9e}, + {value: 0x4574, lo: 0x99, hi: 0x9b}, + {value: 0x458c, lo: 0x9e, hi: 0x9e}, // Block 0x15, offset 0xa8 {value: 0x0000, lo: 0x01}, {value: 0x8102, lo: 0xbc, hi: 0xbc}, @@ -5851,8 +5855,8 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x2cbe, lo: 0x8c, hi: 0x8c}, {value: 0x8104, lo: 0x8d, hi: 0x8d}, {value: 0x9900, lo: 0x96, hi: 0x97}, - {value: 0x463a, lo: 0x9c, hi: 0x9c}, - {value: 0x4642, lo: 0x9d, hi: 0x9d}, + {value: 0x45a4, lo: 0x9c, hi: 0x9c}, + {value: 0x45ac, lo: 0x9d, hi: 0x9d}, // Block 0x18, offset 0xb5 {value: 0x0000, lo: 0x03}, {value: 0xa000, lo: 0x92, hi: 0x92}, @@ -5941,18 +5945,18 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x263d, lo: 0xa9, hi: 0xa9}, {value: 0x8126, lo: 0xb1, hi: 0xb1}, {value: 0x8127, lo: 0xb2, hi: 0xb2}, - {value: 0x4a66, lo: 0xb3, hi: 0xb3}, + {value: 0x4a84, lo: 0xb3, hi: 0xb3}, {value: 0x8128, lo: 0xb4, hi: 0xb4}, - {value: 0x4a6f, lo: 0xb5, hi: 0xb5}, - {value: 0x464a, lo: 0xb6, hi: 0xb6}, - {value: 0x468a, lo: 0xb7, hi: 0xb7}, - {value: 0x4652, lo: 0xb8, hi: 0xb8}, - {value: 0x4695, lo: 0xb9, hi: 0xb9}, + {value: 0x4a8d, lo: 0xb5, hi: 0xb5}, + {value: 0x45b4, lo: 0xb6, hi: 0xb6}, + {value: 0x45f4, lo: 0xb7, hi: 0xb7}, + {value: 0x45bc, lo: 0xb8, hi: 0xb8}, + {value: 0x45ff, lo: 0xb9, hi: 0xb9}, {value: 0x8127, lo: 0xba, hi: 0xbd}, // Block 0x26, offset 0x107 {value: 0x0000, lo: 0x0b}, {value: 0x8127, lo: 0x80, hi: 0x80}, - {value: 0x4a78, lo: 0x81, hi: 0x81}, + {value: 0x4a96, lo: 0x81, hi: 0x81}, {value: 0x8132, lo: 0x82, hi: 0x83}, {value: 0x8104, lo: 0x84, hi: 0x84}, {value: 0x8132, lo: 0x86, hi: 0x87}, @@ -6199,7 +6203,7 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x192d, lo: 0xb5, hi: 0xb6}, // Block 0x4a, offset 0x1db {value: 0x0000, lo: 0x01}, - {value: 0x4573, lo: 0x9c, hi: 0x9c}, + {value: 0x44dd, lo: 0x9c, hi: 0x9c}, // Block 0x4b, offset 0x1dd {value: 0x0000, lo: 0x02}, {value: 0x0095, lo: 0xbc, hi: 0xbc}, @@ -6245,16 +6249,16 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x04b3, lo: 0xb6, hi: 0xb6}, {value: 0x0887, lo: 0xb8, hi: 0xba}, // Block 0x53, offset 0x201 - {value: 0x0005, lo: 0x09}, + {value: 0x0006, lo: 0x09}, {value: 0x0313, lo: 0xb1, hi: 0xb1}, {value: 0x0317, lo: 0xb2, hi: 0xb2}, - {value: 0x4345, lo: 0xb3, hi: 0xb3}, + {value: 0x4a3b, lo: 0xb3, hi: 0xb3}, {value: 0x031b, lo: 0xb4, hi: 0xb4}, - {value: 0x434a, lo: 0xb5, hi: 0xb6}, + {value: 0x4a41, lo: 0xb5, hi: 0xb6}, {value: 0x031f, lo: 0xb7, hi: 0xb7}, {value: 0x0323, lo: 0xb8, hi: 0xb8}, {value: 0x0327, lo: 0xb9, hi: 0xb9}, - {value: 0x4354, lo: 0xba, hi: 0xbf}, + {value: 0x4a4d, lo: 0xba, hi: 0xbf}, // Block 0x54, offset 0x20b {value: 0x0000, lo: 0x02}, {value: 0x8132, lo: 0xaf, hi: 0xaf}, @@ -6479,13 +6483,13 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x8101, lo: 0x9e, hi: 0x9e}, // Block 0x83, offset 0x2ba {value: 0x0000, lo: 0x0c}, - {value: 0x4662, lo: 0x9e, hi: 0x9e}, - {value: 0x466c, lo: 0x9f, hi: 0x9f}, - {value: 0x46a0, lo: 0xa0, hi: 0xa0}, - {value: 0x46ae, lo: 0xa1, hi: 0xa1}, - {value: 0x46bc, lo: 0xa2, hi: 0xa2}, - {value: 0x46ca, lo: 0xa3, hi: 0xa3}, - {value: 0x46d8, lo: 0xa4, hi: 0xa4}, + {value: 0x45cc, lo: 0x9e, hi: 0x9e}, + {value: 0x45d6, lo: 0x9f, hi: 0x9f}, + {value: 0x460a, lo: 0xa0, hi: 0xa0}, + {value: 0x4618, lo: 0xa1, hi: 0xa1}, + {value: 0x4626, lo: 0xa2, hi: 0xa2}, + {value: 0x4634, lo: 0xa3, hi: 0xa3}, + {value: 0x4642, lo: 0xa4, hi: 0xa4}, {value: 0x812b, lo: 0xa5, hi: 0xa6}, {value: 0x8101, lo: 0xa7, hi: 0xa9}, {value: 0x8130, lo: 0xad, hi: 0xad}, @@ -6497,14 +6501,14 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x8132, lo: 0x85, hi: 0x89}, {value: 0x812d, lo: 0x8a, hi: 0x8b}, {value: 0x8132, lo: 0xaa, hi: 0xad}, - {value: 0x4676, lo: 0xbb, hi: 0xbb}, - {value: 0x4680, lo: 0xbc, hi: 0xbc}, - {value: 0x46e6, lo: 0xbd, hi: 0xbd}, - {value: 0x4702, lo: 0xbe, hi: 0xbe}, - {value: 0x46f4, lo: 0xbf, hi: 0xbf}, + {value: 0x45e0, lo: 0xbb, hi: 0xbb}, + {value: 0x45ea, lo: 0xbc, hi: 0xbc}, + {value: 0x4650, lo: 0xbd, hi: 0xbd}, + {value: 0x466c, lo: 0xbe, hi: 0xbe}, + {value: 0x465e, lo: 0xbf, hi: 0xbf}, // Block 0x85, offset 0x2d1 {value: 0x0000, lo: 0x01}, - {value: 0x4710, lo: 0x80, hi: 0x80}, + {value: 0x467a, lo: 0x80, hi: 0x80}, // Block 0x86, offset 0x2d3 {value: 0x0000, lo: 0x01}, {value: 0x8132, lo: 0x82, hi: 0x84}, @@ -7624,4 +7628,4 @@ var recompMap = map[uint32]rune{ 0x15B915AF: 0x115BB, } -// Total size of tables: 53KB (53976 bytes) +// Total size of tables: 53KB (54006 bytes) diff --git a/vendor/golang.org/x/text/width/kind_string.go b/vendor/golang.org/x/text/width/kind_string.go index ab4fee542f3..49bfbf72683 100644 --- a/vendor/golang.org/x/text/width/kind_string.go +++ b/vendor/golang.org/x/text/width/kind_string.go @@ -1,4 +1,4 @@ -// Code generated by "stringer -type=Kind"; DO NOT EDIT +// Code generated by "stringer -type=Kind"; DO NOT EDIT. package width diff --git a/vendor/golang.org/x/text/width/tables.go b/vendor/golang.org/x/text/width/tables.go index 242da0fdb9c..e21f0b83859 100644 --- a/vendor/golang.org/x/text/width/tables.go +++ b/vendor/golang.org/x/text/width/tables.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package width diff --git a/vendor/golang.org/x/text/width/transform.go b/vendor/golang.org/x/text/width/transform.go index 2ed25096acb..0049f700a2f 100644 --- a/vendor/golang.org/x/text/width/transform.go +++ b/vendor/golang.org/x/text/width/transform.go @@ -14,6 +14,32 @@ type foldTransform struct { transform.NopResetter } +func (foldTransform) Span(src []byte, atEOF bool) (n int, err error) { + for n < len(src) { + if src[n] < utf8.RuneSelf { + // ASCII fast path. + for n++; n < len(src) && src[n] < utf8.RuneSelf; n++ { + } + continue + } + v, size := trie.lookup(src[n:]) + if size == 0 { // incomplete UTF-8 encoding + if !atEOF { + err = transform.ErrShortSrc + } else { + n = len(src) + } + break + } + if elem(v)&tagNeedsFold != 0 { + err = transform.ErrEndOfSpan + break + } + n += size + } + return n, err +} + func (foldTransform) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { for nSrc < len(src) { if src[nSrc] < utf8.RuneSelf { @@ -70,6 +96,33 @@ type narrowTransform struct { transform.NopResetter } +func (narrowTransform) Span(src []byte, atEOF bool) (n int, err error) { + for n < len(src) { + if src[n] < utf8.RuneSelf { + // ASCII fast path. + for n++; n < len(src) && src[n] < utf8.RuneSelf; n++ { + } + continue + } + v, size := trie.lookup(src[n:]) + if size == 0 { // incomplete UTF-8 encoding + if !atEOF { + err = transform.ErrShortSrc + } else { + n = len(src) + } + break + } + if k := elem(v).kind(); byte(v) == 0 || k != EastAsianFullwidth && k != EastAsianWide && k != EastAsianAmbiguous { + } else { + err = transform.ErrEndOfSpan + break + } + n += size + } + return n, err +} + func (narrowTransform) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { for nSrc < len(src) { if src[nSrc] < utf8.RuneSelf { @@ -126,6 +179,30 @@ type wideTransform struct { transform.NopResetter } +func (wideTransform) Span(src []byte, atEOF bool) (n int, err error) { + for n < len(src) { + // TODO: Consider ASCII fast path. Special-casing ASCII handling can + // reduce the ns/op of BenchmarkWideASCII by about 30%. This is probably + // not enough to warrant the extra code and complexity. + v, size := trie.lookup(src[n:]) + if size == 0 { // incomplete UTF-8 encoding + if !atEOF { + err = transform.ErrShortSrc + } else { + n = len(src) + } + break + } + if k := elem(v).kind(); byte(v) == 0 || k != EastAsianHalfwidth && k != EastAsianNarrow { + } else { + err = transform.ErrEndOfSpan + break + } + n += size + } + return n, err +} + func (wideTransform) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { for nSrc < len(src) { // TODO: Consider ASCII fast path. Special-casing ASCII handling can diff --git a/vendor/golang.org/x/text/width/trieval.go b/vendor/golang.org/x/text/width/trieval.go index 0ecffb4c64f..ca8e45fd19e 100644 --- a/vendor/golang.org/x/text/width/trieval.go +++ b/vendor/golang.org/x/text/width/trieval.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package width diff --git a/vendor/golang.org/x/text/width/width.go b/vendor/golang.org/x/text/width/width.go index c32d772fc70..0c9aec474ed 100644 --- a/vendor/golang.org/x/text/width/width.go +++ b/vendor/golang.org/x/text/width/width.go @@ -153,17 +153,22 @@ func (p Properties) Wide() rune { // Transformer implements the transform.Transformer interface. type Transformer struct { - t transform.Transformer + t transform.SpanningTransformer } // Reset implements the transform.Transformer interface. func (t Transformer) Reset() { t.t.Reset() } -// Transform implements the Transformer interface. +// Transform implements the transform.Transformer interface. func (t Transformer) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { return t.t.Transform(dst, src, atEOF) } +// Span implements the transform.SpanningTransformer interface. +func (t Transformer) Span(src []byte, atEOF bool) (n int, err error) { + return t.t.Span(src, atEOF) +} + // Bytes returns a new byte slice with the result of applying t to b. func (t Transformer) Bytes(b []byte) []byte { b, _, _ = transform.Bytes(t, b) diff --git a/vendor/google.golang.org/genproto/LICENSE b/vendor/google.golang.org/genproto/LICENSE new file mode 100644 index 00000000000..d6456956733 --- /dev/null +++ b/vendor/google.golang.org/genproto/LICENSE @@ -0,0 +1,202 @@ + + Apache License + Version 2.0, January 2004 + http://www.apache.org/licenses/ + + TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION + + 1. Definitions. + + "License" shall mean the terms and conditions for use, reproduction, + and distribution as defined by Sections 1 through 9 of this document. + + "Licensor" shall mean the copyright owner or entity authorized by + the copyright owner that is granting the License. + + "Legal Entity" shall mean the union of the acting entity and all + other entities that control, are controlled by, or are under common + control with that entity. For the purposes of this definition, + "control" means (i) the power, direct or indirect, to cause the + direction or management of such entity, whether by contract or + otherwise, or (ii) ownership of fifty percent (50%) or more of the + outstanding shares, or (iii) beneficial ownership of such entity. + + "You" (or "Your") shall mean an individual or Legal Entity + exercising permissions granted by this License. + + "Source" form shall mean the preferred form for making modifications, + including but not limited to software source code, documentation + source, and configuration files. + + "Object" form shall mean any form resulting from mechanical + transformation or translation of a Source form, including but + not limited to compiled object code, generated documentation, + and conversions to other media types. + + "Work" shall mean the work of authorship, whether in Source or + Object form, made available under the License, as indicated by a + copyright notice that is included in or attached to the work + (an example is provided in the Appendix below). + + "Derivative Works" shall mean any work, whether in Source or Object + form, that is based on (or derived from) the Work and for which the + editorial revisions, annotations, elaborations, or other modifications + represent, as a whole, an original work of authorship. For the purposes + of this License, Derivative Works shall not include works that remain + separable from, or merely link (or bind by name) to the interfaces of, + the Work and Derivative Works thereof. + + "Contribution" shall mean any work of authorship, including + the original version of the Work and any modifications or additions + to that Work or Derivative Works thereof, that is intentionally + submitted to Licensor for inclusion in the Work by the copyright owner + or by an individual or Legal Entity authorized to submit on behalf of + the copyright owner. For the purposes of this definition, "submitted" + means any form of electronic, verbal, or written communication sent + to the Licensor or its representatives, including but not limited to + communication on electronic mailing lists, source code control systems, + and issue tracking systems that are managed by, or on behalf of, the + Licensor for the purpose of discussing and improving the Work, but + excluding communication that is conspicuously marked or otherwise + designated in writing by the copyright owner as "Not a Contribution." + + "Contributor" shall mean Licensor and any individual or Legal Entity + on behalf of whom a Contribution has been received by Licensor and + subsequently incorporated within the Work. + + 2. Grant of Copyright License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + copyright license to reproduce, prepare Derivative Works of, + publicly display, publicly perform, sublicense, and distribute the + Work and such Derivative Works in Source or Object form. + + 3. Grant of Patent License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + (except as stated in this section) patent license to make, have made, + use, offer to sell, sell, import, and otherwise transfer the Work, + where such license applies only to those patent claims licensable + by such Contributor that are necessarily infringed by their + Contribution(s) alone or by combination of their Contribution(s) + with the Work to which such Contribution(s) was submitted. If You + institute patent litigation against any entity (including a + cross-claim or counterclaim in a lawsuit) alleging that the Work + or a Contribution incorporated within the Work constitutes direct + or contributory patent infringement, then any patent licenses + granted to You under this License for that Work shall terminate + as of the date such litigation is filed. + + 4. Redistribution. You may reproduce and distribute copies of the + Work or Derivative Works thereof in any medium, with or without + modifications, and in Source or Object form, provided that You + meet the following conditions: + + (a) You must give any other recipients of the Work or + Derivative Works a copy of this License; and + + (b) You must cause any modified files to carry prominent notices + stating that You changed the files; and + + (c) You must retain, in the Source form of any Derivative Works + that You distribute, all copyright, patent, trademark, and + attribution notices from the Source form of the Work, + excluding those notices that do not pertain to any part of + the Derivative Works; and + + (d) If the Work includes a "NOTICE" text file as part of its + distribution, then any Derivative Works that You distribute must + include a readable copy of the attribution notices contained + within such NOTICE file, excluding those notices that do not + pertain to any part of the Derivative Works, in at least one + of the following places: within a NOTICE text file distributed + as part of the Derivative Works; within the Source form or + documentation, if provided along with the Derivative Works; or, + within a display generated by the Derivative Works, if and + wherever such third-party notices normally appear. The contents + of the NOTICE file are for informational purposes only and + do not modify the License. You may add Your own attribution + notices within Derivative Works that You distribute, alongside + or as an addendum to the NOTICE text from the Work, provided + that such additional attribution notices cannot be construed + as modifying the License. + + You may add Your own copyright statement to Your modifications and + may provide additional or different license terms and conditions + for use, reproduction, or distribution of Your modifications, or + for any such Derivative Works as a whole, provided Your use, + reproduction, and distribution of the Work otherwise complies with + the conditions stated in this License. + + 5. Submission of Contributions. Unless You explicitly state otherwise, + any Contribution intentionally submitted for inclusion in the Work + by You to the Licensor shall be under the terms and conditions of + this License, without any additional terms or conditions. + Notwithstanding the above, nothing herein shall supersede or modify + the terms of any separate license agreement you may have executed + with Licensor regarding such Contributions. + + 6. Trademarks. This License does not grant permission to use the trade + names, trademarks, service marks, or product names of the Licensor, + except as required for reasonable and customary use in describing the + origin of the Work and reproducing the content of the NOTICE file. + + 7. Disclaimer of Warranty. Unless required by applicable law or + agreed to in writing, Licensor provides the Work (and each + Contributor provides its Contributions) on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or + implied, including, without limitation, any warranties or conditions + of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A + PARTICULAR PURPOSE. You are solely responsible for determining the + appropriateness of using or redistributing the Work and assume any + risks associated with Your exercise of permissions under this License. + + 8. Limitation of Liability. In no event and under no legal theory, + whether in tort (including negligence), contract, or otherwise, + unless required by applicable law (such as deliberate and grossly + negligent acts) or agreed to in writing, shall any Contributor be + liable to You for damages, including any direct, indirect, special, + incidental, or consequential damages of any character arising as a + result of this License or out of the use or inability to use the + Work (including but not limited to damages for loss of goodwill, + work stoppage, computer failure or malfunction, or any and all + other commercial damages or losses), even if such Contributor + has been advised of the possibility of such damages. + + 9. Accepting Warranty or Additional Liability. While redistributing + the Work or Derivative Works thereof, You may choose to offer, + and charge a fee for, acceptance of support, warranty, indemnity, + or other liability obligations and/or rights consistent with this + License. However, in accepting such obligations, You may act only + on Your own behalf and on Your sole responsibility, not on behalf + of any other Contributor, and only if You agree to indemnify, + defend, and hold each Contributor harmless for any liability + incurred by, or claims asserted against, such Contributor by reason + of your accepting any such warranty or additional liability. + + END OF TERMS AND CONDITIONS + + APPENDIX: How to apply the Apache License to your work. + + To apply the Apache License to your work, attach the following + boilerplate notice, with the fields enclosed by brackets "[]" + replaced with your own identifying information. (Don't include + the brackets!) The text should be enclosed in the appropriate + comment syntax for the file format. We also recommend that a + file or class name and description of purpose be included on the + same "printed page" as the copyright notice for easier + identification within third-party archives. + + Copyright [yyyy] [name of copyright owner] + + Licensed under the Apache License, Version 2.0 (the "License"); + you may not use this file except in compliance with the License. + You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + + Unless required by applicable law or agreed to in writing, software + distributed under the License is distributed on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + See the License for the specific language governing permissions and + limitations under the License. diff --git a/vendor/google.golang.org/genproto/googleapis/rpc/status/BUILD b/vendor/google.golang.org/genproto/googleapis/rpc/status/BUILD new file mode 100644 index 00000000000..c82d2b55118 --- /dev/null +++ b/vendor/google.golang.org/genproto/googleapis/rpc/status/BUILD @@ -0,0 +1,25 @@ +load("@io_bazel_rules_go//go:def.bzl", "go_library") + +go_library( + name = "go_default_library", + srcs = ["status.pb.go"], + visibility = ["//visibility:public"], + deps = [ + "//vendor/github.com/golang/protobuf/proto:go_default_library", + "//vendor/github.com/golang/protobuf/ptypes/any:go_default_library", + ], +) + +filegroup( + name = "package-srcs", + srcs = glob(["**"]), + tags = ["automanaged"], + visibility = ["//visibility:private"], +) + +filegroup( + name = "all-srcs", + srcs = [":package-srcs"], + tags = ["automanaged"], + visibility = ["//visibility:public"], +) diff --git a/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go b/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go new file mode 100644 index 00000000000..40e79375bf0 --- /dev/null +++ b/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go @@ -0,0 +1,143 @@ +// Code generated by protoc-gen-go. DO NOT EDIT. +// source: google/rpc/status.proto + +/* +Package status is a generated protocol buffer package. + +It is generated from these files: + google/rpc/status.proto + +It has these top-level messages: + Status +*/ +package status + +import proto "github.com/golang/protobuf/proto" +import fmt "fmt" +import math "math" +import google_protobuf "github.com/golang/protobuf/ptypes/any" + +// Reference imports to suppress errors if they are not otherwise used. +var _ = proto.Marshal +var _ = fmt.Errorf +var _ = math.Inf + +// This is a compile-time assertion to ensure that this generated file +// is compatible with the proto package it is being compiled against. +// A compilation error at this line likely means your copy of the +// proto package needs to be updated. +const _ = proto.ProtoPackageIsVersion2 // please upgrade the proto package + +// The `Status` type defines a logical error model that is suitable for different +// programming environments, including REST APIs and RPC APIs. It is used by +// [gRPC](https://github.com/grpc). The error model is designed to be: +// +// - Simple to use and understand for most users +// - Flexible enough to meet unexpected needs +// +// # Overview +// +// The `Status` message contains three pieces of data: error code, error message, +// and error details. The error code should be an enum value of +// [google.rpc.Code][google.rpc.Code], but it may accept additional error codes if needed. The +// error message should be a developer-facing English message that helps +// developers *understand* and *resolve* the error. If a localized user-facing +// error message is needed, put the localized message in the error details or +// localize it in the client. The optional error details may contain arbitrary +// information about the error. There is a predefined set of error detail types +// in the package `google.rpc` which can be used for common error conditions. +// +// # Language mapping +// +// The `Status` message is the logical representation of the error model, but it +// is not necessarily the actual wire format. When the `Status` message is +// exposed in different client libraries and different wire protocols, it can be +// mapped differently. For example, it will likely be mapped to some exceptions +// in Java, but more likely mapped to some error codes in C. +// +// # Other uses +// +// The error model and the `Status` message can be used in a variety of +// environments, either with or without APIs, to provide a +// consistent developer experience across different environments. +// +// Example uses of this error model include: +// +// - Partial errors. If a service needs to return partial errors to the client, +// it may embed the `Status` in the normal response to indicate the partial +// errors. +// +// - Workflow errors. A typical workflow has multiple steps. Each step may +// have a `Status` message for error reporting purpose. +// +// - Batch operations. If a client uses batch request and batch response, the +// `Status` message should be used directly inside batch response, one for +// each error sub-response. +// +// - Asynchronous operations. If an API call embeds asynchronous operation +// results in its response, the status of those operations should be +// represented directly using the `Status` message. +// +// - Logging. If some API errors are stored in logs, the message `Status` could +// be used directly after any stripping needed for security/privacy reasons. +type Status struct { + // The status code, which should be an enum value of [google.rpc.Code][google.rpc.Code]. + Code int32 `protobuf:"varint,1,opt,name=code" json:"code,omitempty"` + // A developer-facing error message, which should be in English. Any + // user-facing error message should be localized and sent in the + // [google.rpc.Status.details][google.rpc.Status.details] field, or localized by the client. + Message string `protobuf:"bytes,2,opt,name=message" json:"message,omitempty"` + // A list of messages that carry the error details. There will be a + // common set of message types for APIs to use. + Details []*google_protobuf.Any `protobuf:"bytes,3,rep,name=details" json:"details,omitempty"` +} + +func (m *Status) Reset() { *m = Status{} } +func (m *Status) String() string { return proto.CompactTextString(m) } +func (*Status) ProtoMessage() {} +func (*Status) Descriptor() ([]byte, []int) { return fileDescriptor0, []int{0} } + +func (m *Status) GetCode() int32 { + if m != nil { + return m.Code + } + return 0 +} + +func (m *Status) GetMessage() string { + if m != nil { + return m.Message + } + return "" +} + +func (m *Status) GetDetails() []*google_protobuf.Any { + if m != nil { + return m.Details + } + return nil +} + +func init() { + proto.RegisterType((*Status)(nil), "google.rpc.Status") +} + +func init() { proto.RegisterFile("google/rpc/status.proto", fileDescriptor0) } + +var fileDescriptor0 = []byte{ + // 209 bytes of a gzipped FileDescriptorProto + 0x1f, 0x8b, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0xff, 0xe2, 0x12, 0x4f, 0xcf, 0xcf, 0x4f, + 0xcf, 0x49, 0xd5, 0x2f, 0x2a, 0x48, 0xd6, 0x2f, 0x2e, 0x49, 0x2c, 0x29, 0x2d, 0xd6, 0x2b, 0x28, + 0xca, 0x2f, 0xc9, 0x17, 0xe2, 0x82, 0x48, 0xe8, 0x15, 0x15, 0x24, 0x4b, 0x49, 0x42, 0x15, 0x81, + 0x65, 0x92, 0x4a, 0xd3, 0xf4, 0x13, 0xf3, 0x2a, 0x21, 0xca, 0x94, 0xd2, 0xb8, 0xd8, 0x82, 0xc1, + 0xda, 0x84, 0x84, 0xb8, 0x58, 0x92, 0xf3, 0x53, 0x52, 0x25, 0x18, 0x15, 0x18, 0x35, 0x58, 0x83, + 0xc0, 0x6c, 0x21, 0x09, 0x2e, 0xf6, 0xdc, 0xd4, 0xe2, 0xe2, 0xc4, 0xf4, 0x54, 0x09, 0x26, 0x05, + 0x46, 0x0d, 0xce, 0x20, 0x18, 0x57, 0x48, 0x8f, 0x8b, 0x3d, 0x25, 0xb5, 0x24, 0x31, 0x33, 0xa7, + 0x58, 0x82, 0x59, 0x81, 0x59, 0x83, 0xdb, 0x48, 0x44, 0x0f, 0x6a, 0x21, 0xcc, 0x12, 0x3d, 0xc7, + 0xbc, 0xca, 0x20, 0x98, 0x22, 0xa7, 0x38, 0x2e, 0xbe, 0xe4, 0xfc, 0x5c, 0x3d, 0x84, 0xa3, 0x9c, + 0xb8, 0x21, 0xf6, 0x06, 0x80, 0x94, 0x07, 0x30, 0x46, 0x99, 0x43, 0xa5, 0xd2, 0xf3, 0x73, 0x12, + 0xf3, 0xd2, 0xf5, 0xf2, 0x8b, 0xd2, 0xf5, 0xd3, 0x53, 0xf3, 0xc0, 0x86, 0xe9, 0x43, 0xa4, 0x12, + 0x0b, 0x32, 0x8b, 0x91, 0xfc, 0x69, 0x0d, 0xa1, 0x16, 0x31, 0x31, 0x07, 0x05, 0x38, 0x27, 0xb1, + 0x81, 0x55, 0x1a, 0x03, 0x02, 0x00, 0x00, 0xff, 0xff, 0xa4, 0x53, 0xf0, 0x7c, 0x10, 0x01, 0x00, + 0x00, +} diff --git a/vendor/google.golang.org/grpc/.travis.yml b/vendor/google.golang.org/grpc/.travis.yml index 0c1a96c6857..b3577c7ae20 100644 --- a/vendor/google.golang.org/grpc/.travis.yml +++ b/vendor/google.golang.org/grpc/.travis.yml @@ -1,19 +1,19 @@ language: go go: - - 1.5.4 - 1.6.3 - 1.7 + - 1.8 go_import_path: google.golang.org/grpc before_install: - - if [[ $TRAVIS_GO_VERSION != 1.5* ]]; then go get github.com/golang/lint/golint; fi + - go get github.com/golang/lint/golint - go get -u golang.org/x/tools/cmd/goimports github.com/axw/gocov/gocov github.com/mattn/goveralls golang.org/x/tools/cmd/cover script: - '! gofmt -s -d -l . 2>&1 | read' - '! goimports -l . | read' - - 'if [[ $TRAVIS_GO_VERSION != 1.5* ]]; then ! golint ./... | grep -vE "(_string|\.pb)\.go:"; fi' + - '! golint ./... | grep -vE "(_mock|_string|\.pb)\.go:"' - '! go tool vet -all . 2>&1 | grep -vE "constant [0-9]+ not a string in call to Errorf" | grep -vF .pb.go:' # https://github.com/golang/protobuf/issues/214 - make test testrace diff --git a/vendor/google.golang.org/grpc/BUILD b/vendor/google.golang.org/grpc/BUILD index 205df7ee74b..f2dfb075f3d 100644 --- a/vendor/google.golang.org/grpc/BUILD +++ b/vendor/google.golang.org/grpc/BUILD @@ -7,8 +7,13 @@ go_library( "balancer.go", "call.go", "clientconn.go", + "codec.go", "doc.go", + "go16.go", + "go17.go", + "grpclb.go", "interceptor.go", + "proxy.go", "rpc_util.go", "server.go", "stream.go", @@ -22,10 +27,16 @@ go_library( "//vendor/golang.org/x/net/trace:go_default_library", "//vendor/google.golang.org/grpc/codes:go_default_library", "//vendor/google.golang.org/grpc/credentials:go_default_library", + "//vendor/google.golang.org/grpc/grpclb/grpc_lb_v1:go_default_library", "//vendor/google.golang.org/grpc/grpclog:go_default_library", "//vendor/google.golang.org/grpc/internal:go_default_library", + "//vendor/google.golang.org/grpc/keepalive:go_default_library", "//vendor/google.golang.org/grpc/metadata:go_default_library", "//vendor/google.golang.org/grpc/naming:go_default_library", + "//vendor/google.golang.org/grpc/peer:go_default_library", + "//vendor/google.golang.org/grpc/stats:go_default_library", + "//vendor/google.golang.org/grpc/status:go_default_library", + "//vendor/google.golang.org/grpc/tap:go_default_library", "//vendor/google.golang.org/grpc/transport:go_default_library", ], ) @@ -43,11 +54,16 @@ filegroup( ":package-srcs", "//vendor/google.golang.org/grpc/codes:all-srcs", "//vendor/google.golang.org/grpc/credentials:all-srcs", + "//vendor/google.golang.org/grpc/grpclb/grpc_lb_v1:all-srcs", "//vendor/google.golang.org/grpc/grpclog:all-srcs", "//vendor/google.golang.org/grpc/internal:all-srcs", + "//vendor/google.golang.org/grpc/keepalive:all-srcs", "//vendor/google.golang.org/grpc/metadata:all-srcs", "//vendor/google.golang.org/grpc/naming:all-srcs", "//vendor/google.golang.org/grpc/peer:all-srcs", + "//vendor/google.golang.org/grpc/stats:all-srcs", + "//vendor/google.golang.org/grpc/status:all-srcs", + "//vendor/google.golang.org/grpc/tap:all-srcs", "//vendor/google.golang.org/grpc/transport:all-srcs", ], tags = ["automanaged"], diff --git a/vendor/google.golang.org/grpc/README.md b/vendor/google.golang.org/grpc/README.md index 110a8cf4253..ae0236f92f3 100644 --- a/vendor/google.golang.org/grpc/README.md +++ b/vendor/google.golang.org/grpc/README.md @@ -1,4 +1,4 @@ -#gRPC-Go +# gRPC-Go [![Build Status](https://travis-ci.org/grpc/grpc-go.svg)](https://travis-ci.org/grpc/grpc-go) [![GoDoc](https://godoc.org/google.golang.org/grpc?status.svg)](https://godoc.org/google.golang.org/grpc) @@ -16,7 +16,7 @@ $ go get google.golang.org/grpc Prerequisites ------------- -This requires Go 1.5 or later. +This requires Go 1.6 or later. Constraints ----------- @@ -30,3 +30,12 @@ Status ------ GA +FAQ +--- + +#### Compiling error, undefined: grpc.SupportPackageIsVersion + +Please update proto package, gRPC package and rebuild the proto files: + - `go get -u github.com/golang/protobuf/{proto,protoc-gen-go}` + - `go get -u google.golang.org/grpc` + - `protoc --go_out=plugins=grpc:. *.proto` diff --git a/vendor/google.golang.org/grpc/call.go b/vendor/google.golang.org/grpc/call.go index 772c817edd3..af34a71316f 100644 --- a/vendor/google.golang.org/grpc/call.go +++ b/vendor/google.golang.org/grpc/call.go @@ -36,12 +36,14 @@ package grpc import ( "bytes" "io" - "math" "time" "golang.org/x/net/context" "golang.org/x/net/trace" "google.golang.org/grpc/codes" + "google.golang.org/grpc/peer" + "google.golang.org/grpc/stats" + "google.golang.org/grpc/status" "google.golang.org/grpc/transport" ) @@ -49,7 +51,8 @@ import ( // On error, it returns the error and indicates whether the call should be retried. // // TODO(zhaoq): Check whether the received message sequence is valid. -func recvResponse(dopts dialOptions, t transport.ClientTransport, c *callInfo, stream *transport.Stream, reply interface{}) (err error) { +// TODO ctx is used for stats collection and processing. It is the context passed from the application. +func recvResponse(ctx context.Context, dopts dialOptions, t transport.ClientTransport, c *callInfo, stream *transport.Stream, reply interface{}) (err error) { // Try to acquire header metadata from the server if there is any. defer func() { if err != nil { @@ -63,24 +66,34 @@ func recvResponse(dopts dialOptions, t transport.ClientTransport, c *callInfo, s return } p := &parser{r: stream} + var inPayload *stats.InPayload + if dopts.copts.StatsHandler != nil { + inPayload = &stats.InPayload{ + Client: true, + } + } for { - if err = recv(p, dopts.codec, stream, dopts.dc, reply, math.MaxInt32); err != nil { + if err = recv(p, dopts.codec, stream, dopts.dc, reply, dopts.maxMsgSize, inPayload); err != nil { if err == io.EOF { break } return } } + if inPayload != nil && err == io.EOF && stream.Status().Code() == codes.OK { + // TODO in the current implementation, inTrailer may be handled before inPayload in some cases. + // Fix the order if necessary. + dopts.copts.StatsHandler.HandleRPC(ctx, inPayload) + } c.trailerMD = stream.Trailer() + if peer, ok := peer.FromContext(stream.Context()); ok { + c.peer = peer + } return nil } // sendRequest writes out various information of an RPC such as Context and Message. -func sendRequest(ctx context.Context, codec Codec, compressor Compressor, callHdr *transport.CallHdr, t transport.ClientTransport, args interface{}, opts *transport.Options) (_ *transport.Stream, err error) { - stream, err := t.NewStream(ctx, callHdr) - if err != nil { - return nil, err - } +func sendRequest(ctx context.Context, dopts dialOptions, compressor Compressor, callHdr *transport.CallHdr, stream *transport.Stream, t transport.ClientTransport, args interface{}, opts *transport.Options) (err error) { defer func() { if err != nil { // If err is connection error, t will be closed, no need to close stream here. @@ -89,23 +102,35 @@ func sendRequest(ctx context.Context, codec Codec, compressor Compressor, callHd } } }() - var cbuf *bytes.Buffer + var ( + cbuf *bytes.Buffer + outPayload *stats.OutPayload + ) if compressor != nil { cbuf = new(bytes.Buffer) } - outBuf, err := encode(codec, args, compressor, cbuf) + if dopts.copts.StatsHandler != nil { + outPayload = &stats.OutPayload{ + Client: true, + } + } + outBuf, err := encode(dopts.codec, args, compressor, cbuf, outPayload) if err != nil { - return nil, Errorf(codes.Internal, "grpc: %v", err) + return Errorf(codes.Internal, "grpc: %v", err) } err = t.Write(stream, outBuf, opts) + if err == nil && outPayload != nil { + outPayload.SentTime = time.Now() + dopts.copts.StatsHandler.HandleRPC(ctx, outPayload) + } // t.NewStream(...) could lead to an early rejection of the RPC (e.g., the service/method // does not exist.) so that t.Write could get io.EOF from wait(...). Leave the following // recvResponse to get the final status. if err != nil && err != io.EOF { - return nil, err + return err } // Sent successfully. - return stream, nil + return nil } // Invoke sends the RPC request on the wire and returns after response is received. @@ -118,8 +143,16 @@ func Invoke(ctx context.Context, method string, args, reply interface{}, cc *Cli return invoke(ctx, method, args, reply, cc, opts...) } -func invoke(ctx context.Context, method string, args, reply interface{}, cc *ClientConn, opts ...CallOption) (err error) { +func invoke(ctx context.Context, method string, args, reply interface{}, cc *ClientConn, opts ...CallOption) (e error) { c := defaultCallInfo + if mc, ok := cc.getMethodConfig(method); ok { + c.failFast = !mc.WaitForReady + if mc.Timeout > 0 { + var cancel context.CancelFunc + ctx, cancel = context.WithTimeout(ctx, mc.Timeout) + defer cancel() + } + } for _, o := range opts { if err := o.before(&c); err != nil { return toRPCErr(err) @@ -140,12 +173,33 @@ func invoke(ctx context.Context, method string, args, reply interface{}, cc *Cli c.traceInfo.tr.LazyLog(&c.traceInfo.firstLine, false) // TODO(dsymonds): Arrange for c.traceInfo.firstLine.remoteAddr to be set. defer func() { - if err != nil { - c.traceInfo.tr.LazyLog(&fmtStringer{"%v", []interface{}{err}}, true) + if e != nil { + c.traceInfo.tr.LazyLog(&fmtStringer{"%v", []interface{}{e}}, true) c.traceInfo.tr.SetError() } }() } + ctx = newContextWithRPCInfo(ctx) + sh := cc.dopts.copts.StatsHandler + if sh != nil { + ctx = sh.TagRPC(ctx, &stats.RPCTagInfo{FullMethodName: method}) + begin := &stats.Begin{ + Client: true, + BeginTime: time.Now(), + FailFast: c.failFast, + } + sh.HandleRPC(ctx, begin) + } + defer func() { + if sh != nil { + end := &stats.End{ + Client: true, + EndTime: time.Now(), + Error: e, + } + sh.HandleRPC(ctx, end) + } + }() topts := &transport.Options{ Last: true, Delay: false, @@ -167,13 +221,14 @@ func invoke(ctx context.Context, method string, args, reply interface{}, cc *Cli if cc.dopts.cp != nil { callHdr.SendCompress = cc.dopts.cp.Type() } + gopts := BalancerGetOptions{ BlockingWait: !c.failFast, } t, put, err = cc.getTransport(ctx, gopts) if err != nil { // TODO(zhaoq): Probably revisit the error handling. - if _, ok := err.(*rpcError); ok { + if _, ok := status.FromError(err); ok { return err } if err == errConnClosing || err == errConnUnavailable { @@ -188,33 +243,49 @@ func invoke(ctx context.Context, method string, args, reply interface{}, cc *Cli if c.traceInfo.tr != nil { c.traceInfo.tr.LazyLog(&payload{sent: true, msg: args}, true) } - stream, err = sendRequest(ctx, cc.dopts.codec, cc.dopts.cp, callHdr, t, args, topts) + stream, err = t.NewStream(ctx, callHdr) if err != nil { if put != nil { - put() - put = nil - } - // Retry a non-failfast RPC when - // i) there is a connection error; or - // ii) the server started to drain before this RPC was initiated. - if _, ok := err.(transport.ConnectionError); ok || err == transport.ErrStreamDrain { - if c.failFast { - return toRPCErr(err) + if _, ok := err.(transport.ConnectionError); ok { + // If error is connection error, transport was sending data on wire, + // and we are not sure if anything has been sent on wire. + // If error is not connection error, we are sure nothing has been sent. + updateRPCInfoInContext(ctx, rpcInfo{bytesSent: true, bytesReceived: false}) } + put() + } + if _, ok := err.(transport.ConnectionError); (ok || err == transport.ErrStreamDrain) && !c.failFast { continue } return toRPCErr(err) } - err = recvResponse(cc.dopts, t, &c, stream, reply) + err = sendRequest(ctx, cc.dopts, cc.dopts.cp, callHdr, stream, t, args, topts) if err != nil { if put != nil { + updateRPCInfoInContext(ctx, rpcInfo{ + bytesSent: stream.BytesSent(), + bytesReceived: stream.BytesReceived(), + }) put() - put = nil } - if _, ok := err.(transport.ConnectionError); ok || err == transport.ErrStreamDrain { - if c.failFast { - return toRPCErr(err) - } + // Retry a non-failfast RPC when + // i) there is a connection error; or + // ii) the server started to drain before this RPC was initiated. + if _, ok := err.(transport.ConnectionError); (ok || err == transport.ErrStreamDrain) && !c.failFast { + continue + } + return toRPCErr(err) + } + err = recvResponse(ctx, cc.dopts, t, &c, stream, reply) + if err != nil { + if put != nil { + updateRPCInfoInContext(ctx, rpcInfo{ + bytesSent: stream.BytesSent(), + bytesReceived: stream.BytesReceived(), + }) + put() + } + if _, ok := err.(transport.ConnectionError); (ok || err == transport.ErrStreamDrain) && !c.failFast { continue } return toRPCErr(err) @@ -224,9 +295,12 @@ func invoke(ctx context.Context, method string, args, reply interface{}, cc *Cli } t.CloseStream(stream, nil) if put != nil { + updateRPCInfoInContext(ctx, rpcInfo{ + bytesSent: stream.BytesSent(), + bytesReceived: stream.BytesReceived(), + }) put() - put = nil } - return Errorf(stream.StatusCode(), "%s", stream.StatusDesc()) + return stream.Status().Err() } } diff --git a/vendor/google.golang.org/grpc/clientconn.go b/vendor/google.golang.org/grpc/clientconn.go index 61674729a77..f542d8bd041 100644 --- a/vendor/google.golang.org/grpc/clientconn.go +++ b/vendor/google.golang.org/grpc/clientconn.go @@ -36,8 +36,8 @@ package grpc import ( "errors" "fmt" + "math" "net" - "strings" "sync" "time" @@ -45,6 +45,8 @@ import ( "golang.org/x/net/trace" "google.golang.org/grpc/credentials" "google.golang.org/grpc/grpclog" + "google.golang.org/grpc/keepalive" + "google.golang.org/grpc/stats" "google.golang.org/grpc/transport" ) @@ -54,6 +56,8 @@ var ( ErrClientConnClosing = errors.New("grpc: the client connection is closing") // ErrClientConnTimeout indicates that the ClientConn cannot establish the // underlying connections within the specified timeout. + // DEPRECATED: Please use context.DeadlineExceeded instead. This error will be + // removed in Q1 2017. ErrClientConnTimeout = errors.New("grpc: timed out when dialing") // errNoTransportSecurity indicates that there is no transport security @@ -75,7 +79,6 @@ var ( errConnClosing = errors.New("grpc: the connection is closing") // errConnUnavailable indicates that the connection is unavailable. errConnUnavailable = errors.New("grpc: the connection is unavailable") - errNoAddr = errors.New("grpc: there is no address available to dial") // minimum time to give a connection to complete minConnectTimeout = 20 * time.Second ) @@ -83,22 +86,33 @@ var ( // dialOptions configure a Dial call. dialOptions are set by the DialOption // values passed to Dial. type dialOptions struct { - unaryInt UnaryClientInterceptor - streamInt StreamClientInterceptor - codec Codec - cp Compressor - dc Decompressor - bs backoffStrategy - balancer Balancer - block bool - insecure bool - timeout time.Duration - copts transport.ConnectOptions + unaryInt UnaryClientInterceptor + streamInt StreamClientInterceptor + codec Codec + cp Compressor + dc Decompressor + bs backoffStrategy + balancer Balancer + block bool + insecure bool + timeout time.Duration + scChan <-chan ServiceConfig + copts transport.ConnectOptions + maxMsgSize int } +const defaultClientMaxMsgSize = math.MaxInt32 + // DialOption configures how we set up the connection. type DialOption func(*dialOptions) +// WithMaxMsgSize returns a DialOption which sets the maximum message size the client can receive. +func WithMaxMsgSize(s int) DialOption { + return func(o *dialOptions) { + o.maxMsgSize = s + } +} + // WithCodec returns a DialOption which sets a codec for message marshaling and unmarshaling. func WithCodec(c Codec) DialOption { return func(o *dialOptions) { @@ -129,6 +143,13 @@ func WithBalancer(b Balancer) DialOption { } } +// WithServiceConfig returns a DialOption which has a channel to read the service configuration. +func WithServiceConfig(c <-chan ServiceConfig) DialOption { + return func(o *dialOptions) { + o.scChan = c + } +} + // WithBackoffMaxDelay configures the dialer to use the provided maximum delay // when backing off after failed connection attempts. func WithBackoffMaxDelay(md time.Duration) DialOption { @@ -199,6 +220,8 @@ func WithTimeout(d time.Duration) DialOption { } // WithDialer returns a DialOption that specifies a function to use for dialing network addresses. +// If FailOnNonTempDialError() is set to true, and an error is returned by f, gRPC checks the error's +// Temporary() method to decide if it should try to reconnect to the network address. func WithDialer(f func(string, time.Duration) (net.Conn, error)) DialOption { return func(o *dialOptions) { o.copts.Dialer = func(ctx context.Context, addr string) (net.Conn, error) { @@ -210,6 +233,25 @@ func WithDialer(f func(string, time.Duration) (net.Conn, error)) DialOption { } } +// WithStatsHandler returns a DialOption that specifies the stats handler +// for all the RPCs and underlying network connections in this ClientConn. +func WithStatsHandler(h stats.Handler) DialOption { + return func(o *dialOptions) { + o.copts.StatsHandler = h + } +} + +// FailOnNonTempDialError returns a DialOption that specified if gRPC fails on non-temporary dial errors. +// If f is true, and dialer returns a non-temporary error, gRPC will fail the connection to the network +// address and won't try to reconnect. +// The default value of FailOnNonTempDialError is false. +// This is an EXPERIMENTAL API. +func FailOnNonTempDialError(f bool) DialOption { + return func(o *dialOptions) { + o.copts.FailOnNonTempDialError = f + } +} + // WithUserAgent returns a DialOption that specifies a user agent string for all the RPCs. func WithUserAgent(s string) DialOption { return func(o *dialOptions) { @@ -217,6 +259,13 @@ func WithUserAgent(s string) DialOption { } } +// WithKeepaliveParams returns a DialOption that specifies keepalive paramaters for the client transport. +func WithKeepaliveParams(kp keepalive.ClientParameters) DialOption { + return func(o *dialOptions) { + o.copts.KeepaliveParams = kp + } +} + // WithUnaryInterceptor returns a DialOption that specifies the interceptor for unary RPCs. func WithUnaryInterceptor(f UnaryClientInterceptor) DialOption { return func(o *dialOptions) { @@ -231,6 +280,15 @@ func WithStreamInterceptor(f StreamClientInterceptor) DialOption { } } +// WithAuthority returns a DialOption that specifies the value to be used as +// the :authority pseudo-header. This value only works with WithInsecure and +// has no effect if TransportCredentials are present. +func WithAuthority(a string) DialOption { + return func(o *dialOptions) { + o.copts.Authority = a + } +} + // Dial creates a client connection to the given target. func Dial(target string, opts ...DialOption) (*ClientConn, error) { return DialContext(context.Background(), target, opts...) @@ -247,6 +305,32 @@ func DialContext(ctx context.Context, target string, opts ...DialOption) (conn * conns: make(map[Address]*addrConn), } cc.ctx, cc.cancel = context.WithCancel(context.Background()) + cc.dopts.maxMsgSize = defaultClientMaxMsgSize + for _, opt := range opts { + opt(&cc.dopts) + } + cc.mkp = cc.dopts.copts.KeepaliveParams + + if cc.dopts.copts.Dialer == nil { + cc.dopts.copts.Dialer = newProxyDialer( + func(ctx context.Context, addr string) (net.Conn, error) { + return dialContext(ctx, "tcp", addr) + }, + ) + } + + if cc.dopts.copts.UserAgent != "" { + cc.dopts.copts.UserAgent += " " + grpcUA + } else { + cc.dopts.copts.UserAgent = grpcUA + } + + if cc.dopts.timeout > 0 { + var cancel context.CancelFunc + ctx, cancel = context.WithTimeout(ctx, cc.dopts.timeout) + defer cancel() + } + defer func() { select { case <-ctx.Done(): @@ -259,10 +343,17 @@ func DialContext(ctx context.Context, target string, opts ...DialOption) (conn * } }() - for _, opt := range opts { - opt(&cc.dopts) + if cc.dopts.scChan != nil { + // Wait for the initial service config. + select { + case sc, ok := <-cc.dopts.scChan: + if ok { + cc.sc = sc + } + case <-ctx.Done(): + return nil, ctx.Err() + } } - // Set defaults. if cc.dopts.codec == nil { cc.dopts.codec = protoCodec{} @@ -273,21 +364,18 @@ func DialContext(ctx context.Context, target string, opts ...DialOption) (conn * creds := cc.dopts.copts.TransportCredentials if creds != nil && creds.Info().ServerName != "" { cc.authority = creds.Info().ServerName + } else if cc.dopts.insecure && cc.dopts.copts.Authority != "" { + cc.authority = cc.dopts.copts.Authority } else { - colonPos := strings.LastIndex(target, ":") - if colonPos == -1 { - colonPos = len(target) - } - cc.authority = target[:colonPos] + cc.authority = target } - var ok bool waitC := make(chan error, 1) go func() { - var addrs []Address - if cc.dopts.balancer == nil { - // Connect to target directly if balancer is nil. - addrs = append(addrs, Address{Addr: target}) - } else { + defer close(waitC) + if cc.dopts.balancer == nil && cc.sc.LB != nil { + cc.dopts.balancer = cc.sc.LB + } + if cc.dopts.balancer != nil { var credsClone credentials.TransportCredentials if creds != nil { credsClone = creds.Clone() @@ -300,29 +388,23 @@ func DialContext(ctx context.Context, target string, opts ...DialOption) (conn * return } ch := cc.dopts.balancer.Notify() - if ch == nil { - // There is no name resolver installed. - addrs = append(addrs, Address{Addr: target}) - } else { - addrs, ok = <-ch - if !ok || len(addrs) == 0 { - waitC <- errNoAddr - return + if ch != nil { + if cc.dopts.block { + doneChan := make(chan struct{}) + go cc.lbWatcher(doneChan) + <-doneChan + } else { + go cc.lbWatcher(nil) } - } - } - for _, a := range addrs { - if err := cc.resetAddrConn(a, false, nil); err != nil { - waitC <- err return } } - close(waitC) + // No balancer, or no resolver within the balancer. Connect directly. + if err := cc.resetAddrConn(Address{Addr: target}, cc.dopts.block, nil); err != nil { + waitC <- err + return + } }() - var timeoutCh <-chan time.Time - if cc.dopts.timeout > 0 { - timeoutCh = time.After(cc.dopts.timeout) - } select { case <-ctx.Done(): return nil, ctx.Err() @@ -330,14 +412,12 @@ func DialContext(ctx context.Context, target string, opts ...DialOption) (conn * if err != nil { return nil, err } - case <-timeoutCh: - return nil, ErrClientConnTimeout } - // If balancer is nil or balancer.Notify() is nil, ok will be false here. - // The lbWatcher goroutine will not be created. - if ok { - go cc.lbWatcher() + + if cc.dopts.scChan != nil { + go cc.scWatcher() } + return cc, nil } @@ -384,10 +464,16 @@ type ClientConn struct { dopts dialOptions mu sync.RWMutex + sc ServiceConfig conns map[Address]*addrConn + // Keepalive parameter can be udated if a GoAway is received. + mkp keepalive.ClientParameters } -func (cc *ClientConn) lbWatcher() { +// lbWatcher watches the Notify channel of the balancer in cc and manages +// connections accordingly. If doneChan is not nil, it is closed after the +// first successfull connection is made. +func (cc *ClientConn) lbWatcher(doneChan chan struct{}) { for addrs := range cc.dopts.balancer.Notify() { var ( add []Address // Addresses need to setup connections. @@ -414,7 +500,15 @@ func (cc *ClientConn) lbWatcher() { } cc.mu.Unlock() for _, a := range add { - cc.resetAddrConn(a, true, nil) + if doneChan != nil { + err := cc.resetAddrConn(a, true, nil) + if err == nil { + close(doneChan) + doneChan = nil + } + } else { + cc.resetAddrConn(a, false, nil) + } } for _, c := range del { c.tearDown(errConnDrain) @@ -422,15 +516,36 @@ func (cc *ClientConn) lbWatcher() { } } +func (cc *ClientConn) scWatcher() { + for { + select { + case sc, ok := <-cc.dopts.scChan: + if !ok { + return + } + cc.mu.Lock() + // TODO: load balance policy runtime change is ignored. + // We may revist this decision in the future. + cc.sc = sc + cc.mu.Unlock() + case <-cc.ctx.Done(): + return + } + } +} + // resetAddrConn creates an addrConn for addr and adds it to cc.conns. // If there is an old addrConn for addr, it will be torn down, using tearDownErr as the reason. // If tearDownErr is nil, errConnDrain will be used instead. -func (cc *ClientConn) resetAddrConn(addr Address, skipWait bool, tearDownErr error) error { +func (cc *ClientConn) resetAddrConn(addr Address, block bool, tearDownErr error) error { ac := &addrConn{ cc: cc, addr: addr, dopts: cc.dopts, } + cc.mu.RLock() + ac.dopts.copts.KeepaliveParams = cc.mkp + cc.mu.RUnlock() ac.ctx, ac.cancel = context.WithCancel(cc.ctx) ac.stateCV = sync.NewCond(&ac.mu) if EnableTracing { @@ -475,8 +590,7 @@ func (cc *ClientConn) resetAddrConn(addr Address, skipWait bool, tearDownErr err stale.tearDown(tearDownErr) } } - // skipWait may overwrite the decision in ac.dopts.block. - if ac.dopts.block && !skipWait { + if block { if err := ac.resetTransport(false); err != nil { if err != errConnClosing { // Tear down ac and delete it from cc.conns. @@ -509,6 +623,14 @@ func (cc *ClientConn) resetAddrConn(addr Address, skipWait bool, tearDownErr err return nil } +// TODO: Avoid the locking here. +func (cc *ClientConn) getMethodConfig(method string) (m MethodConfig, ok bool) { + cc.mu.RLock() + defer cc.mu.RUnlock() + m, ok = cc.sc.Methods[method] + return +} + func (cc *ClientConn) getTransport(ctx context.Context, opts BalancerGetOptions) (transport.ClientTransport, func(), error) { var ( ac *addrConn @@ -547,6 +669,7 @@ func (cc *ClientConn) getTransport(ctx context.Context, opts BalancerGetOptions) } if !ok { if put != nil { + updateRPCInfoInContext(ctx, rpcInfo{bytesSent: false, bytesReceived: false}) put() } return nil, nil, errConnClosing @@ -554,6 +677,7 @@ func (cc *ClientConn) getTransport(ctx context.Context, opts BalancerGetOptions) t, err := ac.wait(ctx, cc.dopts.balancer != nil, !opts.BlockingWait) if err != nil { if put != nil { + updateRPCInfoInContext(ctx, rpcInfo{bytesSent: false, bytesReceived: false}) put() } return nil, nil, err @@ -605,6 +729,20 @@ type addrConn struct { tearDownErr error } +// adjustParams updates parameters used to create transports upon +// receiving a GoAway. +func (ac *addrConn) adjustParams(r transport.GoAwayReason) { + switch r { + case transport.TooManyPings: + v := 2 * ac.dopts.copts.KeepaliveParams.Time + ac.cc.mu.Lock() + if v > ac.cc.mkp.Time { + ac.cc.mkp.Time = v + } + ac.cc.mu.Unlock() + } +} + // printf records an event in ac's event log, unless ac has been closed. // REQUIRES ac.mu is held. func (ac *addrConn) printf(format string, a ...interface{}) { @@ -689,6 +827,8 @@ func (ac *addrConn) resetTransport(closeTransport bool) error { Metadata: ac.addr.Metadata, } newTransport, err := transport.NewClientTransport(ctx, sinfo, ac.dopts.copts) + // Don't call cancel in success path due to a race in Go 1.6: + // https://github.com/golang/go/issues/15078. if err != nil { cancel() @@ -759,6 +899,7 @@ func (ac *addrConn) transportMonitor() { } return case <-t.GoAway(): + ac.adjustParams(t.GetGoAwayReason()) // If GoAway happens without any network I/O error, ac is closed without shutting down the // underlying transport (the transport will be closed when all the pending RPCs finished or // failed.). @@ -767,9 +908,9 @@ func (ac *addrConn) transportMonitor() { // In both cases, a new ac is created. select { case <-t.Error(): - ac.cc.resetAddrConn(ac.addr, true, errNetworkIO) + ac.cc.resetAddrConn(ac.addr, false, errNetworkIO) default: - ac.cc.resetAddrConn(ac.addr, true, errConnDrain) + ac.cc.resetAddrConn(ac.addr, false, errConnDrain) } return case <-t.Error(): @@ -778,7 +919,8 @@ func (ac *addrConn) transportMonitor() { t.Close() return case <-t.GoAway(): - ac.cc.resetAddrConn(ac.addr, true, errNetworkIO) + ac.adjustParams(t.GetGoAwayReason()) + ac.cc.resetAddrConn(ac.addr, false, errNetworkIO) return default: } diff --git a/vendor/google.golang.org/grpc/codec.go b/vendor/google.golang.org/grpc/codec.go new file mode 100644 index 00000000000..bd76ebb7f17 --- /dev/null +++ b/vendor/google.golang.org/grpc/codec.go @@ -0,0 +1,118 @@ +/* +* + * Copyright 2014, Google Inc. + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions are + * met: + * + * * Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * * Redistributions in binary form must reproduce the above + * copyright notice, this list of conditions and the following disclaimer + * in the documentation and/or other materials provided with the + * distribution. + * * Neither the name of Google Inc. nor the names of its + * contributors may be used to endorse or promote products derived from + * this software without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS + * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT + * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR + * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT + * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT + * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, + * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY + * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + * +*/ + +package grpc + +import ( + "math" + "sync" + + "github.com/golang/protobuf/proto" +) + +// Codec defines the interface gRPC uses to encode and decode messages. +// Note that implementations of this interface must be thread safe; +// a Codec's methods can be called from concurrent goroutines. +type Codec interface { + // Marshal returns the wire format of v. + Marshal(v interface{}) ([]byte, error) + // Unmarshal parses the wire format into v. + Unmarshal(data []byte, v interface{}) error + // String returns the name of the Codec implementation. The returned + // string will be used as part of content type in transmission. + String() string +} + +// protoCodec is a Codec implementation with protobuf. It is the default codec for gRPC. +type protoCodec struct { +} + +type cachedProtoBuffer struct { + lastMarshaledSize uint32 + proto.Buffer +} + +func capToMaxInt32(val int) uint32 { + if val > math.MaxInt32 { + return uint32(math.MaxInt32) + } + return uint32(val) +} + +func (p protoCodec) marshal(v interface{}, cb *cachedProtoBuffer) ([]byte, error) { + protoMsg := v.(proto.Message) + newSlice := make([]byte, 0, cb.lastMarshaledSize) + + cb.SetBuf(newSlice) + cb.Reset() + if err := cb.Marshal(protoMsg); err != nil { + return nil, err + } + out := cb.Bytes() + cb.lastMarshaledSize = capToMaxInt32(len(out)) + return out, nil +} + +func (p protoCodec) Marshal(v interface{}) ([]byte, error) { + cb := protoBufferPool.Get().(*cachedProtoBuffer) + out, err := p.marshal(v, cb) + + // put back buffer and lose the ref to the slice + cb.SetBuf(nil) + protoBufferPool.Put(cb) + return out, err +} + +func (p protoCodec) Unmarshal(data []byte, v interface{}) error { + cb := protoBufferPool.Get().(*cachedProtoBuffer) + cb.SetBuf(data) + err := cb.Unmarshal(v.(proto.Message)) + cb.SetBuf(nil) + protoBufferPool.Put(cb) + return err +} + +func (protoCodec) String() string { + return "proto" +} + +var ( + protoBufferPool = &sync.Pool{ + New: func() interface{} { + return &cachedProtoBuffer{ + Buffer: proto.Buffer{}, + lastMarshaledSize: 16, + } + }, + } +) diff --git a/vendor/google.golang.org/grpc/codegen.sh b/vendor/google.golang.org/grpc/codegen.sh index b0094888429..4cdc6ba7c09 100755 --- a/vendor/google.golang.org/grpc/codegen.sh +++ b/vendor/google.golang.org/grpc/codegen.sh @@ -1,4 +1,4 @@ -#!/bin/bash +#!/usr/bin/env bash # This script serves as an example to demonstrate how to generate the gRPC-Go # interface and the related messages from .proto file. diff --git a/vendor/google.golang.org/grpc/coverage.sh b/vendor/google.golang.org/grpc/coverage.sh index 120235374a4..b85f9181dee 100755 --- a/vendor/google.golang.org/grpc/coverage.sh +++ b/vendor/google.golang.org/grpc/coverage.sh @@ -1,4 +1,5 @@ -#!/bin/bash +#!/usr/bin/env bash + set -e diff --git a/vendor/google.golang.org/grpc/credentials/BUILD b/vendor/google.golang.org/grpc/credentials/BUILD index f64933d442b..e2db54fc98c 100644 --- a/vendor/google.golang.org/grpc/credentials/BUILD +++ b/vendor/google.golang.org/grpc/credentials/BUILD @@ -5,6 +5,7 @@ go_library( srcs = [ "credentials.go", "credentials_util_go17.go", + "credentials_util_go18.go", "credentials_util_pre_go17.go", ], visibility = ["//visibility:public"], diff --git a/vendor/google.golang.org/grpc/credentials/credentials.go b/vendor/google.golang.org/grpc/credentials/credentials.go index 4154f1eeba9..d1217344b67 100644 --- a/vendor/google.golang.org/grpc/credentials/credentials.go +++ b/vendor/google.golang.org/grpc/credentials/credentials.go @@ -102,6 +102,10 @@ type TransportCredentials interface { // authentication protocol on rawConn for clients. It returns the authenticated // connection and the corresponding auth information about the connection. // Implementations must use the provided context to implement timely cancellation. + // gRPC will try to reconnect if the error returned is a temporary error + // (io.EOF, context.DeadlineExceeded or err.Temporary() == true). + // If the returned error is a wrapper error, implementations should make sure that + // the error implements Temporary() to have the correct retry behaviors. ClientHandshake(context.Context, string, net.Conn) (net.Conn, AuthInfo, error) // ServerHandshake does the authentication handshake for servers. It returns // the authenticated connection and the corresponding auth information about @@ -165,9 +169,7 @@ func (c *tlsCreds) ClientHandshake(ctx context.Context, addr string, rawConn net case <-ctx.Done(): return nil, nil, ctx.Err() } - // TODO(zhaoq): Omit the auth info for client now. It is more for - // information than anything else. - return conn, nil, nil + return conn, TLSInfo{conn.ConnectionState()}, nil } func (c *tlsCreds) ServerHandshake(rawConn net.Conn) (net.Conn, AuthInfo, error) { diff --git a/vendor/google.golang.org/grpc/credentials/credentials_util_go17.go b/vendor/google.golang.org/grpc/credentials/credentials_util_go17.go index 9647b9ec83a..7597b09e358 100644 --- a/vendor/google.golang.org/grpc/credentials/credentials_util_go17.go +++ b/vendor/google.golang.org/grpc/credentials/credentials_util_go17.go @@ -1,4 +1,5 @@ // +build go1.7 +// +build !go1.8 /* * @@ -44,8 +45,6 @@ import ( // contains a mutex and must not be copied. // // If cfg is nil, a new zero tls.Config is returned. -// -// TODO replace this function with official clone function. func cloneTLSConfig(cfg *tls.Config) *tls.Config { if cfg == nil { return &tls.Config{} diff --git a/vendor/google.golang.org/grpc/credentials/credentials_util_go18.go b/vendor/google.golang.org/grpc/credentials/credentials_util_go18.go new file mode 100644 index 00000000000..0ecf342da84 --- /dev/null +++ b/vendor/google.golang.org/grpc/credentials/credentials_util_go18.go @@ -0,0 +1,53 @@ +// +build go1.8 + +/* + * + * Copyright 2017, Google Inc. + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions are + * met: + * + * * Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * * Redistributions in binary form must reproduce the above + * copyright notice, this list of conditions and the following disclaimer + * in the documentation and/or other materials provided with the + * distribution. + * * Neither the name of Google Inc. nor the names of its + * contributors may be used to endorse or promote products derived from + * this software without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS + * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT + * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR + * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT + * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT + * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, + * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY + * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + * + */ + +package credentials + +import ( + "crypto/tls" +) + +// cloneTLSConfig returns a shallow clone of the exported +// fields of cfg, ignoring the unexported sync.Once, which +// contains a mutex and must not be copied. +// +// If cfg is nil, a new zero tls.Config is returned. +func cloneTLSConfig(cfg *tls.Config) *tls.Config { + if cfg == nil { + return &tls.Config{} + } + + return cfg.Clone() +} diff --git a/vendor/google.golang.org/grpc/credentials/credentials_util_pre_go17.go b/vendor/google.golang.org/grpc/credentials/credentials_util_pre_go17.go index 09b8d12c79b..cfd40dfa34a 100644 --- a/vendor/google.golang.org/grpc/credentials/credentials_util_pre_go17.go +++ b/vendor/google.golang.org/grpc/credentials/credentials_util_pre_go17.go @@ -44,8 +44,6 @@ import ( // contains a mutex and must not be copied. // // If cfg is nil, a new zero tls.Config is returned. -// -// TODO replace this function with official clone function. func cloneTLSConfig(cfg *tls.Config) *tls.Config { if cfg == nil { return &tls.Config{} diff --git a/vendor/google.golang.org/grpc/go16.go b/vendor/google.golang.org/grpc/go16.go new file mode 100644 index 00000000000..b61c57e88de --- /dev/null +++ b/vendor/google.golang.org/grpc/go16.go @@ -0,0 +1,56 @@ +// +build go1.6,!go1.7 + +/* + * Copyright 2016, Google Inc. + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions are + * met: + * + * * Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * * Redistributions in binary form must reproduce the above + * copyright notice, this list of conditions and the following disclaimer + * in the documentation and/or other materials provided with the + * distribution. + * * Neither the name of Google Inc. nor the names of its + * contributors may be used to endorse or promote products derived from + * this software without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS + * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT + * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR + * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT + * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT + * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, + * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY + * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + * + */ + +package grpc + +import ( + "fmt" + "net" + "net/http" + + "golang.org/x/net/context" +) + +// dialContext connects to the address on the named network. +func dialContext(ctx context.Context, network, address string) (net.Conn, error) { + return (&net.Dialer{Cancel: ctx.Done()}).Dial(network, address) +} + +func sendHTTPRequest(ctx context.Context, req *http.Request, conn net.Conn) error { + req.Cancel = ctx.Done() + if err := req.Write(conn); err != nil { + return fmt.Errorf("failed to write the HTTP request: %v", err) + } + return nil +} diff --git a/vendor/google.golang.org/grpc/transport/pre_go16.go b/vendor/google.golang.org/grpc/go17.go similarity index 86% rename from vendor/google.golang.org/grpc/transport/pre_go16.go rename to vendor/google.golang.org/grpc/go17.go index 33d91c17c4e..844f0e1899b 100644 --- a/vendor/google.golang.org/grpc/transport/pre_go16.go +++ b/vendor/google.golang.org/grpc/go17.go @@ -1,4 +1,4 @@ -// +build !go1.6 +// +build go1.7 /* * Copyright 2016, Google Inc. @@ -32,20 +32,24 @@ * */ -package transport +package grpc import ( "net" - "time" + "net/http" "golang.org/x/net/context" ) // dialContext connects to the address on the named network. func dialContext(ctx context.Context, network, address string) (net.Conn, error) { - var dialer net.Dialer - if deadline, ok := ctx.Deadline(); ok { - dialer.Timeout = deadline.Sub(time.Now()) - } - return dialer.Dial(network, address) + return (&net.Dialer{}).DialContext(ctx, network, address) +} + +func sendHTTPRequest(ctx context.Context, req *http.Request, conn net.Conn) error { + req = req.WithContext(ctx) + if err := req.Write(conn); err != nil { + return err + } + return nil } diff --git a/vendor/google.golang.org/grpc/grpclb.go b/vendor/google.golang.org/grpc/grpclb.go new file mode 100644 index 00000000000..524e429df3e --- /dev/null +++ b/vendor/google.golang.org/grpc/grpclb.go @@ -0,0 +1,749 @@ +/* + * + * Copyright 2016, Google Inc. + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions are + * met: + * + * * Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * * Redistributions in binary form must reproduce the above + * copyright notice, this list of conditions and the following disclaimer + * in the documentation and/or other materials provided with the + * distribution. + * * Neither the name of Google Inc. nor the names of its + * contributors may be used to endorse or promote products derived from + * this software without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS + * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT + * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR + * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT + * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT + * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, + * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY + * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + * + */ + +package grpc + +import ( + "errors" + "fmt" + "math/rand" + "net" + "sync" + "time" + + "golang.org/x/net/context" + "google.golang.org/grpc/codes" + lbpb "google.golang.org/grpc/grpclb/grpc_lb_v1" + "google.golang.org/grpc/grpclog" + "google.golang.org/grpc/metadata" + "google.golang.org/grpc/naming" +) + +// Client API for LoadBalancer service. +// Mostly copied from generated pb.go file. +// To avoid circular dependency. +type loadBalancerClient struct { + cc *ClientConn +} + +func (c *loadBalancerClient) BalanceLoad(ctx context.Context, opts ...CallOption) (*balanceLoadClientStream, error) { + desc := &StreamDesc{ + StreamName: "BalanceLoad", + ServerStreams: true, + ClientStreams: true, + } + stream, err := NewClientStream(ctx, desc, c.cc, "/grpc.lb.v1.LoadBalancer/BalanceLoad", opts...) + if err != nil { + return nil, err + } + x := &balanceLoadClientStream{stream} + return x, nil +} + +type balanceLoadClientStream struct { + ClientStream +} + +func (x *balanceLoadClientStream) Send(m *lbpb.LoadBalanceRequest) error { + return x.ClientStream.SendMsg(m) +} + +func (x *balanceLoadClientStream) Recv() (*lbpb.LoadBalanceResponse, error) { + m := new(lbpb.LoadBalanceResponse) + if err := x.ClientStream.RecvMsg(m); err != nil { + return nil, err + } + return m, nil +} + +// AddressType indicates the address type returned by name resolution. +type AddressType uint8 + +const ( + // Backend indicates the server is a backend server. + Backend AddressType = iota + // GRPCLB indicates the server is a grpclb load balancer. + GRPCLB +) + +// AddrMetadataGRPCLB contains the information the name resolution for grpclb should provide. The +// name resolver used by grpclb balancer is required to provide this type of metadata in +// its address updates. +type AddrMetadataGRPCLB struct { + // AddrType is the type of server (grpc load balancer or backend). + AddrType AddressType + // ServerName is the name of the grpc load balancer. Used for authentication. + ServerName string +} + +// NewGRPCLBBalancer creates a grpclb load balancer. +func NewGRPCLBBalancer(r naming.Resolver) Balancer { + return &balancer{ + r: r, + } +} + +type remoteBalancerInfo struct { + addr string + // the server name used for authentication with the remote LB server. + name string +} + +// grpclbAddrInfo consists of the information of a backend server. +type grpclbAddrInfo struct { + addr Address + connected bool + // dropForRateLimiting indicates whether this particular request should be + // dropped by the client for rate limiting. + dropForRateLimiting bool + // dropForLoadBalancing indicates whether this particular request should be + // dropped by the client for load balancing. + dropForLoadBalancing bool +} + +type balancer struct { + r naming.Resolver + target string + mu sync.Mutex + seq int // a sequence number to make sure addrCh does not get stale addresses. + w naming.Watcher + addrCh chan []Address + rbs []remoteBalancerInfo + addrs []*grpclbAddrInfo + next int + waitCh chan struct{} + done bool + expTimer *time.Timer + rand *rand.Rand + + clientStats lbpb.ClientStats +} + +func (b *balancer) watchAddrUpdates(w naming.Watcher, ch chan []remoteBalancerInfo) error { + updates, err := w.Next() + if err != nil { + return err + } + b.mu.Lock() + defer b.mu.Unlock() + if b.done { + return ErrClientConnClosing + } + for _, update := range updates { + switch update.Op { + case naming.Add: + var exist bool + for _, v := range b.rbs { + // TODO: Is the same addr with different server name a different balancer? + if update.Addr == v.addr { + exist = true + break + } + } + if exist { + continue + } + md, ok := update.Metadata.(*AddrMetadataGRPCLB) + if !ok { + // TODO: Revisit the handling here and may introduce some fallback mechanism. + grpclog.Printf("The name resolution contains unexpected metadata %v", update.Metadata) + continue + } + switch md.AddrType { + case Backend: + // TODO: Revisit the handling here and may introduce some fallback mechanism. + grpclog.Printf("The name resolution does not give grpclb addresses") + continue + case GRPCLB: + b.rbs = append(b.rbs, remoteBalancerInfo{ + addr: update.Addr, + name: md.ServerName, + }) + default: + grpclog.Printf("Received unknow address type %d", md.AddrType) + continue + } + case naming.Delete: + for i, v := range b.rbs { + if update.Addr == v.addr { + copy(b.rbs[i:], b.rbs[i+1:]) + b.rbs = b.rbs[:len(b.rbs)-1] + break + } + } + default: + grpclog.Println("Unknown update.Op ", update.Op) + } + } + // TODO: Fall back to the basic round-robin load balancing if the resulting address is + // not a load balancer. + select { + case <-ch: + default: + } + ch <- b.rbs + return nil +} + +func (b *balancer) serverListExpire(seq int) { + b.mu.Lock() + defer b.mu.Unlock() + // TODO: gRPC interanls do not clear the connections when the server list is stale. + // This means RPCs will keep using the existing server list until b receives new + // server list even though the list is expired. Revisit this behavior later. + if b.done || seq < b.seq { + return + } + b.next = 0 + b.addrs = nil + // Ask grpc internals to close all the corresponding connections. + b.addrCh <- nil +} + +func convertDuration(d *lbpb.Duration) time.Duration { + if d == nil { + return 0 + } + return time.Duration(d.Seconds)*time.Second + time.Duration(d.Nanos)*time.Nanosecond +} + +func (b *balancer) processServerList(l *lbpb.ServerList, seq int) { + if l == nil { + return + } + servers := l.GetServers() + expiration := convertDuration(l.GetExpirationInterval()) + var ( + sl []*grpclbAddrInfo + addrs []Address + ) + for _, s := range servers { + md := metadata.Pairs("lb-token", s.LoadBalanceToken) + addr := Address{ + Addr: fmt.Sprintf("%s:%d", net.IP(s.IpAddress), s.Port), + Metadata: &md, + } + sl = append(sl, &grpclbAddrInfo{ + addr: addr, + dropForRateLimiting: s.DropForRateLimiting, + dropForLoadBalancing: s.DropForLoadBalancing, + }) + addrs = append(addrs, addr) + } + b.mu.Lock() + defer b.mu.Unlock() + if b.done || seq < b.seq { + return + } + if len(sl) > 0 { + // reset b.next to 0 when replacing the server list. + b.next = 0 + b.addrs = sl + b.addrCh <- addrs + if b.expTimer != nil { + b.expTimer.Stop() + b.expTimer = nil + } + if expiration > 0 { + b.expTimer = time.AfterFunc(expiration, func() { + b.serverListExpire(seq) + }) + } + } + return +} + +func (b *balancer) sendLoadReport(s *balanceLoadClientStream, interval time.Duration, done <-chan struct{}) { + ticker := time.NewTicker(interval) + defer ticker.Stop() + for { + select { + case <-ticker.C: + case <-done: + return + } + b.mu.Lock() + stats := b.clientStats + b.clientStats = lbpb.ClientStats{} // Clear the stats. + b.mu.Unlock() + t := time.Now() + stats.Timestamp = &lbpb.Timestamp{ + Seconds: t.Unix(), + Nanos: int32(t.Nanosecond()), + } + if err := s.Send(&lbpb.LoadBalanceRequest{ + LoadBalanceRequestType: &lbpb.LoadBalanceRequest_ClientStats{ + ClientStats: &stats, + }, + }); err != nil { + return + } + } +} + +func (b *balancer) callRemoteBalancer(lbc *loadBalancerClient, seq int) (retry bool) { + ctx, cancel := context.WithCancel(context.Background()) + defer cancel() + stream, err := lbc.BalanceLoad(ctx) + if err != nil { + grpclog.Printf("Failed to perform RPC to the remote balancer %v", err) + return + } + b.mu.Lock() + if b.done { + b.mu.Unlock() + return + } + b.mu.Unlock() + initReq := &lbpb.LoadBalanceRequest{ + LoadBalanceRequestType: &lbpb.LoadBalanceRequest_InitialRequest{ + InitialRequest: &lbpb.InitialLoadBalanceRequest{ + Name: b.target, + }, + }, + } + if err := stream.Send(initReq); err != nil { + // TODO: backoff on retry? + return true + } + reply, err := stream.Recv() + if err != nil { + // TODO: backoff on retry? + return true + } + initResp := reply.GetInitialResponse() + if initResp == nil { + grpclog.Println("Failed to receive the initial response from the remote balancer.") + return + } + // TODO: Support delegation. + if initResp.LoadBalancerDelegate != "" { + // delegation + grpclog.Println("TODO: Delegation is not supported yet.") + return + } + streamDone := make(chan struct{}) + defer close(streamDone) + b.mu.Lock() + b.clientStats = lbpb.ClientStats{} // Clear client stats. + b.mu.Unlock() + if d := convertDuration(initResp.ClientStatsReportInterval); d > 0 { + go b.sendLoadReport(stream, d, streamDone) + } + // Retrieve the server list. + for { + reply, err := stream.Recv() + if err != nil { + break + } + b.mu.Lock() + if b.done || seq < b.seq { + b.mu.Unlock() + return + } + b.seq++ // tick when receiving a new list of servers. + seq = b.seq + b.mu.Unlock() + if serverList := reply.GetServerList(); serverList != nil { + b.processServerList(serverList, seq) + } + } + return true +} + +func (b *balancer) Start(target string, config BalancerConfig) error { + b.rand = rand.New(rand.NewSource(time.Now().Unix())) + // TODO: Fall back to the basic direct connection if there is no name resolver. + if b.r == nil { + return errors.New("there is no name resolver installed") + } + b.target = target + b.mu.Lock() + if b.done { + b.mu.Unlock() + return ErrClientConnClosing + } + b.addrCh = make(chan []Address) + w, err := b.r.Resolve(target) + if err != nil { + b.mu.Unlock() + return err + } + b.w = w + b.mu.Unlock() + balancerAddrsCh := make(chan []remoteBalancerInfo, 1) + // Spawn a goroutine to monitor the name resolution of remote load balancer. + go func() { + for { + if err := b.watchAddrUpdates(w, balancerAddrsCh); err != nil { + grpclog.Printf("grpc: the naming watcher stops working due to %v.\n", err) + close(balancerAddrsCh) + return + } + } + }() + // Spawn a goroutine to talk to the remote load balancer. + go func() { + var ( + cc *ClientConn + // ccError is closed when there is an error in the current cc. + // A new rb should be picked from rbs and connected. + ccError chan struct{} + rb *remoteBalancerInfo + rbs []remoteBalancerInfo + rbIdx int + ) + + defer func() { + if ccError != nil { + select { + case <-ccError: + default: + close(ccError) + } + } + if cc != nil { + cc.Close() + } + }() + + for { + var ok bool + select { + case rbs, ok = <-balancerAddrsCh: + if !ok { + return + } + foundIdx := -1 + if rb != nil { + for i, trb := range rbs { + if trb == *rb { + foundIdx = i + break + } + } + } + if foundIdx >= 0 { + if foundIdx >= 1 { + // Move the address in use to the beginning of the list. + b.rbs[0], b.rbs[foundIdx] = b.rbs[foundIdx], b.rbs[0] + rbIdx = 0 + } + continue // If found, don't dial new cc. + } else if len(rbs) > 0 { + // Pick a random one from the list, instead of always using the first one. + if l := len(rbs); l > 1 && rb != nil { + tmpIdx := b.rand.Intn(l - 1) + b.rbs[0], b.rbs[tmpIdx] = b.rbs[tmpIdx], b.rbs[0] + } + rbIdx = 0 + rb = &rbs[0] + } else { + // foundIdx < 0 && len(rbs) <= 0. + rb = nil + } + case <-ccError: + ccError = nil + if rbIdx < len(rbs)-1 { + rbIdx++ + rb = &rbs[rbIdx] + } else { + rb = nil + } + } + + if rb == nil { + continue + } + + if cc != nil { + cc.Close() + } + // Talk to the remote load balancer to get the server list. + var err error + creds := config.DialCreds + ccError = make(chan struct{}) + if creds == nil { + cc, err = Dial(rb.addr, WithInsecure()) + } else { + if rb.name != "" { + if err := creds.OverrideServerName(rb.name); err != nil { + grpclog.Printf("Failed to override the server name in the credentials: %v", err) + continue + } + } + cc, err = Dial(rb.addr, WithTransportCredentials(creds)) + } + if err != nil { + grpclog.Printf("Failed to setup a connection to the remote balancer %v: %v", rb.addr, err) + close(ccError) + continue + } + b.mu.Lock() + b.seq++ // tick when getting a new balancer address + seq := b.seq + b.next = 0 + b.mu.Unlock() + go func(cc *ClientConn, ccError chan struct{}) { + lbc := &loadBalancerClient{cc} + b.callRemoteBalancer(lbc, seq) + cc.Close() + select { + case <-ccError: + default: + close(ccError) + } + }(cc, ccError) + } + }() + return nil +} + +func (b *balancer) down(addr Address, err error) { + b.mu.Lock() + defer b.mu.Unlock() + for _, a := range b.addrs { + if addr == a.addr { + a.connected = false + break + } + } +} + +func (b *balancer) Up(addr Address) func(error) { + b.mu.Lock() + defer b.mu.Unlock() + if b.done { + return nil + } + var cnt int + for _, a := range b.addrs { + if a.addr == addr { + if a.connected { + return nil + } + a.connected = true + } + if a.connected && !a.dropForRateLimiting && !a.dropForLoadBalancing { + cnt++ + } + } + // addr is the only one which is connected. Notify the Get() callers who are blocking. + if cnt == 1 && b.waitCh != nil { + close(b.waitCh) + b.waitCh = nil + } + return func(err error) { + b.down(addr, err) + } +} + +func (b *balancer) Get(ctx context.Context, opts BalancerGetOptions) (addr Address, put func(), err error) { + var ch chan struct{} + b.mu.Lock() + if b.done { + b.mu.Unlock() + err = ErrClientConnClosing + return + } + seq := b.seq + + defer func() { + if err != nil { + return + } + put = func() { + s, ok := rpcInfoFromContext(ctx) + if !ok { + return + } + b.mu.Lock() + defer b.mu.Unlock() + if b.done || seq < b.seq { + return + } + b.clientStats.NumCallsFinished++ + if !s.bytesSent { + b.clientStats.NumCallsFinishedWithClientFailedToSend++ + } else if s.bytesReceived { + b.clientStats.NumCallsFinishedKnownReceived++ + } + } + }() + + b.clientStats.NumCallsStarted++ + if len(b.addrs) > 0 { + if b.next >= len(b.addrs) { + b.next = 0 + } + next := b.next + for { + a := b.addrs[next] + next = (next + 1) % len(b.addrs) + if a.connected { + if !a.dropForRateLimiting && !a.dropForLoadBalancing { + addr = a.addr + b.next = next + b.mu.Unlock() + return + } + if !opts.BlockingWait { + b.next = next + if a.dropForLoadBalancing { + b.clientStats.NumCallsFinished++ + b.clientStats.NumCallsFinishedWithDropForLoadBalancing++ + } else if a.dropForRateLimiting { + b.clientStats.NumCallsFinished++ + b.clientStats.NumCallsFinishedWithDropForRateLimiting++ + } + b.mu.Unlock() + err = Errorf(codes.Unavailable, "%s drops requests", a.addr.Addr) + return + } + } + if next == b.next { + // Has iterated all the possible address but none is connected. + break + } + } + } + if !opts.BlockingWait { + if len(b.addrs) == 0 { + b.clientStats.NumCallsFinished++ + b.clientStats.NumCallsFinishedWithClientFailedToSend++ + b.mu.Unlock() + err = Errorf(codes.Unavailable, "there is no address available") + return + } + // Returns the next addr on b.addrs for a failfast RPC. + addr = b.addrs[b.next].addr + b.next++ + b.mu.Unlock() + return + } + // Wait on b.waitCh for non-failfast RPCs. + if b.waitCh == nil { + ch = make(chan struct{}) + b.waitCh = ch + } else { + ch = b.waitCh + } + b.mu.Unlock() + for { + select { + case <-ctx.Done(): + b.mu.Lock() + b.clientStats.NumCallsFinished++ + b.clientStats.NumCallsFinishedWithClientFailedToSend++ + b.mu.Unlock() + err = ctx.Err() + return + case <-ch: + b.mu.Lock() + if b.done { + b.clientStats.NumCallsFinished++ + b.clientStats.NumCallsFinishedWithClientFailedToSend++ + b.mu.Unlock() + err = ErrClientConnClosing + return + } + + if len(b.addrs) > 0 { + if b.next >= len(b.addrs) { + b.next = 0 + } + next := b.next + for { + a := b.addrs[next] + next = (next + 1) % len(b.addrs) + if a.connected { + if !a.dropForRateLimiting && !a.dropForLoadBalancing { + addr = a.addr + b.next = next + b.mu.Unlock() + return + } + if !opts.BlockingWait { + b.next = next + if a.dropForLoadBalancing { + b.clientStats.NumCallsFinished++ + b.clientStats.NumCallsFinishedWithDropForLoadBalancing++ + } else if a.dropForRateLimiting { + b.clientStats.NumCallsFinished++ + b.clientStats.NumCallsFinishedWithDropForRateLimiting++ + } + b.mu.Unlock() + err = Errorf(codes.Unavailable, "drop requests for the addreess %s", a.addr.Addr) + return + } + } + if next == b.next { + // Has iterated all the possible address but none is connected. + break + } + } + } + // The newly added addr got removed by Down() again. + if b.waitCh == nil { + ch = make(chan struct{}) + b.waitCh = ch + } else { + ch = b.waitCh + } + b.mu.Unlock() + } + } +} + +func (b *balancer) Notify() <-chan []Address { + return b.addrCh +} + +func (b *balancer) Close() error { + b.mu.Lock() + defer b.mu.Unlock() + b.done = true + if b.expTimer != nil { + b.expTimer.Stop() + } + if b.waitCh != nil { + close(b.waitCh) + } + if b.addrCh != nil { + close(b.addrCh) + } + if b.w != nil { + b.w.Close() + } + return nil +} diff --git a/vendor/google.golang.org/grpc/grpclb/grpc_lb_v1/BUILD b/vendor/google.golang.org/grpc/grpclb/grpc_lb_v1/BUILD new file mode 100644 index 00000000000..deb94c76bee --- /dev/null +++ b/vendor/google.golang.org/grpc/grpclb/grpc_lb_v1/BUILD @@ -0,0 +1,28 @@ +load("@io_bazel_rules_go//go:def.bzl", "go_library") + +go_library( + name = "go_default_library", + srcs = ["grpclb.pb.go"], + visibility = ["//visibility:public"], + deps = ["//vendor/github.com/golang/protobuf/proto:go_default_library"], +) + +filegroup( + name = "go_default_library_protos", + srcs = ["grpclb.proto"], + visibility = ["//visibility:public"], +) + +filegroup( + name = "package-srcs", + srcs = glob(["**"]), + tags = ["automanaged"], + visibility = ["//visibility:private"], +) + +filegroup( + name = "all-srcs", + srcs = [":package-srcs"], + tags = ["automanaged"], + visibility = ["//visibility:public"], +) diff --git a/vendor/google.golang.org/grpc/grpclb/grpc_lb_v1/grpclb.pb.go b/vendor/google.golang.org/grpc/grpclb/grpc_lb_v1/grpclb.pb.go new file mode 100644 index 00000000000..f63941bd803 --- /dev/null +++ b/vendor/google.golang.org/grpc/grpclb/grpc_lb_v1/grpclb.pb.go @@ -0,0 +1,629 @@ +// Code generated by protoc-gen-go. +// source: grpclb.proto +// DO NOT EDIT! + +/* +Package grpc_lb_v1 is a generated protocol buffer package. + +It is generated from these files: + grpclb.proto + +It has these top-level messages: + Duration + Timestamp + LoadBalanceRequest + InitialLoadBalanceRequest + ClientStats + LoadBalanceResponse + InitialLoadBalanceResponse + ServerList + Server +*/ +package grpc_lb_v1 + +import proto "github.com/golang/protobuf/proto" +import fmt "fmt" +import math "math" + +// Reference imports to suppress errors if they are not otherwise used. +var _ = proto.Marshal +var _ = fmt.Errorf +var _ = math.Inf + +// This is a compile-time assertion to ensure that this generated file +// is compatible with the proto package it is being compiled against. +// A compilation error at this line likely means your copy of the +// proto package needs to be updated. +const _ = proto.ProtoPackageIsVersion2 // please upgrade the proto package + +type Duration struct { + // Signed seconds of the span of time. Must be from -315,576,000,000 + // to +315,576,000,000 inclusive. + Seconds int64 `protobuf:"varint,1,opt,name=seconds" json:"seconds,omitempty"` + // Signed fractions of a second at nanosecond resolution of the span + // of time. Durations less than one second are represented with a 0 + // `seconds` field and a positive or negative `nanos` field. For durations + // of one second or more, a non-zero value for the `nanos` field must be + // of the same sign as the `seconds` field. Must be from -999,999,999 + // to +999,999,999 inclusive. + Nanos int32 `protobuf:"varint,2,opt,name=nanos" json:"nanos,omitempty"` +} + +func (m *Duration) Reset() { *m = Duration{} } +func (m *Duration) String() string { return proto.CompactTextString(m) } +func (*Duration) ProtoMessage() {} +func (*Duration) Descriptor() ([]byte, []int) { return fileDescriptor0, []int{0} } + +func (m *Duration) GetSeconds() int64 { + if m != nil { + return m.Seconds + } + return 0 +} + +func (m *Duration) GetNanos() int32 { + if m != nil { + return m.Nanos + } + return 0 +} + +type Timestamp struct { + // Represents seconds of UTC time since Unix epoch + // 1970-01-01T00:00:00Z. Must be from 0001-01-01T00:00:00Z to + // 9999-12-31T23:59:59Z inclusive. + Seconds int64 `protobuf:"varint,1,opt,name=seconds" json:"seconds,omitempty"` + // Non-negative fractions of a second at nanosecond resolution. Negative + // second values with fractions must still have non-negative nanos values + // that count forward in time. Must be from 0 to 999,999,999 + // inclusive. + Nanos int32 `protobuf:"varint,2,opt,name=nanos" json:"nanos,omitempty"` +} + +func (m *Timestamp) Reset() { *m = Timestamp{} } +func (m *Timestamp) String() string { return proto.CompactTextString(m) } +func (*Timestamp) ProtoMessage() {} +func (*Timestamp) Descriptor() ([]byte, []int) { return fileDescriptor0, []int{1} } + +func (m *Timestamp) GetSeconds() int64 { + if m != nil { + return m.Seconds + } + return 0 +} + +func (m *Timestamp) GetNanos() int32 { + if m != nil { + return m.Nanos + } + return 0 +} + +type LoadBalanceRequest struct { + // Types that are valid to be assigned to LoadBalanceRequestType: + // *LoadBalanceRequest_InitialRequest + // *LoadBalanceRequest_ClientStats + LoadBalanceRequestType isLoadBalanceRequest_LoadBalanceRequestType `protobuf_oneof:"load_balance_request_type"` +} + +func (m *LoadBalanceRequest) Reset() { *m = LoadBalanceRequest{} } +func (m *LoadBalanceRequest) String() string { return proto.CompactTextString(m) } +func (*LoadBalanceRequest) ProtoMessage() {} +func (*LoadBalanceRequest) Descriptor() ([]byte, []int) { return fileDescriptor0, []int{2} } + +type isLoadBalanceRequest_LoadBalanceRequestType interface { + isLoadBalanceRequest_LoadBalanceRequestType() +} + +type LoadBalanceRequest_InitialRequest struct { + InitialRequest *InitialLoadBalanceRequest `protobuf:"bytes,1,opt,name=initial_request,json=initialRequest,oneof"` +} +type LoadBalanceRequest_ClientStats struct { + ClientStats *ClientStats `protobuf:"bytes,2,opt,name=client_stats,json=clientStats,oneof"` +} + +func (*LoadBalanceRequest_InitialRequest) isLoadBalanceRequest_LoadBalanceRequestType() {} +func (*LoadBalanceRequest_ClientStats) isLoadBalanceRequest_LoadBalanceRequestType() {} + +func (m *LoadBalanceRequest) GetLoadBalanceRequestType() isLoadBalanceRequest_LoadBalanceRequestType { + if m != nil { + return m.LoadBalanceRequestType + } + return nil +} + +func (m *LoadBalanceRequest) GetInitialRequest() *InitialLoadBalanceRequest { + if x, ok := m.GetLoadBalanceRequestType().(*LoadBalanceRequest_InitialRequest); ok { + return x.InitialRequest + } + return nil +} + +func (m *LoadBalanceRequest) GetClientStats() *ClientStats { + if x, ok := m.GetLoadBalanceRequestType().(*LoadBalanceRequest_ClientStats); ok { + return x.ClientStats + } + return nil +} + +// XXX_OneofFuncs is for the internal use of the proto package. +func (*LoadBalanceRequest) XXX_OneofFuncs() (func(msg proto.Message, b *proto.Buffer) error, func(msg proto.Message, tag, wire int, b *proto.Buffer) (bool, error), func(msg proto.Message) (n int), []interface{}) { + return _LoadBalanceRequest_OneofMarshaler, _LoadBalanceRequest_OneofUnmarshaler, _LoadBalanceRequest_OneofSizer, []interface{}{ + (*LoadBalanceRequest_InitialRequest)(nil), + (*LoadBalanceRequest_ClientStats)(nil), + } +} + +func _LoadBalanceRequest_OneofMarshaler(msg proto.Message, b *proto.Buffer) error { + m := msg.(*LoadBalanceRequest) + // load_balance_request_type + switch x := m.LoadBalanceRequestType.(type) { + case *LoadBalanceRequest_InitialRequest: + b.EncodeVarint(1<<3 | proto.WireBytes) + if err := b.EncodeMessage(x.InitialRequest); err != nil { + return err + } + case *LoadBalanceRequest_ClientStats: + b.EncodeVarint(2<<3 | proto.WireBytes) + if err := b.EncodeMessage(x.ClientStats); err != nil { + return err + } + case nil: + default: + return fmt.Errorf("LoadBalanceRequest.LoadBalanceRequestType has unexpected type %T", x) + } + return nil +} + +func _LoadBalanceRequest_OneofUnmarshaler(msg proto.Message, tag, wire int, b *proto.Buffer) (bool, error) { + m := msg.(*LoadBalanceRequest) + switch tag { + case 1: // load_balance_request_type.initial_request + if wire != proto.WireBytes { + return true, proto.ErrInternalBadWireType + } + msg := new(InitialLoadBalanceRequest) + err := b.DecodeMessage(msg) + m.LoadBalanceRequestType = &LoadBalanceRequest_InitialRequest{msg} + return true, err + case 2: // load_balance_request_type.client_stats + if wire != proto.WireBytes { + return true, proto.ErrInternalBadWireType + } + msg := new(ClientStats) + err := b.DecodeMessage(msg) + m.LoadBalanceRequestType = &LoadBalanceRequest_ClientStats{msg} + return true, err + default: + return false, nil + } +} + +func _LoadBalanceRequest_OneofSizer(msg proto.Message) (n int) { + m := msg.(*LoadBalanceRequest) + // load_balance_request_type + switch x := m.LoadBalanceRequestType.(type) { + case *LoadBalanceRequest_InitialRequest: + s := proto.Size(x.InitialRequest) + n += proto.SizeVarint(1<<3 | proto.WireBytes) + n += proto.SizeVarint(uint64(s)) + n += s + case *LoadBalanceRequest_ClientStats: + s := proto.Size(x.ClientStats) + n += proto.SizeVarint(2<<3 | proto.WireBytes) + n += proto.SizeVarint(uint64(s)) + n += s + case nil: + default: + panic(fmt.Sprintf("proto: unexpected type %T in oneof", x)) + } + return n +} + +type InitialLoadBalanceRequest struct { + // Name of load balanced service (IE, balancer.service.com) + // length should be less than 256 bytes. + Name string `protobuf:"bytes,1,opt,name=name" json:"name,omitempty"` +} + +func (m *InitialLoadBalanceRequest) Reset() { *m = InitialLoadBalanceRequest{} } +func (m *InitialLoadBalanceRequest) String() string { return proto.CompactTextString(m) } +func (*InitialLoadBalanceRequest) ProtoMessage() {} +func (*InitialLoadBalanceRequest) Descriptor() ([]byte, []int) { return fileDescriptor0, []int{3} } + +func (m *InitialLoadBalanceRequest) GetName() string { + if m != nil { + return m.Name + } + return "" +} + +// Contains client level statistics that are useful to load balancing. Each +// count except the timestamp should be reset to zero after reporting the stats. +type ClientStats struct { + // The timestamp of generating the report. + Timestamp *Timestamp `protobuf:"bytes,1,opt,name=timestamp" json:"timestamp,omitempty"` + // The total number of RPCs that started. + NumCallsStarted int64 `protobuf:"varint,2,opt,name=num_calls_started,json=numCallsStarted" json:"num_calls_started,omitempty"` + // The total number of RPCs that finished. + NumCallsFinished int64 `protobuf:"varint,3,opt,name=num_calls_finished,json=numCallsFinished" json:"num_calls_finished,omitempty"` + // The total number of RPCs that were dropped by the client because of rate + // limiting. + NumCallsFinishedWithDropForRateLimiting int64 `protobuf:"varint,4,opt,name=num_calls_finished_with_drop_for_rate_limiting,json=numCallsFinishedWithDropForRateLimiting" json:"num_calls_finished_with_drop_for_rate_limiting,omitempty"` + // The total number of RPCs that were dropped by the client because of load + // balancing. + NumCallsFinishedWithDropForLoadBalancing int64 `protobuf:"varint,5,opt,name=num_calls_finished_with_drop_for_load_balancing,json=numCallsFinishedWithDropForLoadBalancing" json:"num_calls_finished_with_drop_for_load_balancing,omitempty"` + // The total number of RPCs that failed to reach a server except dropped RPCs. + NumCallsFinishedWithClientFailedToSend int64 `protobuf:"varint,6,opt,name=num_calls_finished_with_client_failed_to_send,json=numCallsFinishedWithClientFailedToSend" json:"num_calls_finished_with_client_failed_to_send,omitempty"` + // The total number of RPCs that finished and are known to have been received + // by a server. + NumCallsFinishedKnownReceived int64 `protobuf:"varint,7,opt,name=num_calls_finished_known_received,json=numCallsFinishedKnownReceived" json:"num_calls_finished_known_received,omitempty"` +} + +func (m *ClientStats) Reset() { *m = ClientStats{} } +func (m *ClientStats) String() string { return proto.CompactTextString(m) } +func (*ClientStats) ProtoMessage() {} +func (*ClientStats) Descriptor() ([]byte, []int) { return fileDescriptor0, []int{4} } + +func (m *ClientStats) GetTimestamp() *Timestamp { + if m != nil { + return m.Timestamp + } + return nil +} + +func (m *ClientStats) GetNumCallsStarted() int64 { + if m != nil { + return m.NumCallsStarted + } + return 0 +} + +func (m *ClientStats) GetNumCallsFinished() int64 { + if m != nil { + return m.NumCallsFinished + } + return 0 +} + +func (m *ClientStats) GetNumCallsFinishedWithDropForRateLimiting() int64 { + if m != nil { + return m.NumCallsFinishedWithDropForRateLimiting + } + return 0 +} + +func (m *ClientStats) GetNumCallsFinishedWithDropForLoadBalancing() int64 { + if m != nil { + return m.NumCallsFinishedWithDropForLoadBalancing + } + return 0 +} + +func (m *ClientStats) GetNumCallsFinishedWithClientFailedToSend() int64 { + if m != nil { + return m.NumCallsFinishedWithClientFailedToSend + } + return 0 +} + +func (m *ClientStats) GetNumCallsFinishedKnownReceived() int64 { + if m != nil { + return m.NumCallsFinishedKnownReceived + } + return 0 +} + +type LoadBalanceResponse struct { + // Types that are valid to be assigned to LoadBalanceResponseType: + // *LoadBalanceResponse_InitialResponse + // *LoadBalanceResponse_ServerList + LoadBalanceResponseType isLoadBalanceResponse_LoadBalanceResponseType `protobuf_oneof:"load_balance_response_type"` +} + +func (m *LoadBalanceResponse) Reset() { *m = LoadBalanceResponse{} } +func (m *LoadBalanceResponse) String() string { return proto.CompactTextString(m) } +func (*LoadBalanceResponse) ProtoMessage() {} +func (*LoadBalanceResponse) Descriptor() ([]byte, []int) { return fileDescriptor0, []int{5} } + +type isLoadBalanceResponse_LoadBalanceResponseType interface { + isLoadBalanceResponse_LoadBalanceResponseType() +} + +type LoadBalanceResponse_InitialResponse struct { + InitialResponse *InitialLoadBalanceResponse `protobuf:"bytes,1,opt,name=initial_response,json=initialResponse,oneof"` +} +type LoadBalanceResponse_ServerList struct { + ServerList *ServerList `protobuf:"bytes,2,opt,name=server_list,json=serverList,oneof"` +} + +func (*LoadBalanceResponse_InitialResponse) isLoadBalanceResponse_LoadBalanceResponseType() {} +func (*LoadBalanceResponse_ServerList) isLoadBalanceResponse_LoadBalanceResponseType() {} + +func (m *LoadBalanceResponse) GetLoadBalanceResponseType() isLoadBalanceResponse_LoadBalanceResponseType { + if m != nil { + return m.LoadBalanceResponseType + } + return nil +} + +func (m *LoadBalanceResponse) GetInitialResponse() *InitialLoadBalanceResponse { + if x, ok := m.GetLoadBalanceResponseType().(*LoadBalanceResponse_InitialResponse); ok { + return x.InitialResponse + } + return nil +} + +func (m *LoadBalanceResponse) GetServerList() *ServerList { + if x, ok := m.GetLoadBalanceResponseType().(*LoadBalanceResponse_ServerList); ok { + return x.ServerList + } + return nil +} + +// XXX_OneofFuncs is for the internal use of the proto package. +func (*LoadBalanceResponse) XXX_OneofFuncs() (func(msg proto.Message, b *proto.Buffer) error, func(msg proto.Message, tag, wire int, b *proto.Buffer) (bool, error), func(msg proto.Message) (n int), []interface{}) { + return _LoadBalanceResponse_OneofMarshaler, _LoadBalanceResponse_OneofUnmarshaler, _LoadBalanceResponse_OneofSizer, []interface{}{ + (*LoadBalanceResponse_InitialResponse)(nil), + (*LoadBalanceResponse_ServerList)(nil), + } +} + +func _LoadBalanceResponse_OneofMarshaler(msg proto.Message, b *proto.Buffer) error { + m := msg.(*LoadBalanceResponse) + // load_balance_response_type + switch x := m.LoadBalanceResponseType.(type) { + case *LoadBalanceResponse_InitialResponse: + b.EncodeVarint(1<<3 | proto.WireBytes) + if err := b.EncodeMessage(x.InitialResponse); err != nil { + return err + } + case *LoadBalanceResponse_ServerList: + b.EncodeVarint(2<<3 | proto.WireBytes) + if err := b.EncodeMessage(x.ServerList); err != nil { + return err + } + case nil: + default: + return fmt.Errorf("LoadBalanceResponse.LoadBalanceResponseType has unexpected type %T", x) + } + return nil +} + +func _LoadBalanceResponse_OneofUnmarshaler(msg proto.Message, tag, wire int, b *proto.Buffer) (bool, error) { + m := msg.(*LoadBalanceResponse) + switch tag { + case 1: // load_balance_response_type.initial_response + if wire != proto.WireBytes { + return true, proto.ErrInternalBadWireType + } + msg := new(InitialLoadBalanceResponse) + err := b.DecodeMessage(msg) + m.LoadBalanceResponseType = &LoadBalanceResponse_InitialResponse{msg} + return true, err + case 2: // load_balance_response_type.server_list + if wire != proto.WireBytes { + return true, proto.ErrInternalBadWireType + } + msg := new(ServerList) + err := b.DecodeMessage(msg) + m.LoadBalanceResponseType = &LoadBalanceResponse_ServerList{msg} + return true, err + default: + return false, nil + } +} + +func _LoadBalanceResponse_OneofSizer(msg proto.Message) (n int) { + m := msg.(*LoadBalanceResponse) + // load_balance_response_type + switch x := m.LoadBalanceResponseType.(type) { + case *LoadBalanceResponse_InitialResponse: + s := proto.Size(x.InitialResponse) + n += proto.SizeVarint(1<<3 | proto.WireBytes) + n += proto.SizeVarint(uint64(s)) + n += s + case *LoadBalanceResponse_ServerList: + s := proto.Size(x.ServerList) + n += proto.SizeVarint(2<<3 | proto.WireBytes) + n += proto.SizeVarint(uint64(s)) + n += s + case nil: + default: + panic(fmt.Sprintf("proto: unexpected type %T in oneof", x)) + } + return n +} + +type InitialLoadBalanceResponse struct { + // This is an application layer redirect that indicates the client should use + // the specified server for load balancing. When this field is non-empty in + // the response, the client should open a separate connection to the + // load_balancer_delegate and call the BalanceLoad method. Its length should + // be less than 64 bytes. + LoadBalancerDelegate string `protobuf:"bytes,1,opt,name=load_balancer_delegate,json=loadBalancerDelegate" json:"load_balancer_delegate,omitempty"` + // This interval defines how often the client should send the client stats + // to the load balancer. Stats should only be reported when the duration is + // positive. + ClientStatsReportInterval *Duration `protobuf:"bytes,2,opt,name=client_stats_report_interval,json=clientStatsReportInterval" json:"client_stats_report_interval,omitempty"` +} + +func (m *InitialLoadBalanceResponse) Reset() { *m = InitialLoadBalanceResponse{} } +func (m *InitialLoadBalanceResponse) String() string { return proto.CompactTextString(m) } +func (*InitialLoadBalanceResponse) ProtoMessage() {} +func (*InitialLoadBalanceResponse) Descriptor() ([]byte, []int) { return fileDescriptor0, []int{6} } + +func (m *InitialLoadBalanceResponse) GetLoadBalancerDelegate() string { + if m != nil { + return m.LoadBalancerDelegate + } + return "" +} + +func (m *InitialLoadBalanceResponse) GetClientStatsReportInterval() *Duration { + if m != nil { + return m.ClientStatsReportInterval + } + return nil +} + +type ServerList struct { + // Contains a list of servers selected by the load balancer. The list will + // be updated when server resolutions change or as needed to balance load + // across more servers. The client should consume the server list in order + // unless instructed otherwise via the client_config. + Servers []*Server `protobuf:"bytes,1,rep,name=servers" json:"servers,omitempty"` + // Indicates the amount of time that the client should consider this server + // list as valid. It may be considered stale after waiting this interval of + // time after receiving the list. If the interval is not positive, the + // client can assume the list is valid until the next list is received. + ExpirationInterval *Duration `protobuf:"bytes,3,opt,name=expiration_interval,json=expirationInterval" json:"expiration_interval,omitempty"` +} + +func (m *ServerList) Reset() { *m = ServerList{} } +func (m *ServerList) String() string { return proto.CompactTextString(m) } +func (*ServerList) ProtoMessage() {} +func (*ServerList) Descriptor() ([]byte, []int) { return fileDescriptor0, []int{7} } + +func (m *ServerList) GetServers() []*Server { + if m != nil { + return m.Servers + } + return nil +} + +func (m *ServerList) GetExpirationInterval() *Duration { + if m != nil { + return m.ExpirationInterval + } + return nil +} + +// Contains server information. When none of the [drop_for_*] fields are true, +// use the other fields. When drop_for_rate_limiting is true, ignore all other +// fields. Use drop_for_load_balancing only when it is true and +// drop_for_rate_limiting is false. +type Server struct { + // A resolved address for the server, serialized in network-byte-order. It may + // either be an IPv4 or IPv6 address. + IpAddress []byte `protobuf:"bytes,1,opt,name=ip_address,json=ipAddress,proto3" json:"ip_address,omitempty"` + // A resolved port number for the server. + Port int32 `protobuf:"varint,2,opt,name=port" json:"port,omitempty"` + // An opaque but printable token given to the frontend for each pick. All + // frontend requests for that pick must include the token in its initial + // metadata. The token is used by the backend to verify the request and to + // allow the backend to report load to the gRPC LB system. + // + // Its length is variable but less than 50 bytes. + LoadBalanceToken string `protobuf:"bytes,3,opt,name=load_balance_token,json=loadBalanceToken" json:"load_balance_token,omitempty"` + // Indicates whether this particular request should be dropped by the client + // for rate limiting. + DropForRateLimiting bool `protobuf:"varint,4,opt,name=drop_for_rate_limiting,json=dropForRateLimiting" json:"drop_for_rate_limiting,omitempty"` + // Indicates whether this particular request should be dropped by the client + // for load balancing. + DropForLoadBalancing bool `protobuf:"varint,5,opt,name=drop_for_load_balancing,json=dropForLoadBalancing" json:"drop_for_load_balancing,omitempty"` +} + +func (m *Server) Reset() { *m = Server{} } +func (m *Server) String() string { return proto.CompactTextString(m) } +func (*Server) ProtoMessage() {} +func (*Server) Descriptor() ([]byte, []int) { return fileDescriptor0, []int{8} } + +func (m *Server) GetIpAddress() []byte { + if m != nil { + return m.IpAddress + } + return nil +} + +func (m *Server) GetPort() int32 { + if m != nil { + return m.Port + } + return 0 +} + +func (m *Server) GetLoadBalanceToken() string { + if m != nil { + return m.LoadBalanceToken + } + return "" +} + +func (m *Server) GetDropForRateLimiting() bool { + if m != nil { + return m.DropForRateLimiting + } + return false +} + +func (m *Server) GetDropForLoadBalancing() bool { + if m != nil { + return m.DropForLoadBalancing + } + return false +} + +func init() { + proto.RegisterType((*Duration)(nil), "grpc.lb.v1.Duration") + proto.RegisterType((*Timestamp)(nil), "grpc.lb.v1.Timestamp") + proto.RegisterType((*LoadBalanceRequest)(nil), "grpc.lb.v1.LoadBalanceRequest") + proto.RegisterType((*InitialLoadBalanceRequest)(nil), "grpc.lb.v1.InitialLoadBalanceRequest") + proto.RegisterType((*ClientStats)(nil), "grpc.lb.v1.ClientStats") + proto.RegisterType((*LoadBalanceResponse)(nil), "grpc.lb.v1.LoadBalanceResponse") + proto.RegisterType((*InitialLoadBalanceResponse)(nil), "grpc.lb.v1.InitialLoadBalanceResponse") + proto.RegisterType((*ServerList)(nil), "grpc.lb.v1.ServerList") + proto.RegisterType((*Server)(nil), "grpc.lb.v1.Server") +} + +func init() { proto.RegisterFile("grpclb.proto", fileDescriptor0) } + +var fileDescriptor0 = []byte{ + // 733 bytes of a gzipped FileDescriptorProto + 0x1f, 0x8b, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0xff, 0x94, 0x55, 0xdd, 0x4e, 0x1b, 0x39, + 0x14, 0x66, 0x36, 0xfc, 0xe5, 0x24, 0x5a, 0x58, 0x93, 0x85, 0xc0, 0xc2, 0x2e, 0x1b, 0xa9, 0x34, + 0xaa, 0x68, 0x68, 0x43, 0x7b, 0xd1, 0x9f, 0x9b, 0x02, 0x45, 0x41, 0xe5, 0xa2, 0x72, 0xa8, 0x7a, + 0x55, 0x59, 0x4e, 0xc6, 0x80, 0xc5, 0xc4, 0x9e, 0xda, 0x4e, 0x68, 0x2f, 0x7b, 0xd9, 0x47, 0xe9, + 0x63, 0x54, 0x7d, 0x86, 0xbe, 0x4f, 0x65, 0x7b, 0x26, 0x33, 0x90, 0x1f, 0xd4, 0xbb, 0xf1, 0xf1, + 0x77, 0xbe, 0xf3, 0xf9, 0xd8, 0xdf, 0x19, 0x28, 0x5f, 0xa8, 0xb8, 0x1b, 0x75, 0x1a, 0xb1, 0x92, + 0x46, 0x22, 0xb0, 0xab, 0x46, 0xd4, 0x69, 0x0c, 0x1e, 0xd7, 0x9e, 0xc3, 0xe2, 0x51, 0x5f, 0x51, + 0xc3, 0xa5, 0x40, 0x55, 0x58, 0xd0, 0xac, 0x2b, 0x45, 0xa8, 0xab, 0xc1, 0x76, 0x50, 0x2f, 0xe0, + 0x74, 0x89, 0x2a, 0x30, 0x27, 0xa8, 0x90, 0xba, 0xfa, 0xc7, 0x76, 0x50, 0x9f, 0xc3, 0x7e, 0x51, + 0x7b, 0x01, 0xc5, 0x33, 0xde, 0x63, 0xda, 0xd0, 0x5e, 0xfc, 0xdb, 0xc9, 0xdf, 0x03, 0x40, 0xa7, + 0x92, 0x86, 0x07, 0x34, 0xa2, 0xa2, 0xcb, 0x30, 0xfb, 0xd8, 0x67, 0xda, 0xa0, 0xb7, 0xb0, 0xc4, + 0x05, 0x37, 0x9c, 0x46, 0x44, 0xf9, 0x90, 0xa3, 0x2b, 0x35, 0xef, 0x35, 0x32, 0xd5, 0x8d, 0x13, + 0x0f, 0x19, 0xcd, 0x6f, 0xcd, 0xe0, 0x3f, 0x93, 0xfc, 0x94, 0xf1, 0x25, 0x94, 0xbb, 0x11, 0x67, + 0xc2, 0x10, 0x6d, 0xa8, 0xf1, 0x2a, 0x4a, 0xcd, 0xb5, 0x3c, 0xdd, 0xa1, 0xdb, 0x6f, 0xdb, 0xed, + 0xd6, 0x0c, 0x2e, 0x75, 0xb3, 0xe5, 0xc1, 0x3f, 0xb0, 0x1e, 0x49, 0x1a, 0x92, 0x8e, 0x2f, 0x93, + 0x8a, 0x22, 0xe6, 0x73, 0xcc, 0x6a, 0x7b, 0xb0, 0x3e, 0x51, 0x09, 0x42, 0x30, 0x2b, 0x68, 0x8f, + 0x39, 0xf9, 0x45, 0xec, 0xbe, 0x6b, 0x5f, 0x67, 0xa1, 0x94, 0x2b, 0x86, 0xf6, 0xa1, 0x68, 0xd2, + 0x0e, 0x26, 0xe7, 0xfc, 0x3b, 0x2f, 0x6c, 0xd8, 0x5e, 0x9c, 0xe1, 0xd0, 0x03, 0xf8, 0x4b, 0xf4, + 0x7b, 0xa4, 0x4b, 0xa3, 0x48, 0xdb, 0x33, 0x29, 0xc3, 0x42, 0x77, 0xaa, 0x02, 0x5e, 0x12, 0xfd, + 0xde, 0xa1, 0x8d, 0xb7, 0x7d, 0x18, 0xed, 0x02, 0xca, 0xb0, 0xe7, 0x5c, 0x70, 0x7d, 0xc9, 0xc2, + 0x6a, 0xc1, 0x81, 0x97, 0x53, 0xf0, 0x71, 0x12, 0x47, 0x04, 0x1a, 0xa3, 0x68, 0x72, 0xcd, 0xcd, + 0x25, 0x09, 0x95, 0x8c, 0xc9, 0xb9, 0x54, 0x44, 0x51, 0xc3, 0x48, 0xc4, 0x7b, 0xdc, 0x70, 0x71, + 0x51, 0x9d, 0x75, 0x4c, 0xf7, 0x6f, 0x33, 0xbd, 0xe7, 0xe6, 0xf2, 0x48, 0xc9, 0xf8, 0x58, 0x2a, + 0x4c, 0x0d, 0x3b, 0x4d, 0xe0, 0x88, 0xc2, 0xde, 0x9d, 0x05, 0x72, 0xed, 0xb6, 0x15, 0xe6, 0x5c, + 0x85, 0xfa, 0x94, 0x0a, 0x59, 0xef, 0x6d, 0x89, 0x0f, 0xf0, 0x70, 0x52, 0x89, 0xe4, 0x19, 0x9c, + 0x53, 0x1e, 0xb1, 0x90, 0x18, 0x49, 0x34, 0x13, 0x61, 0x75, 0xde, 0x15, 0xd8, 0x19, 0x57, 0xc0, + 0x5f, 0xd5, 0xb1, 0xc3, 0x9f, 0xc9, 0x36, 0x13, 0x21, 0x6a, 0xc1, 0xff, 0x63, 0xe8, 0xaf, 0x84, + 0xbc, 0x16, 0x44, 0xb1, 0x2e, 0xe3, 0x03, 0x16, 0x56, 0x17, 0x1c, 0xe5, 0xd6, 0x6d, 0xca, 0x37, + 0x16, 0x85, 0x13, 0x50, 0xed, 0x47, 0x00, 0x2b, 0x37, 0x9e, 0x8d, 0x8e, 0xa5, 0xd0, 0x0c, 0xb5, + 0x61, 0x39, 0x73, 0x80, 0x8f, 0x25, 0x4f, 0x63, 0xe7, 0x2e, 0x0b, 0x78, 0x74, 0x6b, 0x06, 0x2f, + 0x0d, 0x3d, 0x90, 0x90, 0x3e, 0x83, 0x92, 0x66, 0x6a, 0xc0, 0x14, 0x89, 0xb8, 0x36, 0x89, 0x07, + 0x56, 0xf3, 0x7c, 0x6d, 0xb7, 0x7d, 0xca, 0x9d, 0x87, 0x40, 0x0f, 0x57, 0x07, 0x9b, 0xb0, 0x71, + 0xcb, 0x01, 0x9e, 0xd3, 0x5b, 0xe0, 0x5b, 0x00, 0x1b, 0x93, 0xa5, 0xa0, 0x27, 0xb0, 0x9a, 0x4f, + 0x56, 0x24, 0x64, 0x11, 0xbb, 0xa0, 0x26, 0xb5, 0x45, 0x25, 0xca, 0x92, 0xd4, 0x51, 0xb2, 0x87, + 0xde, 0xc1, 0x66, 0xde, 0xb2, 0x44, 0xb1, 0x58, 0x2a, 0x43, 0xb8, 0x30, 0x4c, 0x0d, 0x68, 0x94, + 0xc8, 0xaf, 0xe4, 0xe5, 0xa7, 0x43, 0x0c, 0xaf, 0xe7, 0xdc, 0x8b, 0x5d, 0xde, 0x49, 0x92, 0x56, + 0xfb, 0x12, 0x00, 0x64, 0xc7, 0x44, 0xbb, 0x76, 0x62, 0xd9, 0x95, 0x9d, 0x58, 0x85, 0x7a, 0xa9, + 0x89, 0x46, 0xfb, 0x81, 0x53, 0x08, 0x7a, 0x0d, 0x2b, 0xec, 0x53, 0xcc, 0x7d, 0x95, 0x4c, 0x4a, + 0x61, 0x8a, 0x14, 0x94, 0x25, 0x0c, 0x35, 0xfc, 0x0c, 0x60, 0xde, 0x53, 0xa3, 0x2d, 0x00, 0x1e, + 0x13, 0x1a, 0x86, 0x8a, 0x69, 0x3f, 0x34, 0xcb, 0xb8, 0xc8, 0xe3, 0x57, 0x3e, 0x60, 0xe7, 0x87, + 0x55, 0x9f, 0x4c, 0x4d, 0xf7, 0x6d, 0xed, 0x7c, 0xe3, 0x2e, 0x8c, 0xbc, 0x62, 0xc2, 0x69, 0x28, + 0xe2, 0xe5, 0x5c, 0x2b, 0xcf, 0x6c, 0x1c, 0xed, 0xc3, 0xea, 0x14, 0xdb, 0x2e, 0xe2, 0x95, 0x70, + 0x8c, 0x45, 0x9f, 0xc2, 0xda, 0x34, 0x2b, 0x2e, 0xe2, 0x4a, 0x38, 0xc6, 0x76, 0xcd, 0x0e, 0x94, + 0x73, 0xf7, 0xaf, 0x10, 0x86, 0x52, 0xf2, 0x6d, 0xc3, 0xe8, 0xdf, 0x7c, 0x83, 0x46, 0x87, 0xe5, + 0xc6, 0x7f, 0x13, 0xf7, 0xfd, 0x43, 0xaa, 0x07, 0x8f, 0x82, 0xce, 0xbc, 0xfb, 0x7d, 0xed, 0xff, + 0x0a, 0x00, 0x00, 0xff, 0xff, 0x64, 0xbf, 0xda, 0x5e, 0xce, 0x06, 0x00, 0x00, +} diff --git a/vendor/google.golang.org/grpc/grpclb/grpc_lb_v1/grpclb.proto b/vendor/google.golang.org/grpc/grpclb/grpc_lb_v1/grpclb.proto new file mode 100644 index 00000000000..a2502fb284a --- /dev/null +++ b/vendor/google.golang.org/grpc/grpclb/grpc_lb_v1/grpclb.proto @@ -0,0 +1,179 @@ +// Copyright 2016, Google Inc. +// All rights reserved. +// +// Redistribution and use in source and binary forms, with or without +// modification, are permitted provided that the following conditions are +// met: +// +// * Redistributions of source code must retain the above copyright +// notice, this list of conditions and the following disclaimer. +// * Redistributions in binary form must reproduce the above +// copyright notice, this list of conditions and the following disclaimer +// in the documentation and/or other materials provided with the +// distribution. +// * Neither the name of Google Inc. nor the names of its +// contributors may be used to endorse or promote products derived from +// this software without specific prior written permission. +// +// THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +// "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +// LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +// A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +// OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +// SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +// LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +// DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +// THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +// (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +// OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +syntax = "proto3"; + +package grpc.lb.v1; + +message Duration { + // Signed seconds of the span of time. Must be from -315,576,000,000 + // to +315,576,000,000 inclusive. + int64 seconds = 1; + + // Signed fractions of a second at nanosecond resolution of the span + // of time. Durations less than one second are represented with a 0 + // `seconds` field and a positive or negative `nanos` field. For durations + // of one second or more, a non-zero value for the `nanos` field must be + // of the same sign as the `seconds` field. Must be from -999,999,999 + // to +999,999,999 inclusive. + int32 nanos = 2; +} + +message Timestamp { + + // Represents seconds of UTC time since Unix epoch + // 1970-01-01T00:00:00Z. Must be from 0001-01-01T00:00:00Z to + // 9999-12-31T23:59:59Z inclusive. + int64 seconds = 1; + + // Non-negative fractions of a second at nanosecond resolution. Negative + // second values with fractions must still have non-negative nanos values + // that count forward in time. Must be from 0 to 999,999,999 + // inclusive. + int32 nanos = 2; +} + +service LoadBalancer { + // Bidirectional rpc to get a list of servers. + rpc BalanceLoad(stream LoadBalanceRequest) + returns (stream LoadBalanceResponse); +} + +message LoadBalanceRequest { + oneof load_balance_request_type { + // This message should be sent on the first request to the load balancer. + InitialLoadBalanceRequest initial_request = 1; + + // The client stats should be periodically reported to the load balancer + // based on the duration defined in the InitialLoadBalanceResponse. + ClientStats client_stats = 2; + } +} + +message InitialLoadBalanceRequest { + // Name of load balanced service (IE, balancer.service.com) + // length should be less than 256 bytes. + string name = 1; +} + +// Contains client level statistics that are useful to load balancing. Each +// count except the timestamp should be reset to zero after reporting the stats. +message ClientStats { + // The timestamp of generating the report. + Timestamp timestamp = 1; + + // The total number of RPCs that started. + int64 num_calls_started = 2; + + // The total number of RPCs that finished. + int64 num_calls_finished = 3; + + // The total number of RPCs that were dropped by the client because of rate + // limiting. + int64 num_calls_finished_with_drop_for_rate_limiting = 4; + + // The total number of RPCs that were dropped by the client because of load + // balancing. + int64 num_calls_finished_with_drop_for_load_balancing = 5; + + // The total number of RPCs that failed to reach a server except dropped RPCs. + int64 num_calls_finished_with_client_failed_to_send = 6; + + // The total number of RPCs that finished and are known to have been received + // by a server. + int64 num_calls_finished_known_received = 7; +} + +message LoadBalanceResponse { + oneof load_balance_response_type { + // This message should be sent on the first response to the client. + InitialLoadBalanceResponse initial_response = 1; + + // Contains the list of servers selected by the load balancer. The client + // should send requests to these servers in the specified order. + ServerList server_list = 2; + } +} + +message InitialLoadBalanceResponse { + // This is an application layer redirect that indicates the client should use + // the specified server for load balancing. When this field is non-empty in + // the response, the client should open a separate connection to the + // load_balancer_delegate and call the BalanceLoad method. Its length should + // be less than 64 bytes. + string load_balancer_delegate = 1; + + // This interval defines how often the client should send the client stats + // to the load balancer. Stats should only be reported when the duration is + // positive. + Duration client_stats_report_interval = 2; +} + +message ServerList { + // Contains a list of servers selected by the load balancer. The list will + // be updated when server resolutions change or as needed to balance load + // across more servers. The client should consume the server list in order + // unless instructed otherwise via the client_config. + repeated Server servers = 1; + + // Indicates the amount of time that the client should consider this server + // list as valid. It may be considered stale after waiting this interval of + // time after receiving the list. If the interval is not positive, the + // client can assume the list is valid until the next list is received. + Duration expiration_interval = 3; +} + +// Contains server information. When none of the [drop_for_*] fields are true, +// use the other fields. When drop_for_rate_limiting is true, ignore all other +// fields. Use drop_for_load_balancing only when it is true and +// drop_for_rate_limiting is false. +message Server { + // A resolved address for the server, serialized in network-byte-order. It may + // either be an IPv4 or IPv6 address. + bytes ip_address = 1; + + // A resolved port number for the server. + int32 port = 2; + + // An opaque but printable token given to the frontend for each pick. All + // frontend requests for that pick must include the token in its initial + // metadata. The token is used by the backend to verify the request and to + // allow the backend to report load to the gRPC LB system. + // + // Its length is variable but less than 50 bytes. + string load_balance_token = 3; + + // Indicates whether this particular request should be dropped by the client + // for rate limiting. + bool drop_for_rate_limiting = 4; + + // Indicates whether this particular request should be dropped by the client + // for load balancing. + bool drop_for_load_balancing = 5; +} diff --git a/vendor/google.golang.org/grpc/interceptor.go b/vendor/google.golang.org/grpc/interceptor.go index 8d932efed7e..a6921614572 100644 --- a/vendor/google.golang.org/grpc/interceptor.go +++ b/vendor/google.golang.org/grpc/interceptor.go @@ -40,7 +40,7 @@ import ( // UnaryInvoker is called by UnaryClientInterceptor to complete RPCs. type UnaryInvoker func(ctx context.Context, method string, req, reply interface{}, cc *ClientConn, opts ...CallOption) error -// UnaryClientInterceptor intercepts the execution of a unary RPC on the client. inovker is the handler to complete the RPC +// UnaryClientInterceptor intercepts the execution of a unary RPC on the client. invoker is the handler to complete the RPC // and it is the responsibility of the interceptor to call it. // This is the EXPERIMENTAL API. type UnaryClientInterceptor func(ctx context.Context, method string, req, reply interface{}, cc *ClientConn, invoker UnaryInvoker, opts ...CallOption) error diff --git a/vendor/google.golang.org/grpc/keepalive/BUILD b/vendor/google.golang.org/grpc/keepalive/BUILD new file mode 100644 index 00000000000..f93e5639384 --- /dev/null +++ b/vendor/google.golang.org/grpc/keepalive/BUILD @@ -0,0 +1,21 @@ +load("@io_bazel_rules_go//go:def.bzl", "go_library") + +go_library( + name = "go_default_library", + srcs = ["keepalive.go"], + visibility = ["//visibility:public"], +) + +filegroup( + name = "package-srcs", + srcs = glob(["**"]), + tags = ["automanaged"], + visibility = ["//visibility:private"], +) + +filegroup( + name = "all-srcs", + srcs = [":package-srcs"], + tags = ["automanaged"], + visibility = ["//visibility:public"], +) diff --git a/vendor/google.golang.org/grpc/keepalive/keepalive.go b/vendor/google.golang.org/grpc/keepalive/keepalive.go new file mode 100644 index 00000000000..d492589c96b --- /dev/null +++ b/vendor/google.golang.org/grpc/keepalive/keepalive.go @@ -0,0 +1,80 @@ +/* + * + * Copyright 2017, Google Inc. + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions are + * met: + * + * * Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * * Redistributions in binary form must reproduce the above + * copyright notice, this list of conditions and the following disclaimer + * in the documentation and/or other materials provided with the + * distribution. + * * Neither the name of Google Inc. nor the names of its + * contributors may be used to endorse or promote products derived from + * this software without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS + * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT + * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR + * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT + * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT + * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, + * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY + * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + * + */ + +// Package keepalive defines configurable parameters for point-to-point healthcheck. +package keepalive + +import ( + "time" +) + +// ClientParameters is used to set keepalive parameters on the client-side. +// These configure how the client will actively probe to notice when a connection broken +// and to cause activity so intermediaries are aware the connection is still in use. +// Make sure these parameters are set in coordination with the keepalive policy on the server, +// as incompatible settings can result in closing of connection. +type ClientParameters struct { + // After a duration of this time if the client doesn't see any activity it pings the server to see if the transport is still alive. + Time time.Duration // The current default value is infinity. + // After having pinged for keepalive check, the client waits for a duration of Timeout and if no activity is seen even after that + // the connection is closed. + Timeout time.Duration // The current default value is 20 seconds. + // If true, client runs keepalive checks even with no active RPCs. + PermitWithoutStream bool // false by default. +} + +// ServerParameters is used to set keepalive and max-age parameters on the server-side. +type ServerParameters struct { + // MaxConnectionIdle is a duration for the amount of time after which an idle connection would be closed by sending a GoAway. + // Idleness duration is defined since the most recent time the number of outstanding RPCs became zero or the connection establishment. + MaxConnectionIdle time.Duration // The current default value is infinity. + // MaxConnectionAge is a duration for the maximum amount of time a connection may exist before it will be closed by sending a GoAway. + // A random jitter of +/-10% will be added to MaxConnectionAge to spread out connection storms. + MaxConnectionAge time.Duration // The current default value is infinity. + // MaxConnectinoAgeGrace is an additive period after MaxConnectionAge after which the connection will be forcibly closed. + MaxConnectionAgeGrace time.Duration // The current default value is infinity. + // After a duration of this time if the server doesn't see any activity it pings the client to see if the transport is still alive. + Time time.Duration // The current default value is 2 hours. + // After having pinged for keepalive check, the server waits for a duration of Timeout and if no activity is seen even after that + // the connection is closed. + Timeout time.Duration // The current default value is 20 seconds. +} + +// EnforcementPolicy is used to set keepalive enforcement policy on the server-side. +// Server will close connection with a client that violates this policy. +type EnforcementPolicy struct { + // MinTime is the minimum amount of time a client should wait before sending a keepalive ping. + MinTime time.Duration // The current default value is 5 minutes. + // If true, server expects keepalive pings even when there are no active streams(RPCs). + PermitWithoutStream bool // false by default. +} diff --git a/vendor/google.golang.org/grpc/metadata/metadata.go b/vendor/google.golang.org/grpc/metadata/metadata.go index cb29bf94579..a4f2de026db 100644 --- a/vendor/google.golang.org/grpc/metadata/metadata.go +++ b/vendor/google.golang.org/grpc/metadata/metadata.go @@ -32,49 +32,19 @@ */ // Package metadata define the structure of the metadata supported by gRPC library. +// Please refer to http://www.grpc.io/docs/guides/wire.html for more information about custom-metadata. package metadata import ( - "encoding/base64" "fmt" "strings" "golang.org/x/net/context" ) -const ( - binHdrSuffix = "-bin" -) - -// encodeKeyValue encodes key and value qualified for transmission via gRPC. -// Transmitting binary headers violates HTTP/2 spec. -// TODO(zhaoq): Maybe check if k is ASCII also. -func encodeKeyValue(k, v string) (string, string) { - k = strings.ToLower(k) - if strings.HasSuffix(k, binHdrSuffix) { - val := base64.StdEncoding.EncodeToString([]byte(v)) - v = string(val) - } - return k, v -} - -// DecodeKeyValue returns the original key and value corresponding to the -// encoded data in k, v. -// If k is a binary header and v contains comma, v is split on comma before decoded, -// and the decoded v will be joined with comma before returned. +// DecodeKeyValue returns k, v, nil. It is deprecated and should not be used. func DecodeKeyValue(k, v string) (string, string, error) { - if !strings.HasSuffix(k, binHdrSuffix) { - return k, v, nil - } - vvs := strings.Split(v, ",") - for i, vv := range vvs { - val, err := base64.StdEncoding.DecodeString(vv) - if err != nil { - return "", "", err - } - vvs[i] = string(val) - } - return k, strings.Join(vvs, ","), nil + return k, v, nil } // MD is a mapping from metadata keys to values. Users should use the following @@ -82,10 +52,11 @@ func DecodeKeyValue(k, v string) (string, string, error) { type MD map[string][]string // New creates a MD from given key-value map. +// Keys are automatically converted to lowercase. func New(m map[string]string) MD { md := MD{} - for k, v := range m { - key, val := encodeKeyValue(k, v) + for k, val := range m { + key := strings.ToLower(k) md[key] = append(md[key], val) } return md @@ -93,19 +64,19 @@ func New(m map[string]string) MD { // Pairs returns an MD formed by the mapping of key, value ... // Pairs panics if len(kv) is odd. +// Keys are automatically converted to lowercase. func Pairs(kv ...string) MD { if len(kv)%2 == 1 { panic(fmt.Sprintf("metadata: Pairs got the odd number of input pairs for metadata: %d", len(kv))) } md := MD{} - var k string + var key string for i, s := range kv { if i%2 == 0 { - k = s + key = strings.ToLower(s) continue } - key, val := encodeKeyValue(k, s) - md[key] = append(md[key], val) + md[key] = append(md[key], s) } return md } @@ -133,15 +104,41 @@ func Join(mds ...MD) MD { return out } -type mdKey struct{} +type mdIncomingKey struct{} +type mdOutgoingKey struct{} -// NewContext creates a new context with md attached. +// NewContext is a wrapper for NewOutgoingContext(ctx, md). Deprecated. func NewContext(ctx context.Context, md MD) context.Context { - return context.WithValue(ctx, mdKey{}, md) + return NewOutgoingContext(ctx, md) } -// FromContext returns the MD in ctx if it exists. +// NewIncomingContext creates a new context with incoming md attached. +func NewIncomingContext(ctx context.Context, md MD) context.Context { + return context.WithValue(ctx, mdIncomingKey{}, md) +} + +// NewOutgoingContext creates a new context with outgoing md attached. +func NewOutgoingContext(ctx context.Context, md MD) context.Context { + return context.WithValue(ctx, mdOutgoingKey{}, md) +} + +// FromContext is a wrapper for FromIncomingContext(ctx). Deprecated. func FromContext(ctx context.Context) (md MD, ok bool) { - md, ok = ctx.Value(mdKey{}).(MD) + return FromIncomingContext(ctx) +} + +// FromIncomingContext returns the incoming MD in ctx if it exists. The +// returned md should be immutable, writing to it may cause races. +// Modification should be made to the copies of the returned md. +func FromIncomingContext(ctx context.Context) (md MD, ok bool) { + md, ok = ctx.Value(mdIncomingKey{}).(MD) + return +} + +// FromOutgoingContext returns the outgoing MD in ctx if it exists. The +// returned md should be immutable, writing to it may cause races. +// Modification should be made to the copies of the returned md. +func FromOutgoingContext(ctx context.Context) (md MD, ok bool) { + md, ok = ctx.Value(mdOutgoingKey{}).(MD) return } diff --git a/vendor/google.golang.org/grpc/proxy.go b/vendor/google.golang.org/grpc/proxy.go new file mode 100644 index 00000000000..10188dc3433 --- /dev/null +++ b/vendor/google.golang.org/grpc/proxy.go @@ -0,0 +1,145 @@ +/* + * + * Copyright 2017, Google Inc. + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions are + * met: + * + * * Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * * Redistributions in binary form must reproduce the above + * copyright notice, this list of conditions and the following disclaimer + * in the documentation and/or other materials provided with the + * distribution. + * * Neither the name of Google Inc. nor the names of its + * contributors may be used to endorse or promote products derived from + * this software without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS + * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT + * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR + * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT + * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT + * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, + * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY + * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + * + */ + +package grpc + +import ( + "bufio" + "errors" + "fmt" + "io" + "net" + "net/http" + "net/http/httputil" + "net/url" + + "golang.org/x/net/context" +) + +var ( + // errDisabled indicates that proxy is disabled for the address. + errDisabled = errors.New("proxy is disabled for the address") + // The following variable will be overwritten in the tests. + httpProxyFromEnvironment = http.ProxyFromEnvironment +) + +func mapAddress(ctx context.Context, address string) (string, error) { + req := &http.Request{ + URL: &url.URL{ + Scheme: "https", + Host: address, + }, + } + url, err := httpProxyFromEnvironment(req) + if err != nil { + return "", err + } + if url == nil { + return "", errDisabled + } + return url.Host, nil +} + +// To read a response from a net.Conn, http.ReadResponse() takes a bufio.Reader. +// It's possible that this reader reads more than what's need for the response and stores +// those bytes in the buffer. +// bufConn wraps the original net.Conn and the bufio.Reader to make sure we don't lose the +// bytes in the buffer. +type bufConn struct { + net.Conn + r io.Reader +} + +func (c *bufConn) Read(b []byte) (int, error) { + return c.r.Read(b) +} + +func doHTTPConnectHandshake(ctx context.Context, conn net.Conn, addr string) (_ net.Conn, err error) { + defer func() { + if err != nil { + conn.Close() + } + }() + + req := (&http.Request{ + Method: http.MethodConnect, + URL: &url.URL{Host: addr}, + Header: map[string][]string{"User-Agent": {grpcUA}}, + }) + + if err := sendHTTPRequest(ctx, req, conn); err != nil { + return nil, fmt.Errorf("failed to write the HTTP request: %v", err) + } + + r := bufio.NewReader(conn) + resp, err := http.ReadResponse(r, req) + if err != nil { + return nil, fmt.Errorf("reading server HTTP response: %v", err) + } + defer resp.Body.Close() + if resp.StatusCode != http.StatusOK { + dump, err := httputil.DumpResponse(resp, true) + if err != nil { + return nil, fmt.Errorf("failed to do connect handshake, status code: %s", resp.Status) + } + return nil, fmt.Errorf("failed to do connect handshake, response: %q", dump) + } + + return &bufConn{Conn: conn, r: r}, nil +} + +// newProxyDialer returns a dialer that connects to proxy first if necessary. +// The returned dialer checks if a proxy is necessary, dial to the proxy with the +// provided dialer, does HTTP CONNECT handshake and returns the connection. +func newProxyDialer(dialer func(context.Context, string) (net.Conn, error)) func(context.Context, string) (net.Conn, error) { + return func(ctx context.Context, addr string) (conn net.Conn, err error) { + var skipHandshake bool + newAddr, err := mapAddress(ctx, addr) + if err != nil { + if err != errDisabled { + return nil, err + } + skipHandshake = true + newAddr = addr + } + + conn, err = dialer(ctx, newAddr) + if err != nil { + return + } + if !skipHandshake { + conn, err = doHTTPConnectHandshake(ctx, conn, addr) + } + return + } +} diff --git a/vendor/google.golang.org/grpc/rpc_util.go b/vendor/google.golang.org/grpc/rpc_util.go index a25eaa8a287..34e1ad03b97 100644 --- a/vendor/google.golang.org/grpc/rpc_util.go +++ b/vendor/google.golang.org/grpc/rpc_util.go @@ -37,45 +37,21 @@ import ( "bytes" "compress/gzip" "encoding/binary" - "fmt" "io" "io/ioutil" "math" "os" + "time" - "github.com/golang/protobuf/proto" "golang.org/x/net/context" "google.golang.org/grpc/codes" "google.golang.org/grpc/metadata" + "google.golang.org/grpc/peer" + "google.golang.org/grpc/stats" + "google.golang.org/grpc/status" "google.golang.org/grpc/transport" ) -// Codec defines the interface gRPC uses to encode and decode messages. -type Codec interface { - // Marshal returns the wire format of v. - Marshal(v interface{}) ([]byte, error) - // Unmarshal parses the wire format into v. - Unmarshal(data []byte, v interface{}) error - // String returns the name of the Codec implementation. The returned - // string will be used as part of content type in transmission. - String() string -} - -// protoCodec is a Codec implementation with protobuf. It is the default codec for gRPC. -type protoCodec struct{} - -func (protoCodec) Marshal(v interface{}) ([]byte, error) { - return proto.Marshal(v.(proto.Message)) -} - -func (protoCodec) Unmarshal(data []byte, v interface{}) error { - return proto.Unmarshal(data, v.(proto.Message)) -} - -func (protoCodec) String() string { - return "proto" -} - // Compressor defines the interface gRPC uses to compress a message. type Compressor interface { // Do compresses p into w. @@ -138,6 +114,7 @@ type callInfo struct { failFast bool headerMD metadata.MD trailerMD metadata.MD + peer *peer.Peer traceInfo traceInfo // in trace.go } @@ -181,12 +158,22 @@ func Trailer(md *metadata.MD) CallOption { }) } +// Peer returns a CallOption that retrieves peer information for a +// unary RPC. +func Peer(peer *peer.Peer) CallOption { + return afterCall(func(c *callInfo) { + if c.peer != nil { + *peer = *c.peer + } + }) +} + // FailFast configures the action to take when an RPC is attempted on broken // connections or unreachable servers. If failfast is true, the RPC will fail // immediately. Otherwise, the RPC client will block the call until a // connection is available (or the call is canceled or times out) and will retry // the call if it fails due to a transient error. Please refer to -// https://github.com/grpc/grpc/blob/master/doc/fail_fast.md +// https://github.com/grpc/grpc/blob/master/doc/fail_fast.md. Note: failFast is default to true. func FailFast(failFast bool) CallOption { return beforeCall(func(c *callInfo) error { c.failFast = failFast @@ -255,9 +242,11 @@ func (p *parser) recvMsg(maxMsgSize int) (pf payloadFormat, msg []byte, err erro // encode serializes msg and prepends the message header. If msg is nil, it // generates the message header of 0 message length. -func encode(c Codec, msg interface{}, cp Compressor, cbuf *bytes.Buffer) ([]byte, error) { - var b []byte - var length uint +func encode(c Codec, msg interface{}, cp Compressor, cbuf *bytes.Buffer, outPayload *stats.OutPayload) ([]byte, error) { + var ( + b []byte + length uint + ) if msg != nil { var err error // TODO(zhaoq): optimize to reduce memory alloc and copying. @@ -265,6 +254,12 @@ func encode(c Codec, msg interface{}, cp Compressor, cbuf *bytes.Buffer) ([]byte if err != nil { return nil, err } + if outPayload != nil { + outPayload.Payload = msg + // TODO truncate large payload. + outPayload.Data = b + outPayload.Length = len(b) + } if cp != nil { if err := cp.Do(cbuf, b); err != nil { return nil, err @@ -295,6 +290,10 @@ func encode(c Codec, msg interface{}, cp Compressor, cbuf *bytes.Buffer) ([]byte // Copy encoded msg to buf copy(buf[5:], b) + if outPayload != nil { + outPayload.WireLength = len(buf) + } + return buf, nil } @@ -311,11 +310,14 @@ func checkRecvPayload(pf payloadFormat, recvCompress string, dc Decompressor) er return nil } -func recv(p *parser, c Codec, s *transport.Stream, dc Decompressor, m interface{}, maxMsgSize int) error { +func recv(p *parser, c Codec, s *transport.Stream, dc Decompressor, m interface{}, maxMsgSize int, inPayload *stats.InPayload) error { pf, d, err := p.recvMsg(maxMsgSize) if err != nil { return err } + if inPayload != nil { + inPayload.WireLength = len(d) + } if err := checkRecvPayload(pf, s.RecvCompress(), dc); err != nil { return err } @@ -333,91 +335,90 @@ func recv(p *parser, c Codec, s *transport.Stream, dc Decompressor, m interface{ if err := c.Unmarshal(d, m); err != nil { return Errorf(codes.Internal, "grpc: failed to unmarshal the received message %v", err) } + if inPayload != nil { + inPayload.RecvTime = time.Now() + inPayload.Payload = m + // TODO truncate large payload. + inPayload.Data = d + inPayload.Length = len(d) + } return nil } -// rpcError defines the status from an RPC. -type rpcError struct { - code codes.Code - desc string +type rpcInfo struct { + bytesSent bool + bytesReceived bool } -func (e *rpcError) Error() string { - return fmt.Sprintf("rpc error: code = %d desc = %s", e.code, e.desc) +type rpcInfoContextKey struct{} + +func newContextWithRPCInfo(ctx context.Context) context.Context { + return context.WithValue(ctx, rpcInfoContextKey{}, &rpcInfo{}) +} + +func rpcInfoFromContext(ctx context.Context) (s *rpcInfo, ok bool) { + s, ok = ctx.Value(rpcInfoContextKey{}).(*rpcInfo) + return +} + +func updateRPCInfoInContext(ctx context.Context, s rpcInfo) { + if ss, ok := rpcInfoFromContext(ctx); ok { + *ss = s + } + return } // Code returns the error code for err if it was produced by the rpc system. // Otherwise, it returns codes.Unknown. +// +// Deprecated; use status.FromError and Code method instead. func Code(err error) codes.Code { - if err == nil { - return codes.OK - } - if e, ok := err.(*rpcError); ok { - return e.code + if s, ok := status.FromError(err); ok { + return s.Code() } return codes.Unknown } // ErrorDesc returns the error description of err if it was produced by the rpc system. // Otherwise, it returns err.Error() or empty string when err is nil. +// +// Deprecated; use status.FromError and Message method instead. func ErrorDesc(err error) string { - if err == nil { - return "" - } - if e, ok := err.(*rpcError); ok { - return e.desc + if s, ok := status.FromError(err); ok { + return s.Message() } return err.Error() } // Errorf returns an error containing an error code and a description; // Errorf returns nil if c is OK. +// +// Deprecated; use status.Errorf instead. func Errorf(c codes.Code, format string, a ...interface{}) error { - if c == codes.OK { - return nil - } - return &rpcError{ - code: c, - desc: fmt.Sprintf(format, a...), - } + return status.Errorf(c, format, a...) } -// toRPCErr converts an error into a rpcError. +// toRPCErr converts an error into an error from the status package. func toRPCErr(err error) error { - switch e := err.(type) { - case *rpcError: + if _, ok := status.FromError(err); ok { return err + } + switch e := err.(type) { case transport.StreamError: - return &rpcError{ - code: e.Code, - desc: e.Desc, - } + return status.Error(e.Code, e.Desc) case transport.ConnectionError: - return &rpcError{ - code: codes.Internal, - desc: e.Desc, - } + return status.Error(codes.Internal, e.Desc) default: switch err { case context.DeadlineExceeded: - return &rpcError{ - code: codes.DeadlineExceeded, - desc: err.Error(), - } + return status.Error(codes.DeadlineExceeded, err.Error()) case context.Canceled: - return &rpcError{ - code: codes.Canceled, - desc: err.Error(), - } + return status.Error(codes.Canceled, err.Error()) case ErrClientConnClosing: - return &rpcError{ - code: codes.FailedPrecondition, - desc: err.Error(), - } + return status.Error(codes.FailedPrecondition, err.Error()) } - } - return Errorf(codes.Unknown, "%v", err) + return status.Error(codes.Unknown, err.Error()) } // convertCode converts a standard Go error into its canonical code. Note that @@ -448,6 +449,44 @@ func convertCode(err error) codes.Code { return codes.Unknown } +// MethodConfig defines the configuration recommended by the service providers for a +// particular method. +// This is EXPERIMENTAL and subject to change. +type MethodConfig struct { + // WaitForReady indicates whether RPCs sent to this method should wait until + // the connection is ready by default (!failfast). The value specified via the + // gRPC client API will override the value set here. + WaitForReady bool + // Timeout is the default timeout for RPCs sent to this method. The actual + // deadline used will be the minimum of the value specified here and the value + // set by the application via the gRPC client API. If either one is not set, + // then the other will be used. If neither is set, then the RPC has no deadline. + Timeout time.Duration + // MaxReqSize is the maximum allowed payload size for an individual request in a + // stream (client->server) in bytes. The size which is measured is the serialized + // payload after per-message compression (but before stream compression) in bytes. + // The actual value used is the minumum of the value specified here and the value set + // by the application via the gRPC client API. If either one is not set, then the other + // will be used. If neither is set, then the built-in default is used. + // TODO: support this. + MaxReqSize uint32 + // MaxRespSize is the maximum allowed payload size for an individual response in a + // stream (server->client) in bytes. + // TODO: support this. + MaxRespSize uint32 +} + +// ServiceConfig is provided by the service provider and contains parameters for how +// clients that connect to the service should behave. +// This is EXPERIMENTAL and subject to change. +type ServiceConfig struct { + // LB is the load balancer the service providers recommends. The balancer specified + // via grpc.WithBalancer will override this. + LB Balancer + // Methods contains a map for the methods in this service. + Methods map[string]MethodConfig +} + // SupportPackageIsVersion4 is referenced from generated protocol buffer files // to assert that that code is compatible with this version of the grpc package. // @@ -455,3 +494,8 @@ func convertCode(err error) codes.Code { // requires a synchronised update of grpc-go and protoc-gen-go. This constant // should not be referenced from any other code. const SupportPackageIsVersion4 = true + +// Version is the current grpc version. +const Version = "1.3.0" + +const grpcUA = "grpc-go/" + Version diff --git a/vendor/google.golang.org/grpc/server.go b/vendor/google.golang.org/grpc/server.go index e0bb187ef97..b15f71c6c18 100644 --- a/vendor/google.golang.org/grpc/server.go +++ b/vendor/google.golang.org/grpc/server.go @@ -53,7 +53,11 @@ import ( "google.golang.org/grpc/credentials" "google.golang.org/grpc/grpclog" "google.golang.org/grpc/internal" + "google.golang.org/grpc/keepalive" "google.golang.org/grpc/metadata" + "google.golang.org/grpc/stats" + "google.golang.org/grpc/status" + "google.golang.org/grpc/tap" "google.golang.org/grpc/transport" ) @@ -110,8 +114,13 @@ type options struct { maxMsgSize int unaryInt UnaryServerInterceptor streamInt StreamServerInterceptor + inTapHandle tap.ServerInHandle + statsHandler stats.Handler maxConcurrentStreams uint32 useHandlerImpl bool // use http.Handler-based server + unknownStreamDesc *StreamDesc + keepaliveParams keepalive.ServerParameters + keepalivePolicy keepalive.EnforcementPolicy } var defaultMaxMsgSize = 1024 * 1024 * 4 // use 4MB as the default message size limit @@ -119,6 +128,20 @@ var defaultMaxMsgSize = 1024 * 1024 * 4 // use 4MB as the default message size l // A ServerOption sets options. type ServerOption func(*options) +// KeepaliveParams returns a ServerOption that sets keepalive and max-age parameters for the server. +func KeepaliveParams(kp keepalive.ServerParameters) ServerOption { + return func(o *options) { + o.keepaliveParams = kp + } +} + +// KeepaliveEnforcementPolicy returns a ServerOption that sets keepalive enforcement policy for the server. +func KeepaliveEnforcementPolicy(kep keepalive.EnforcementPolicy) ServerOption { + return func(o *options) { + o.keepalivePolicy = kep + } +} + // CustomCodec returns a ServerOption that sets a codec for message marshaling and unmarshaling. func CustomCodec(codec Codec) ServerOption { return func(o *options) { @@ -186,6 +209,42 @@ func StreamInterceptor(i StreamServerInterceptor) ServerOption { } } +// InTapHandle returns a ServerOption that sets the tap handle for all the server +// transport to be created. Only one can be installed. +func InTapHandle(h tap.ServerInHandle) ServerOption { + return func(o *options) { + if o.inTapHandle != nil { + panic("The tap handle has been set.") + } + o.inTapHandle = h + } +} + +// StatsHandler returns a ServerOption that sets the stats handler for the server. +func StatsHandler(h stats.Handler) ServerOption { + return func(o *options) { + o.statsHandler = h + } +} + +// UnknownServiceHandler returns a ServerOption that allows for adding a custom +// unknown service handler. The provided method is a bidi-streaming RPC service +// handler that will be invoked instead of returning the the "unimplemented" gRPC +// error whenever a request is received for an unregistered service or method. +// The handling function has full access to the Context of the request and the +// stream, and the invocation passes through interceptors. +func UnknownServiceHandler(streamHandler StreamHandler) ServerOption { + return func(o *options) { + o.unknownStreamDesc = &StreamDesc{ + StreamName: "unknown_service_handler", + Handler: streamHandler, + // We need to assume that the users of the streamHandler will want to use both. + ClientStreams: true, + ServerStreams: true, + } + } +} + // NewServer creates a gRPC server which has no service registered and has not // started to accept requests yet. func NewServer(opt ...ServerOption) *Server { @@ -329,6 +388,7 @@ func (s *Server) useTransportAuthenticator(rawConn net.Conn) (net.Conn, credenti // read gRPC requests and then call the registered handlers to reply to them. // Serve returns when lis.Accept fails with fatal errors. lis will be closed when // this method returns. +// Serve always returns non-nil error. func (s *Server) Serve(lis net.Listener) error { s.mu.Lock() s.printf("serving") @@ -412,17 +472,25 @@ func (s *Server) handleRawConn(rawConn net.Conn) { if s.opts.useHandlerImpl { s.serveUsingHandler(conn) } else { - s.serveNewHTTP2Transport(conn, authInfo) + s.serveHTTP2Transport(conn, authInfo) } } -// serveNewHTTP2Transport sets up a new http/2 transport (using the +// serveHTTP2Transport sets up a http/2 transport (using the // gRPC http2 server transport in transport/http2_server.go) and // serves streams on it. // This is run in its own goroutine (it does network I/O in // transport.NewServerTransport). -func (s *Server) serveNewHTTP2Transport(c net.Conn, authInfo credentials.AuthInfo) { - st, err := transport.NewServerTransport("http2", c, s.opts.maxConcurrentStreams, authInfo) +func (s *Server) serveHTTP2Transport(c net.Conn, authInfo credentials.AuthInfo) { + config := &transport.ServerConfig{ + MaxStreams: s.opts.maxConcurrentStreams, + AuthInfo: authInfo, + InTapHandle: s.opts.inTapHandle, + StatsHandler: s.opts.statsHandler, + KeepaliveParams: s.opts.keepaliveParams, + KeepalivePolicy: s.opts.keepalivePolicy, + } + st, err := transport.NewServerTransport("http2", c, config) if err != nil { s.mu.Lock() s.errorf("NewServerTransport(%q) failed: %v", c.RemoteAddr(), err) @@ -448,6 +516,12 @@ func (s *Server) serveStreams(st transport.ServerTransport) { defer wg.Done() s.handleStream(st, stream, s.traceInfo(st, stream)) }() + }, func(ctx context.Context, method string) context.Context { + if !EnableTracing { + return ctx + } + tr := trace.New("grpc.Recv."+methodFamily(method), method) + return trace.NewContext(ctx, tr) }) wg.Wait() } @@ -497,15 +571,17 @@ func (s *Server) ServeHTTP(w http.ResponseWriter, r *http.Request) { // traceInfo returns a traceInfo and associates it with stream, if tracing is enabled. // If tracing is not enabled, it returns nil. func (s *Server) traceInfo(st transport.ServerTransport, stream *transport.Stream) (trInfo *traceInfo) { - if !EnableTracing { + tr, ok := trace.FromContext(stream.Context()) + if !ok { return nil } + trInfo = &traceInfo{ - tr: trace.New("grpc.Recv."+methodFamily(stream.Method()), stream.Method()), + tr: tr, } trInfo.firstLine.client = false trInfo.firstLine.remoteAddr = st.RemoteAddr() - stream.TraceContext(trInfo.tr) + if dl, ok := stream.Context().Deadline(); ok { trInfo.firstLine.deadline = dl.Sub(time.Now()) } @@ -532,11 +608,17 @@ func (s *Server) removeConn(c io.Closer) { } func (s *Server) sendResponse(t transport.ServerTransport, stream *transport.Stream, msg interface{}, cp Compressor, opts *transport.Options) error { - var cbuf *bytes.Buffer + var ( + cbuf *bytes.Buffer + outPayload *stats.OutPayload + ) if cp != nil { cbuf = new(bytes.Buffer) } - p, err := encode(s.opts.codec, msg, cp, cbuf) + if s.opts.statsHandler != nil { + outPayload = &stats.OutPayload{} + } + p, err := encode(s.opts.codec, msg, cp, cbuf, outPayload) if err != nil { // This typically indicates a fatal issue (e.g., memory // corruption or hardware faults) the application program @@ -547,10 +629,33 @@ func (s *Server) sendResponse(t transport.ServerTransport, stream *transport.Str // the optimal option. grpclog.Fatalf("grpc: Server failed to encode response %v", err) } - return t.Write(stream, p, opts) + err = t.Write(stream, p, opts) + if err == nil && outPayload != nil { + outPayload.SentTime = time.Now() + s.opts.statsHandler.HandleRPC(stream.Context(), outPayload) + } + return err } func (s *Server) processUnaryRPC(t transport.ServerTransport, stream *transport.Stream, srv *service, md *MethodDesc, trInfo *traceInfo) (err error) { + sh := s.opts.statsHandler + if sh != nil { + begin := &stats.Begin{ + BeginTime: time.Now(), + } + sh.HandleRPC(stream.Context(), begin) + } + defer func() { + if sh != nil { + end := &stats.End{ + EndTime: time.Now(), + } + if err != nil && err != io.EOF { + end.Error = toRPCErr(err) + } + sh.HandleRPC(stream.Context(), end) + } + }() if trInfo != nil { defer trInfo.tr.Finish() trInfo.firstLine.client = false @@ -567,7 +672,7 @@ func (s *Server) processUnaryRPC(t transport.ServerTransport, stream *transport. stream.SetSendCompress(s.opts.cp.Type()) } p := &parser{r: stream} - for { + for { // TODO: delete pf, req, err := p.recvMsg(s.opts.maxMsgSize) if err == io.EOF { // The entire stream is done (for unary RPC only). @@ -577,58 +682,68 @@ func (s *Server) processUnaryRPC(t transport.ServerTransport, stream *transport. err = Errorf(codes.Internal, io.ErrUnexpectedEOF.Error()) } if err != nil { - switch err := err.(type) { - case *rpcError: - if err := t.WriteStatus(stream, err.code, err.desc); err != nil { - grpclog.Printf("grpc: Server.processUnaryRPC failed to write status %v", err) + if st, ok := status.FromError(err); ok { + if e := t.WriteStatus(stream, st); e != nil { + grpclog.Printf("grpc: Server.processUnaryRPC failed to write status %v", e) } - case transport.ConnectionError: - // Nothing to do here. - case transport.StreamError: - if err := t.WriteStatus(stream, err.Code, err.Desc); err != nil { - grpclog.Printf("grpc: Server.processUnaryRPC failed to write status %v", err) + } else { + switch st := err.(type) { + case transport.ConnectionError: + // Nothing to do here. + case transport.StreamError: + if e := t.WriteStatus(stream, status.New(st.Code, st.Desc)); e != nil { + grpclog.Printf("grpc: Server.processUnaryRPC failed to write status %v", e) + } + default: + panic(fmt.Sprintf("grpc: Unexpected error (%T) from recvMsg: %v", st, st)) } - default: - panic(fmt.Sprintf("grpc: Unexpected error (%T) from recvMsg: %v", err, err)) } return err } if err := checkRecvPayload(pf, stream.RecvCompress(), s.opts.dc); err != nil { - switch err := err.(type) { - case *rpcError: - if err := t.WriteStatus(stream, err.code, err.desc); err != nil { - grpclog.Printf("grpc: Server.processUnaryRPC failed to write status %v", err) + if st, ok := status.FromError(err); ok { + if e := t.WriteStatus(stream, st); e != nil { + grpclog.Printf("grpc: Server.processUnaryRPC failed to write status %v", e) } - default: - if err := t.WriteStatus(stream, codes.Internal, err.Error()); err != nil { - grpclog.Printf("grpc: Server.processUnaryRPC failed to write status %v", err) - } - + return err + } + if e := t.WriteStatus(stream, status.New(codes.Internal, err.Error())); e != nil { + grpclog.Printf("grpc: Server.processUnaryRPC failed to write status %v", e) + } + + // TODO checkRecvPayload always return RPC error. Add a return here if necessary. + } + var inPayload *stats.InPayload + if sh != nil { + inPayload = &stats.InPayload{ + RecvTime: time.Now(), } - return err } - statusCode := codes.OK - statusDesc := "" df := func(v interface{}) error { + if inPayload != nil { + inPayload.WireLength = len(req) + } if pf == compressionMade { var err error req, err = s.opts.dc.Do(bytes.NewReader(req)) if err != nil { - if err := t.WriteStatus(stream, codes.Internal, err.Error()); err != nil { - grpclog.Printf("grpc: Server.processUnaryRPC failed to write status %v", err) - } - return err + return Errorf(codes.Internal, err.Error()) } } if len(req) > s.opts.maxMsgSize { // TODO: Revisit the error code. Currently keep it consistent with // java implementation. - statusCode = codes.Internal - statusDesc = fmt.Sprintf("grpc: server received a message of %d bytes exceeding %d limit", len(req), s.opts.maxMsgSize) + return status.Errorf(codes.Internal, "grpc: server received a message of %d bytes exceeding %d limit", len(req), s.opts.maxMsgSize) } if err := s.opts.codec.Unmarshal(req, v); err != nil { - return err + return status.Errorf(codes.Internal, "grpc: error unmarshalling request: %v", err) + } + if inPayload != nil { + inPayload.Payload = v + inPayload.Data = req + inPayload.Length = len(req) + sh.HandleRPC(stream.Context(), inPayload) } if trInfo != nil { trInfo.tr.LazyLog(&payload{sent: false, msg: v}, true) @@ -637,22 +752,20 @@ func (s *Server) processUnaryRPC(t transport.ServerTransport, stream *transport. } reply, appErr := md.Handler(srv.server, stream.Context(), df, s.opts.unaryInt) if appErr != nil { - if err, ok := appErr.(*rpcError); ok { - statusCode = err.code - statusDesc = err.desc - } else { - statusCode = convertCode(appErr) - statusDesc = appErr.Error() + appStatus, ok := status.FromError(appErr) + if !ok { + // Convert appErr if it is not a grpc status error. + appErr = status.Error(convertCode(appErr), appErr.Error()) + appStatus, _ = status.FromError(appErr) } - if trInfo != nil && statusCode != codes.OK { - trInfo.tr.LazyLog(stringer(statusDesc), true) + if trInfo != nil { + trInfo.tr.LazyLog(stringer(appStatus.Message()), true) trInfo.tr.SetError() } - if err := t.WriteStatus(stream, statusCode, statusDesc); err != nil { - grpclog.Printf("grpc: Server.processUnaryRPC failed to write status: %v", err) - return err + if e := t.WriteStatus(stream, appStatus); e != nil { + grpclog.Printf("grpc: Server.processUnaryRPC failed to write status: %v", e) } - return nil + return appErr } if trInfo != nil { trInfo.tr.LazyLog(stringer("OK"), false) @@ -662,38 +775,70 @@ func (s *Server) processUnaryRPC(t transport.ServerTransport, stream *transport. Delay: false, } if err := s.sendResponse(t, stream, reply, s.opts.cp, opts); err != nil { - switch err := err.(type) { - case transport.ConnectionError: - // Nothing to do here. - case transport.StreamError: - statusCode = err.Code - statusDesc = err.Desc - default: - statusCode = codes.Unknown - statusDesc = err.Error() + if err == io.EOF { + // The entire stream is done (for unary RPC only). + return err + } + if s, ok := status.FromError(err); ok { + if e := t.WriteStatus(stream, s); e != nil { + grpclog.Printf("grpc: Server.processUnaryRPC failed to write status: %v", e) + } + } else { + switch st := err.(type) { + case transport.ConnectionError: + // Nothing to do here. + case transport.StreamError: + if e := t.WriteStatus(stream, status.New(st.Code, st.Desc)); e != nil { + grpclog.Printf("grpc: Server.processUnaryRPC failed to write status %v", e) + } + default: + panic(fmt.Sprintf("grpc: Unexpected error (%T) from sendResponse: %v", st, st)) + } } return err } if trInfo != nil { trInfo.tr.LazyLog(&payload{sent: true, msg: reply}, true) } - return t.WriteStatus(stream, statusCode, statusDesc) + // TODO: Should we be logging if writing status failed here, like above? + // Should the logging be in WriteStatus? Should we ignore the WriteStatus + // error or allow the stats handler to see it? + return t.WriteStatus(stream, status.New(codes.OK, "")) } } func (s *Server) processStreamingRPC(t transport.ServerTransport, stream *transport.Stream, srv *service, sd *StreamDesc, trInfo *traceInfo) (err error) { + sh := s.opts.statsHandler + if sh != nil { + begin := &stats.Begin{ + BeginTime: time.Now(), + } + sh.HandleRPC(stream.Context(), begin) + } + defer func() { + if sh != nil { + end := &stats.End{ + EndTime: time.Now(), + } + if err != nil && err != io.EOF { + end.Error = toRPCErr(err) + } + sh.HandleRPC(stream.Context(), end) + } + }() if s.opts.cp != nil { stream.SetSendCompress(s.opts.cp.Type()) } ss := &serverStream{ - t: t, - s: stream, - p: &parser{r: stream}, - codec: s.opts.codec, - cp: s.opts.cp, - dc: s.opts.dc, - maxMsgSize: s.opts.maxMsgSize, - trInfo: trInfo, + t: t, + s: stream, + p: &parser{r: stream}, + codec: s.opts.codec, + cp: s.opts.cp, + dc: s.opts.dc, + maxMsgSize: s.opts.maxMsgSize, + trInfo: trInfo, + statsHandler: sh, } if ss.cp != nil { ss.cbuf = new(bytes.Buffer) @@ -712,39 +857,47 @@ func (s *Server) processStreamingRPC(t transport.ServerTransport, stream *transp }() } var appErr error + var server interface{} + if srv != nil { + server = srv.server + } if s.opts.streamInt == nil { - appErr = sd.Handler(srv.server, ss) + appErr = sd.Handler(server, ss) } else { info := &StreamServerInfo{ FullMethod: stream.Method(), IsClientStream: sd.ClientStreams, IsServerStream: sd.ServerStreams, } - appErr = s.opts.streamInt(srv.server, ss, info, sd.Handler) + appErr = s.opts.streamInt(server, ss, info, sd.Handler) } if appErr != nil { - if err, ok := appErr.(*rpcError); ok { - ss.statusCode = err.code - ss.statusDesc = err.desc - } else if err, ok := appErr.(transport.StreamError); ok { - ss.statusCode = err.Code - ss.statusDesc = err.Desc - } else { - ss.statusCode = convertCode(appErr) - ss.statusDesc = appErr.Error() + appStatus, ok := status.FromError(appErr) + if !ok { + switch err := appErr.(type) { + case transport.StreamError: + appStatus = status.New(err.Code, err.Desc) + default: + appStatus = status.New(convertCode(appErr), appErr.Error()) + } + appErr = appStatus.Err() } + if trInfo != nil { + ss.mu.Lock() + ss.trInfo.tr.LazyLog(stringer(appStatus.Message()), true) + ss.trInfo.tr.SetError() + ss.mu.Unlock() + } + t.WriteStatus(ss.s, appStatus) + // TODO: Should we log an error from WriteStatus here and below? + return appErr } if trInfo != nil { ss.mu.Lock() - if ss.statusCode != codes.OK { - ss.trInfo.tr.LazyLog(stringer(ss.statusDesc), true) - ss.trInfo.tr.SetError() - } else { - ss.trInfo.tr.LazyLog(stringer("OK"), false) - } + ss.trInfo.tr.LazyLog(stringer("OK"), false) ss.mu.Unlock() } - return t.WriteStatus(ss.s, ss.statusCode, ss.statusDesc) + return t.WriteStatus(ss.s, status.New(codes.OK, "")) } @@ -759,7 +912,8 @@ func (s *Server) handleStream(t transport.ServerTransport, stream *transport.Str trInfo.tr.LazyLog(&fmtStringer{"Malformed method name %q", []interface{}{sm}}, true) trInfo.tr.SetError() } - if err := t.WriteStatus(stream, codes.InvalidArgument, fmt.Sprintf("malformed method name: %q", stream.Method())); err != nil { + errDesc := fmt.Sprintf("malformed method name: %q", stream.Method()) + if err := t.WriteStatus(stream, status.New(codes.InvalidArgument, errDesc)); err != nil { if trInfo != nil { trInfo.tr.LazyLog(&fmtStringer{"%v", []interface{}{err}}, true) trInfo.tr.SetError() @@ -775,11 +929,16 @@ func (s *Server) handleStream(t transport.ServerTransport, stream *transport.Str method := sm[pos+1:] srv, ok := s.m[service] if !ok { + if unknownDesc := s.opts.unknownStreamDesc; unknownDesc != nil { + s.processStreamingRPC(t, stream, nil, unknownDesc, trInfo) + return + } if trInfo != nil { trInfo.tr.LazyLog(&fmtStringer{"Unknown service %v", []interface{}{service}}, true) trInfo.tr.SetError() } - if err := t.WriteStatus(stream, codes.Unimplemented, fmt.Sprintf("unknown service %v", service)); err != nil { + errDesc := fmt.Sprintf("unknown service %v", service) + if err := t.WriteStatus(stream, status.New(codes.Unimplemented, errDesc)); err != nil { if trInfo != nil { trInfo.tr.LazyLog(&fmtStringer{"%v", []interface{}{err}}, true) trInfo.tr.SetError() @@ -804,7 +963,12 @@ func (s *Server) handleStream(t transport.ServerTransport, stream *transport.Str trInfo.tr.LazyLog(&fmtStringer{"Unknown method %v", []interface{}{method}}, true) trInfo.tr.SetError() } - if err := t.WriteStatus(stream, codes.Unimplemented, fmt.Sprintf("unknown method %v", method)); err != nil { + if unknownDesc := s.opts.unknownStreamDesc; unknownDesc != nil { + s.processStreamingRPC(t, stream, nil, unknownDesc, trInfo) + return + } + errDesc := fmt.Sprintf("unknown method %v", method) + if err := t.WriteStatus(stream, status.New(codes.Unimplemented, errDesc)); err != nil { if trInfo != nil { trInfo.tr.LazyLog(&fmtStringer{"%v", []interface{}{err}}, true) trInfo.tr.SetError() diff --git a/vendor/google.golang.org/grpc/stats/BUILD b/vendor/google.golang.org/grpc/stats/BUILD new file mode 100644 index 00000000000..40ef55534c9 --- /dev/null +++ b/vendor/google.golang.org/grpc/stats/BUILD @@ -0,0 +1,25 @@ +load("@io_bazel_rules_go//go:def.bzl", "go_library") + +go_library( + name = "go_default_library", + srcs = [ + "handlers.go", + "stats.go", + ], + visibility = ["//visibility:public"], + deps = ["//vendor/golang.org/x/net/context:go_default_library"], +) + +filegroup( + name = "package-srcs", + srcs = glob(["**"]), + tags = ["automanaged"], + visibility = ["//visibility:private"], +) + +filegroup( + name = "all-srcs", + srcs = [":package-srcs"], + tags = ["automanaged"], + visibility = ["//visibility:public"], +) diff --git a/vendor/google.golang.org/grpc/stats/handlers.go b/vendor/google.golang.org/grpc/stats/handlers.go new file mode 100644 index 00000000000..26e1a8e2f08 --- /dev/null +++ b/vendor/google.golang.org/grpc/stats/handlers.go @@ -0,0 +1,76 @@ +/* + * + * Copyright 2016, Google Inc. + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions are + * met: + * + * * Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * * Redistributions in binary form must reproduce the above + * copyright notice, this list of conditions and the following disclaimer + * in the documentation and/or other materials provided with the + * distribution. + * * Neither the name of Google Inc. nor the names of its + * contributors may be used to endorse or promote products derived from + * this software without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS + * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT + * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR + * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT + * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT + * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, + * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY + * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + * + */ + +package stats + +import ( + "net" + + "golang.org/x/net/context" +) + +// ConnTagInfo defines the relevant information needed by connection context tagger. +type ConnTagInfo struct { + // RemoteAddr is the remote address of the corresponding connection. + RemoteAddr net.Addr + // LocalAddr is the local address of the corresponding connection. + LocalAddr net.Addr + // TODO add QOS related fields. +} + +// RPCTagInfo defines the relevant information needed by RPC context tagger. +type RPCTagInfo struct { + // FullMethodName is the RPC method in the format of /package.service/method. + FullMethodName string +} + +// Handler defines the interface for the related stats handling (e.g., RPCs, connections). +type Handler interface { + // TagRPC can attach some information to the given context. + // The returned context is used in the rest lifetime of the RPC. + TagRPC(context.Context, *RPCTagInfo) context.Context + // HandleRPC processes the RPC stats. + HandleRPC(context.Context, RPCStats) + + // TagConn can attach some information to the given context. + // The returned context will be used for stats handling. + // For conn stats handling, the context used in HandleConn for this + // connection will be derived from the context returned. + // For RPC stats handling, + // - On server side, the context used in HandleRPC for all RPCs on this + // connection will be derived from the context returned. + // - On client side, the context is not derived from the context returned. + TagConn(context.Context, *ConnTagInfo) context.Context + // HandleConn processes the Conn stats. + HandleConn(context.Context, ConnStats) +} diff --git a/vendor/google.golang.org/grpc/stats/stats.go b/vendor/google.golang.org/grpc/stats/stats.go new file mode 100644 index 00000000000..c2c9a9dfa23 --- /dev/null +++ b/vendor/google.golang.org/grpc/stats/stats.go @@ -0,0 +1,223 @@ +/* + * + * Copyright 2016, Google Inc. + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions are + * met: + * + * * Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * * Redistributions in binary form must reproduce the above + * copyright notice, this list of conditions and the following disclaimer + * in the documentation and/or other materials provided with the + * distribution. + * * Neither the name of Google Inc. nor the names of its + * contributors may be used to endorse or promote products derived from + * this software without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS + * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT + * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR + * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT + * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT + * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, + * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY + * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + * + */ + +// Package stats is for collecting and reporting various network and RPC stats. +// This package is for monitoring purpose only. All fields are read-only. +// All APIs are experimental. +package stats + +import ( + "net" + "time" +) + +// RPCStats contains stats information about RPCs. +type RPCStats interface { + isRPCStats() + // IsClient returns true if this RPCStats is from client side. + IsClient() bool +} + +// Begin contains stats when an RPC begins. +// FailFast are only valid if Client is true. +type Begin struct { + // Client is true if this Begin is from client side. + Client bool + // BeginTime is the time when the RPC begins. + BeginTime time.Time + // FailFast indicates if this RPC is failfast. + FailFast bool +} + +// IsClient indicates if this is from client side. +func (s *Begin) IsClient() bool { return s.Client } + +func (s *Begin) isRPCStats() {} + +// InPayload contains the information for an incoming payload. +type InPayload struct { + // Client is true if this InPayload is from client side. + Client bool + // Payload is the payload with original type. + Payload interface{} + // Data is the serialized message payload. + Data []byte + // Length is the length of uncompressed data. + Length int + // WireLength is the length of data on wire (compressed, signed, encrypted). + WireLength int + // RecvTime is the time when the payload is received. + RecvTime time.Time +} + +// IsClient indicates if this is from client side. +func (s *InPayload) IsClient() bool { return s.Client } + +func (s *InPayload) isRPCStats() {} + +// InHeader contains stats when a header is received. +// FullMethod, addresses and Compression are only valid if Client is false. +type InHeader struct { + // Client is true if this InHeader is from client side. + Client bool + // WireLength is the wire length of header. + WireLength int + + // FullMethod is the full RPC method string, i.e., /package.service/method. + FullMethod string + // RemoteAddr is the remote address of the corresponding connection. + RemoteAddr net.Addr + // LocalAddr is the local address of the corresponding connection. + LocalAddr net.Addr + // Compression is the compression algorithm used for the RPC. + Compression string +} + +// IsClient indicates if this is from client side. +func (s *InHeader) IsClient() bool { return s.Client } + +func (s *InHeader) isRPCStats() {} + +// InTrailer contains stats when a trailer is received. +type InTrailer struct { + // Client is true if this InTrailer is from client side. + Client bool + // WireLength is the wire length of trailer. + WireLength int +} + +// IsClient indicates if this is from client side. +func (s *InTrailer) IsClient() bool { return s.Client } + +func (s *InTrailer) isRPCStats() {} + +// OutPayload contains the information for an outgoing payload. +type OutPayload struct { + // Client is true if this OutPayload is from client side. + Client bool + // Payload is the payload with original type. + Payload interface{} + // Data is the serialized message payload. + Data []byte + // Length is the length of uncompressed data. + Length int + // WireLength is the length of data on wire (compressed, signed, encrypted). + WireLength int + // SentTime is the time when the payload is sent. + SentTime time.Time +} + +// IsClient indicates if this is from client side. +func (s *OutPayload) IsClient() bool { return s.Client } + +func (s *OutPayload) isRPCStats() {} + +// OutHeader contains stats when a header is sent. +// FullMethod, addresses and Compression are only valid if Client is true. +type OutHeader struct { + // Client is true if this OutHeader is from client side. + Client bool + // WireLength is the wire length of header. + WireLength int + + // FullMethod is the full RPC method string, i.e., /package.service/method. + FullMethod string + // RemoteAddr is the remote address of the corresponding connection. + RemoteAddr net.Addr + // LocalAddr is the local address of the corresponding connection. + LocalAddr net.Addr + // Compression is the compression algorithm used for the RPC. + Compression string +} + +// IsClient indicates if this is from client side. +func (s *OutHeader) IsClient() bool { return s.Client } + +func (s *OutHeader) isRPCStats() {} + +// OutTrailer contains stats when a trailer is sent. +type OutTrailer struct { + // Client is true if this OutTrailer is from client side. + Client bool + // WireLength is the wire length of trailer. + WireLength int +} + +// IsClient indicates if this is from client side. +func (s *OutTrailer) IsClient() bool { return s.Client } + +func (s *OutTrailer) isRPCStats() {} + +// End contains stats when an RPC ends. +type End struct { + // Client is true if this End is from client side. + Client bool + // EndTime is the time when the RPC ends. + EndTime time.Time + // Error is the error just happened. It implements status.Status if non-nil. + Error error +} + +// IsClient indicates if this is from client side. +func (s *End) IsClient() bool { return s.Client } + +func (s *End) isRPCStats() {} + +// ConnStats contains stats information about connections. +type ConnStats interface { + isConnStats() + // IsClient returns true if this ConnStats is from client side. + IsClient() bool +} + +// ConnBegin contains the stats of a connection when it is established. +type ConnBegin struct { + // Client is true if this ConnBegin is from client side. + Client bool +} + +// IsClient indicates if this is from client side. +func (s *ConnBegin) IsClient() bool { return s.Client } + +func (s *ConnBegin) isConnStats() {} + +// ConnEnd contains the stats of a connection when it ends. +type ConnEnd struct { + // Client is true if this ConnEnd is from client side. + Client bool +} + +// IsClient indicates if this is from client side. +func (s *ConnEnd) IsClient() bool { return s.Client } + +func (s *ConnEnd) isConnStats() {} diff --git a/vendor/google.golang.org/grpc/status/BUILD b/vendor/google.golang.org/grpc/status/BUILD new file mode 100644 index 00000000000..8c12e5a6856 --- /dev/null +++ b/vendor/google.golang.org/grpc/status/BUILD @@ -0,0 +1,26 @@ +load("@io_bazel_rules_go//go:def.bzl", "go_library") + +go_library( + name = "go_default_library", + srcs = ["status.go"], + visibility = ["//visibility:public"], + deps = [ + "//vendor/github.com/golang/protobuf/proto:go_default_library", + "//vendor/google.golang.org/genproto/googleapis/rpc/status:go_default_library", + "//vendor/google.golang.org/grpc/codes:go_default_library", + ], +) + +filegroup( + name = "package-srcs", + srcs = glob(["**"]), + tags = ["automanaged"], + visibility = ["//visibility:private"], +) + +filegroup( + name = "all-srcs", + srcs = [":package-srcs"], + tags = ["automanaged"], + visibility = ["//visibility:public"], +) diff --git a/vendor/google.golang.org/grpc/status/status.go b/vendor/google.golang.org/grpc/status/status.go new file mode 100644 index 00000000000..99a4cbe5112 --- /dev/null +++ b/vendor/google.golang.org/grpc/status/status.go @@ -0,0 +1,145 @@ +/* + * + * Copyright 2017, Google Inc. + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions are + * met: + * + * * Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * * Redistributions in binary form must reproduce the above + * copyright notice, this list of conditions and the following disclaimer + * in the documentation and/or other materials provided with the + * distribution. + * * Neither the name of Google Inc. nor the names of its + * contributors may be used to endorse or promote products derived from + * this software without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS + * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT + * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR + * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT + * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT + * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, + * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY + * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + * + */ + +// Package status implements errors returned by gRPC. These errors are +// serialized and transmitted on the wire between server and client, and allow +// for additional data to be transmitted via the Details field in the status +// proto. gRPC service handlers should return an error created by this +// package, and gRPC clients should expect a corresponding error to be +// returned from the RPC call. +// +// This package upholds the invariants that a non-nil error may not +// contain an OK code, and an OK code must result in a nil error. +package status + +import ( + "fmt" + + "github.com/golang/protobuf/proto" + spb "google.golang.org/genproto/googleapis/rpc/status" + "google.golang.org/grpc/codes" +) + +// statusError is an alias of a status proto. It implements error and Status, +// and a nil statusError should never be returned by this package. +type statusError spb.Status + +func (se *statusError) Error() string { + p := (*spb.Status)(se) + return fmt.Sprintf("rpc error: code = %s desc = %s", codes.Code(p.GetCode()), p.GetMessage()) +} + +func (se *statusError) status() *Status { + return &Status{s: (*spb.Status)(se)} +} + +// Status represents an RPC status code, message, and details. It is immutable +// and should be created with New, Newf, or FromProto. +type Status struct { + s *spb.Status +} + +// Code returns the status code contained in s. +func (s *Status) Code() codes.Code { + if s == nil || s.s == nil { + return codes.OK + } + return codes.Code(s.s.Code) +} + +// Message returns the message contained in s. +func (s *Status) Message() string { + if s == nil || s.s == nil { + return "" + } + return s.s.Message +} + +// Proto returns s's status as an spb.Status proto message. +func (s *Status) Proto() *spb.Status { + if s == nil { + return nil + } + return proto.Clone(s.s).(*spb.Status) +} + +// Err returns an immutable error representing s; returns nil if s.Code() is +// OK. +func (s *Status) Err() error { + if s.Code() == codes.OK { + return nil + } + return (*statusError)(s.s) +} + +// New returns a Status representing c and msg. +func New(c codes.Code, msg string) *Status { + return &Status{s: &spb.Status{Code: int32(c), Message: msg}} +} + +// Newf returns New(c, fmt.Sprintf(format, a...)). +func Newf(c codes.Code, format string, a ...interface{}) *Status { + return New(c, fmt.Sprintf(format, a...)) +} + +// Error returns an error representing c and msg. If c is OK, returns nil. +func Error(c codes.Code, msg string) error { + return New(c, msg).Err() +} + +// Errorf returns Error(c, fmt.Sprintf(format, a...)). +func Errorf(c codes.Code, format string, a ...interface{}) error { + return Error(c, fmt.Sprintf(format, a...)) +} + +// ErrorProto returns an error representing s. If s.Code is OK, returns nil. +func ErrorProto(s *spb.Status) error { + return FromProto(s).Err() +} + +// FromProto returns a Status representing s. +func FromProto(s *spb.Status) *Status { + return &Status{s: proto.Clone(s).(*spb.Status)} +} + +// FromError returns a Status representing err if it was produced from this +// package, otherwise it returns nil, false. +func FromError(err error) (s *Status, ok bool) { + if err == nil { + return &Status{s: &spb.Status{Code: int32(codes.OK)}}, true + } + if s, ok := err.(*statusError); ok { + return s.status(), true + } + return nil, false +} diff --git a/vendor/google.golang.org/grpc/stream.go b/vendor/google.golang.org/grpc/stream.go index 46810544f19..33f1c787b34 100644 --- a/vendor/google.golang.org/grpc/stream.go +++ b/vendor/google.golang.org/grpc/stream.go @@ -37,7 +37,6 @@ import ( "bytes" "errors" "io" - "math" "sync" "time" @@ -45,6 +44,8 @@ import ( "golang.org/x/net/trace" "google.golang.org/grpc/codes" "google.golang.org/grpc/metadata" + "google.golang.org/grpc/stats" + "google.golang.org/grpc/status" "google.golang.org/grpc/transport" ) @@ -97,7 +98,7 @@ type ClientStream interface { // NewClientStream creates a new Stream for the client side. This is called // by generated code. -func NewClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, method string, opts ...CallOption) (ClientStream, error) { +func NewClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, method string, opts ...CallOption) (_ ClientStream, err error) { if cc.dopts.streamInt != nil { return cc.dopts.streamInt(ctx, desc, cc, method, newClientStream, opts...) } @@ -106,11 +107,18 @@ func NewClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, meth func newClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, method string, opts ...CallOption) (_ ClientStream, err error) { var ( - t transport.ClientTransport - s *transport.Stream - put func() + t transport.ClientTransport + s *transport.Stream + put func() + cancel context.CancelFunc ) c := defaultCallInfo + if mc, ok := cc.getMethodConfig(method); ok { + c.failFast = !mc.WaitForReady + if mc.Timeout > 0 { + ctx, cancel = context.WithTimeout(ctx, mc.Timeout) + } + } for _, o := range opts { if err := o.before(&c); err != nil { return nil, toRPCErr(err) @@ -143,6 +151,27 @@ func newClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, meth } }() } + ctx = newContextWithRPCInfo(ctx) + sh := cc.dopts.copts.StatsHandler + if sh != nil { + ctx = sh.TagRPC(ctx, &stats.RPCTagInfo{FullMethodName: method}) + begin := &stats.Begin{ + Client: true, + BeginTime: time.Now(), + FailFast: c.failFast, + } + sh.HandleRPC(ctx, begin) + } + defer func() { + if err != nil && sh != nil { + // Only handle end stats if err != nil. + end := &stats.End{ + Client: true, + Error: err, + } + sh.HandleRPC(ctx, end) + } + }() gopts := BalancerGetOptions{ BlockingWait: !c.failFast, } @@ -150,7 +179,7 @@ func newClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, meth t, put, err = cc.getTransport(ctx, gopts) if err != nil { // TODO(zhaoq): Probably revisit the error handling. - if _, ok := err.(*rpcError); ok { + if _, ok := status.FromError(err); ok { return nil, err } if err == errConnClosing || err == errConnUnavailable { @@ -165,14 +194,17 @@ func newClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, meth s, err = t.NewStream(ctx, callHdr) if err != nil { + if _, ok := err.(transport.ConnectionError); ok && put != nil { + // If error is connection error, transport was sending data on wire, + // and we are not sure if anything has been sent on wire. + // If error is not connection error, we are sure nothing has been sent. + updateRPCInfoInContext(ctx, rpcInfo{bytesSent: true, bytesReceived: false}) + } if put != nil { put() put = nil } - if _, ok := err.(transport.ConnectionError); ok || err == transport.ErrStreamDrain { - if c.failFast { - return nil, toRPCErr(err) - } + if _, ok := err.(transport.ConnectionError); (ok || err == transport.ErrStreamDrain) && !c.failFast { continue } return nil, toRPCErr(err) @@ -180,12 +212,14 @@ func newClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, meth break } cs := &clientStream{ - opts: opts, - c: c, - desc: desc, - codec: cc.dopts.codec, - cp: cc.dopts.cp, - dc: cc.dopts.dc, + opts: opts, + c: c, + desc: desc, + codec: cc.dopts.codec, + cp: cc.dopts.cp, + dc: cc.dopts.dc, + maxMsgSize: cc.dopts.maxMsgSize, + cancel: cancel, put: put, t: t, @@ -194,6 +228,9 @@ func newClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, meth tracing: EnableTracing, trInfo: trInfo, + + statsCtx: ctx, + statsHandler: cc.dopts.copts.StatsHandler, } if cc.dopts.cp != nil { cs.cbuf = new(bytes.Buffer) @@ -204,14 +241,13 @@ func newClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, meth select { case <-t.Error(): // Incur transport error, simply exit. + case <-cc.ctx.Done(): + cs.finish(ErrClientConnClosing) + cs.closeTransportStream(ErrClientConnClosing) case <-s.Done(): // TODO: The trace of the RPC is terminated here when there is no pending // I/O, which is probably not the optimal solution. - if s.StatusCode() == codes.OK { - cs.finish(nil) - } else { - cs.finish(Errorf(s.StatusCode(), "%s", s.StatusDesc())) - } + cs.finish(s.Status().Err()) cs.closeTransportStream(nil) case <-s.GoAway(): cs.finish(errConnDrain) @@ -227,25 +263,34 @@ func newClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, meth // clientStream implements a client side Stream. type clientStream struct { - opts []CallOption - c callInfo - t transport.ClientTransport - s *transport.Stream - p *parser - desc *StreamDesc - codec Codec - cp Compressor - cbuf *bytes.Buffer - dc Decompressor + opts []CallOption + c callInfo + t transport.ClientTransport + s *transport.Stream + p *parser + desc *StreamDesc + codec Codec + cp Compressor + cbuf *bytes.Buffer + dc Decompressor + maxMsgSize int + cancel context.CancelFunc tracing bool // set to EnableTracing when the clientStream is created. - mu sync.Mutex - put func() - closed bool + mu sync.Mutex + put func() + closed bool + finished bool // trInfo.tr is set when the clientStream is created (if EnableTracing is true), // and is set to nil when the clientStream's finish method is called. trInfo traceInfo + + // statsCtx keeps the user context for stats handling. + // All stats collection should use the statsCtx (instead of the stream context) + // so that all the generated stats for a particular RPC can be associated in the processing phase. + statsCtx context.Context + statsHandler stats.Handler } func (cs *clientStream) Context() context.Context { @@ -274,6 +319,8 @@ func (cs *clientStream) SendMsg(m interface{}) (err error) { } cs.mu.Unlock() } + // TODO Investigate how to signal the stats handling party. + // generate error stats if err != nil && err != io.EOF? defer func() { if err != nil { cs.finish(err) @@ -296,7 +343,13 @@ func (cs *clientStream) SendMsg(m interface{}) (err error) { } err = toRPCErr(err) }() - out, err := encode(cs.codec, m, cs.cp, cs.cbuf) + var outPayload *stats.OutPayload + if cs.statsHandler != nil { + outPayload = &stats.OutPayload{ + Client: true, + } + } + out, err := encode(cs.codec, m, cs.cp, cs.cbuf, outPayload) defer func() { if cs.cbuf != nil { cs.cbuf.Reset() @@ -305,11 +358,22 @@ func (cs *clientStream) SendMsg(m interface{}) (err error) { if err != nil { return Errorf(codes.Internal, "grpc: %v", err) } - return cs.t.Write(cs.s, out, &transport.Options{Last: false}) + err = cs.t.Write(cs.s, out, &transport.Options{Last: false}) + if err == nil && outPayload != nil { + outPayload.SentTime = time.Now() + cs.statsHandler.HandleRPC(cs.statsCtx, outPayload) + } + return err } func (cs *clientStream) RecvMsg(m interface{}) (err error) { - err = recv(cs.p, cs.codec, cs.s, cs.dc, m, math.MaxInt32) + var inPayload *stats.InPayload + if cs.statsHandler != nil { + inPayload = &stats.InPayload{ + Client: true, + } + } + err = recv(cs.p, cs.codec, cs.s, cs.dc, m, cs.maxMsgSize, inPayload) defer func() { // err != nil indicates the termination of the stream. if err != nil { @@ -324,21 +388,25 @@ func (cs *clientStream) RecvMsg(m interface{}) (err error) { } cs.mu.Unlock() } + if inPayload != nil { + cs.statsHandler.HandleRPC(cs.statsCtx, inPayload) + } if !cs.desc.ClientStreams || cs.desc.ServerStreams { return } // Special handling for client streaming rpc. - err = recv(cs.p, cs.codec, cs.s, cs.dc, m, math.MaxInt32) + // This recv expects EOF or errors, so we don't collect inPayload. + err = recv(cs.p, cs.codec, cs.s, cs.dc, m, cs.maxMsgSize, nil) cs.closeTransportStream(err) if err == nil { return toRPCErr(errors.New("grpc: client streaming protocol violation: get , want ")) } if err == io.EOF { - if cs.s.StatusCode() == codes.OK { - cs.finish(err) - return nil + if se := cs.s.Status().Err(); se != nil { + return se } - return Errorf(cs.s.StatusCode(), "%s", cs.s.StatusDesc()) + cs.finish(err) + return nil } return toRPCErr(err) } @@ -346,11 +414,11 @@ func (cs *clientStream) RecvMsg(m interface{}) (err error) { cs.closeTransportStream(err) } if err == io.EOF { - if cs.s.StatusCode() == codes.OK { - // Returns io.EOF to indicate the end of the stream. - return + if statusErr := cs.s.Status().Err(); statusErr != nil { + return statusErr } - return Errorf(cs.s.StatusCode(), "%s", cs.s.StatusDesc()) + // Returns io.EOF to indicate the end of the stream. + return } return toRPCErr(err) } @@ -386,13 +454,37 @@ func (cs *clientStream) closeTransportStream(err error) { func (cs *clientStream) finish(err error) { cs.mu.Lock() defer cs.mu.Unlock() + if cs.finished { + return + } + cs.finished = true + defer func() { + if cs.cancel != nil { + cs.cancel() + } + }() for _, o := range cs.opts { o.after(&cs.c) } if cs.put != nil { + updateRPCInfoInContext(cs.s.Context(), rpcInfo{ + bytesSent: cs.s.BytesSent(), + bytesReceived: cs.s.BytesReceived(), + }) cs.put() cs.put = nil } + if cs.statsHandler != nil { + end := &stats.End{ + Client: true, + EndTime: time.Now(), + } + if err != io.EOF { + // end.Error is nil if the RPC finished successfully. + end.Error = toRPCErr(err) + } + cs.statsHandler.HandleRPC(cs.statsCtx, end) + } if !cs.tracing { return } @@ -437,10 +529,10 @@ type serverStream struct { dc Decompressor cbuf *bytes.Buffer maxMsgSize int - statusCode codes.Code - statusDesc string trInfo *traceInfo + statsHandler stats.Handler + mu sync.Mutex // protects trInfo.tr after the service handler runs. } @@ -482,7 +574,11 @@ func (ss *serverStream) SendMsg(m interface{}) (err error) { ss.mu.Unlock() } }() - out, err := encode(ss.codec, m, ss.cp, ss.cbuf) + var outPayload *stats.OutPayload + if ss.statsHandler != nil { + outPayload = &stats.OutPayload{} + } + out, err := encode(ss.codec, m, ss.cp, ss.cbuf, outPayload) defer func() { if ss.cbuf != nil { ss.cbuf.Reset() @@ -495,6 +591,10 @@ func (ss *serverStream) SendMsg(m interface{}) (err error) { if err := ss.t.Write(ss.s, out, &transport.Options{Last: false}); err != nil { return toRPCErr(err) } + if outPayload != nil { + outPayload.SentTime = time.Now() + ss.statsHandler.HandleRPC(ss.s.Context(), outPayload) + } return nil } @@ -513,7 +613,11 @@ func (ss *serverStream) RecvMsg(m interface{}) (err error) { ss.mu.Unlock() } }() - if err := recv(ss.p, ss.codec, ss.s, ss.dc, m, ss.maxMsgSize); err != nil { + var inPayload *stats.InPayload + if ss.statsHandler != nil { + inPayload = &stats.InPayload{} + } + if err := recv(ss.p, ss.codec, ss.s, ss.dc, m, ss.maxMsgSize, inPayload); err != nil { if err == io.EOF { return err } @@ -522,5 +626,8 @@ func (ss *serverStream) RecvMsg(m interface{}) (err error) { } return toRPCErr(err) } + if inPayload != nil { + ss.statsHandler.HandleRPC(ss.s.Context(), inPayload) + } return nil } diff --git a/vendor/google.golang.org/grpc/tap/BUILD b/vendor/google.golang.org/grpc/tap/BUILD new file mode 100644 index 00000000000..4cd77933019 --- /dev/null +++ b/vendor/google.golang.org/grpc/tap/BUILD @@ -0,0 +1,22 @@ +load("@io_bazel_rules_go//go:def.bzl", "go_library") + +go_library( + name = "go_default_library", + srcs = ["tap.go"], + visibility = ["//visibility:public"], + deps = ["//vendor/golang.org/x/net/context:go_default_library"], +) + +filegroup( + name = "package-srcs", + srcs = glob(["**"]), + tags = ["automanaged"], + visibility = ["//visibility:private"], +) + +filegroup( + name = "all-srcs", + srcs = [":package-srcs"], + tags = ["automanaged"], + visibility = ["//visibility:public"], +) diff --git a/vendor/google.golang.org/grpc/tap/tap.go b/vendor/google.golang.org/grpc/tap/tap.go new file mode 100644 index 00000000000..0f366476742 --- /dev/null +++ b/vendor/google.golang.org/grpc/tap/tap.go @@ -0,0 +1,54 @@ +/* + * + * Copyright 2016, Google Inc. + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions are + * met: + * + * * Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * * Redistributions in binary form must reproduce the above + * copyright notice, this list of conditions and the following disclaimer + * in the documentation and/or other materials provided with the + * distribution. + * * Neither the name of Google Inc. nor the names of its + * contributors may be used to endorse or promote products derived from + * this software without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS + * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT + * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR + * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT + * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT + * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, + * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY + * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + * + */ + +// Package tap defines the function handles which are executed on the transport +// layer of gRPC-Go and related information. Everything here is EXPERIMENTAL. +package tap + +import ( + "golang.org/x/net/context" +) + +// Info defines the relevant information needed by the handles. +type Info struct { + // FullMethodName is the string of grpc method (in the format of + // /package.service/method). + FullMethodName string + // TODO: More to be added. +} + +// ServerInHandle defines the function which runs when a new stream is created +// on the server side. Note that it is executed in the per-connection I/O goroutine(s) instead +// of per-RPC goroutine. Therefore, users should NOT have any blocking/time-consuming +// work in this handle. Otherwise all the RPCs would slow down. +type ServerInHandle func(ctx context.Context, info *Info) (context.Context, error) diff --git a/vendor/google.golang.org/grpc/transport/BUILD b/vendor/google.golang.org/grpc/transport/BUILD index ec05cd83463..7e9fd1c47cd 100644 --- a/vendor/google.golang.org/grpc/transport/BUILD +++ b/vendor/google.golang.org/grpc/transport/BUILD @@ -10,20 +10,24 @@ go_library( "http2_client.go", "http2_server.go", "http_util.go", - "pre_go16.go", "transport.go", ], visibility = ["//visibility:public"], deps = [ + "//vendor/github.com/golang/protobuf/proto:go_default_library", "//vendor/golang.org/x/net/context:go_default_library", "//vendor/golang.org/x/net/http2:go_default_library", "//vendor/golang.org/x/net/http2/hpack:go_default_library", - "//vendor/golang.org/x/net/trace:go_default_library", + "//vendor/google.golang.org/genproto/googleapis/rpc/status:go_default_library", "//vendor/google.golang.org/grpc/codes:go_default_library", "//vendor/google.golang.org/grpc/credentials:go_default_library", "//vendor/google.golang.org/grpc/grpclog:go_default_library", + "//vendor/google.golang.org/grpc/keepalive:go_default_library", "//vendor/google.golang.org/grpc/metadata:go_default_library", "//vendor/google.golang.org/grpc/peer:go_default_library", + "//vendor/google.golang.org/grpc/stats:go_default_library", + "//vendor/google.golang.org/grpc/status:go_default_library", + "//vendor/google.golang.org/grpc/tap:go_default_library", ], ) diff --git a/vendor/google.golang.org/grpc/transport/control.go b/vendor/google.golang.org/grpc/transport/control.go index 4ef0830b56c..8d29aee53d4 100644 --- a/vendor/google.golang.org/grpc/transport/control.go +++ b/vendor/google.golang.org/grpc/transport/control.go @@ -35,7 +35,9 @@ package transport import ( "fmt" + "math" "sync" + "time" "golang.org/x/net/http2" ) @@ -44,8 +46,18 @@ const ( // The default value of flow control window size in HTTP2 spec. defaultWindowSize = 65535 // The initial window size for flow control. - initialWindowSize = defaultWindowSize // for an RPC - initialConnWindowSize = defaultWindowSize * 16 // for a connection + initialWindowSize = defaultWindowSize // for an RPC + initialConnWindowSize = defaultWindowSize * 16 // for a connection + infinity = time.Duration(math.MaxInt64) + defaultClientKeepaliveTime = infinity + defaultClientKeepaliveTimeout = time.Duration(20 * time.Second) + defaultMaxStreamsClient = 100 + defaultMaxConnectionIdle = infinity + defaultMaxConnectionAge = infinity + defaultMaxConnectionAgeGrace = infinity + defaultServerKeepaliveTime = time.Duration(2 * time.Hour) + defaultServerKeepaliveTimeout = time.Duration(20 * time.Second) + defaultKeepalivePolicyMinTime = time.Duration(5 * time.Minute) ) // The following defines various control items which could flow through @@ -73,6 +85,8 @@ type resetStream struct { func (*resetStream) item() {} type goAway struct { + code http2.ErrCode + debugData []byte } func (*goAway) item() {} @@ -111,35 +125,9 @@ func newQuotaPool(q int) *quotaPool { return qb } -// add adds n to the available quota and tries to send it on acquire. -func (qb *quotaPool) add(n int) { - qb.mu.Lock() - defer qb.mu.Unlock() - qb.quota += n - if qb.quota <= 0 { - return - } - select { - case qb.c <- qb.quota: - qb.quota = 0 - default: - } -} - -// cancel cancels the pending quota sent on acquire, if any. -func (qb *quotaPool) cancel() { - qb.mu.Lock() - defer qb.mu.Unlock() - select { - case n := <-qb.c: - qb.quota += n - default: - } -} - -// reset cancels the pending quota sent on acquired, incremented by v and sends +// add cancels the pending quota sent on acquired, incremented by v and sends // it back on acquire. -func (qb *quotaPool) reset(v int) { +func (qb *quotaPool) add(v int) { qb.mu.Lock() defer qb.mu.Unlock() select { @@ -151,6 +139,10 @@ func (qb *quotaPool) reset(v int) { if qb.quota <= 0 { return } + // After the pool has been created, this is the only place that sends on + // the channel. Since mu is held at this point and any quota that was sent + // on the channel has been retrieved, we know that this code will always + // place any positive quota value on the channel. select { case qb.c <- qb.quota: qb.quota = 0 diff --git a/vendor/google.golang.org/grpc/transport/handler_server.go b/vendor/google.golang.org/grpc/transport/handler_server.go index 114e34906a1..24f306babbb 100644 --- a/vendor/google.golang.org/grpc/transport/handler_server.go +++ b/vendor/google.golang.org/grpc/transport/handler_server.go @@ -53,6 +53,7 @@ import ( "google.golang.org/grpc/credentials" "google.golang.org/grpc/metadata" "google.golang.org/grpc/peer" + "google.golang.org/grpc/status" ) // NewServerHandlerTransport returns a ServerTransport handling gRPC @@ -110,6 +111,10 @@ func NewServerHandlerTransport(w http.ResponseWriter, r *http.Request) (ServerTr v = v[:i] } } + v, err := decodeMetadataHeader(k, v) + if err != nil { + return nil, streamErrorf(codes.InvalidArgument, "malformed binary metadata: %v", err) + } metakv = append(metakv, k, v) } } @@ -182,7 +187,7 @@ func (ht *serverHandlerTransport) do(fn func()) error { } } -func (ht *serverHandlerTransport) WriteStatus(s *Stream, statusCode codes.Code, statusDesc string) error { +func (ht *serverHandlerTransport) WriteStatus(s *Stream, st *status.Status) error { err := ht.do(func() { ht.writeCommonHeaders(s) @@ -192,10 +197,13 @@ func (ht *serverHandlerTransport) WriteStatus(s *Stream, statusCode codes.Code, ht.rw.(http.Flusher).Flush() h := ht.rw.Header() - h.Set("Grpc-Status", fmt.Sprintf("%d", statusCode)) - if statusDesc != "" { - h.Set("Grpc-Message", encodeGrpcMessage(statusDesc)) + h.Set("Grpc-Status", fmt.Sprintf("%d", st.Code())) + if m := st.Message(); m != "" { + h.Set("Grpc-Message", encodeGrpcMessage(m)) } + + // TODO: Support Grpc-Status-Details-Bin + if md := s.Trailer(); len(md) > 0 { for k, vv := range md { // Clients don't tolerate reading restricted headers after some non restricted ones were sent. @@ -203,10 +211,9 @@ func (ht *serverHandlerTransport) WriteStatus(s *Stream, statusCode codes.Code, continue } for _, v := range vv { - // http2 ResponseWriter mechanism to - // send undeclared Trailers after the - // headers have possibly been written. - h.Add(http2.TrailerPrefix+k, v) + // http2 ResponseWriter mechanism to send undeclared Trailers after + // the headers have possibly been written. + h.Add(http2.TrailerPrefix+k, encodeMetadataHeader(k, v)) } } } @@ -234,6 +241,7 @@ func (ht *serverHandlerTransport) writeCommonHeaders(s *Stream) { // and https://golang.org/pkg/net/http/#example_ResponseWriter_trailers h.Add("Trailer", "Grpc-Status") h.Add("Trailer", "Grpc-Message") + // TODO: Support Grpc-Status-Details-Bin if s.sendCompress != "" { h.Set("Grpc-Encoding", s.sendCompress) @@ -260,6 +268,7 @@ func (ht *serverHandlerTransport) WriteHeader(s *Stream, md metadata.MD) error { continue } for _, v := range vv { + v = encodeMetadataHeader(k, v) h.Add(k, v) } } @@ -268,7 +277,7 @@ func (ht *serverHandlerTransport) WriteHeader(s *Stream, md metadata.MD) error { }) } -func (ht *serverHandlerTransport) HandleStreams(startStream func(*Stream)) { +func (ht *serverHandlerTransport) HandleStreams(startStream func(*Stream), traceCtx func(context.Context, string) context.Context) { // With this transport type there will be exactly 1 stream: this HTTP request. var ctx context.Context @@ -314,7 +323,7 @@ func (ht *serverHandlerTransport) HandleStreams(startStream func(*Stream)) { if req.TLS != nil { pr.AuthInfo = credentials.TLSInfo{State: *req.TLS} } - ctx = metadata.NewContext(ctx, ht.headerMD) + ctx = metadata.NewIncomingContext(ctx, ht.headerMD) ctx = peer.NewContext(ctx, pr) s.ctx = newContextWithStream(ctx, s) s.dec = &recvBufferReader{ctx: s.ctx, recv: s.buf} diff --git a/vendor/google.golang.org/grpc/transport/http2_client.go b/vendor/google.golang.org/grpc/transport/http2_client.go index 2b0f68016af..380fff665fb 100644 --- a/vendor/google.golang.org/grpc/transport/http2_client.go +++ b/vendor/google.golang.org/grpc/transport/http2_client.go @@ -35,12 +35,12 @@ package transport import ( "bytes" - "fmt" "io" "math" "net" "strings" "sync" + "sync/atomic" "time" "golang.org/x/net/context" @@ -49,18 +49,24 @@ import ( "google.golang.org/grpc/codes" "google.golang.org/grpc/credentials" "google.golang.org/grpc/grpclog" + "google.golang.org/grpc/keepalive" "google.golang.org/grpc/metadata" "google.golang.org/grpc/peer" + "google.golang.org/grpc/stats" + "google.golang.org/grpc/status" ) // http2Client implements the ClientTransport interface with HTTP2. type http2Client struct { - target string // server name/addr - userAgent string - md interface{} - conn net.Conn // underlying communication channel - authInfo credentials.AuthInfo // auth info about the connection - nextID uint32 // the next stream ID to be used + ctx context.Context + target string // server name/addr + userAgent string + md interface{} + conn net.Conn // underlying communication channel + remoteAddr net.Addr + localAddr net.Addr + authInfo credentials.AuthInfo // auth info about the connection + nextID uint32 // the next stream ID to be used // writableChan synchronizes write access to the transport. // A writer acquires the write lock by sending a value on writableChan @@ -76,6 +82,8 @@ type http2Client struct { // goAway is closed to notify the upper layer (i.e., addrConn.transportMonitor) // that the server sent GoAway on this transport. goAway chan struct{} + // awakenKeepalive is used to wake up keepalive when after it has gone dormant. + awakenKeepalive chan struct{} framer *framer hBuf *bytes.Buffer // the buffer for HPACK encoding @@ -95,6 +103,13 @@ type http2Client struct { creds []credentials.PerRPCCredentials + // Boolean to keep track of reading activity on transport. + // 1 is true and 0 is false. + activity uint32 // Accessed atomically. + kp keepalive.ClientParameters + + statsHandler stats.Handler + mu sync.Mutex // guard the following variables state transportState // the state of underlying connection activeStreams map[uint32]*Stream @@ -106,6 +121,9 @@ type http2Client struct { goAwayID uint32 // prevGoAway ID records the Last-Stream-ID in the previous GOAway frame. prevGoAwayID uint32 + // goAwayReason records the http2.ErrCode and debug data received with the + // GoAway frame. + goAwayReason GoAwayReason } func dial(ctx context.Context, fn func(context.Context, string) (net.Conn, error), addr string) (net.Conn, error) { @@ -150,6 +168,9 @@ func newHTTP2Client(ctx context.Context, addr TargetInfo, opts ConnectOptions) ( scheme := "http" conn, err := dial(ctx, opts.Dialer, addr.Addr) if err != nil { + if opts.FailOnNonTempDialError { + return nil, connectionErrorf(isTemporary(err), err, "transport: %v", err) + } return nil, connectionErrorf(true, err, "transport: %v", err) } // Any further errors will close the underlying connection @@ -169,23 +190,31 @@ func newHTTP2Client(ctx context.Context, addr TargetInfo, opts ConnectOptions) ( return nil, connectionErrorf(temp, err, "transport: %v", err) } } - ua := primaryUA - if opts.UserAgent != "" { - ua = opts.UserAgent + " " + ua + kp := opts.KeepaliveParams + // Validate keepalive parameters. + if kp.Time == 0 { + kp.Time = defaultClientKeepaliveTime + } + if kp.Timeout == 0 { + kp.Timeout = defaultClientKeepaliveTimeout } var buf bytes.Buffer t := &http2Client{ - target: addr.Addr, - userAgent: ua, - md: addr.Metadata, - conn: conn, - authInfo: authInfo, + ctx: ctx, + target: addr.Addr, + userAgent: opts.UserAgent, + md: addr.Metadata, + conn: conn, + remoteAddr: conn.RemoteAddr(), + localAddr: conn.LocalAddr(), + authInfo: authInfo, // The client initiated stream id is odd starting from 1. nextID: 1, writableChan: make(chan int, 1), shutdownChan: make(chan struct{}), errorChan: make(chan struct{}), goAway: make(chan struct{}), + awakenKeepalive: make(chan struct{}, 1), framer: newFramer(conn), hBuf: &buf, hEnc: hpack.NewEncoder(&buf), @@ -196,8 +225,24 @@ func newHTTP2Client(ctx context.Context, addr TargetInfo, opts ConnectOptions) ( state: reachable, activeStreams: make(map[uint32]*Stream), creds: opts.PerRPCCredentials, - maxStreams: math.MaxInt32, + maxStreams: defaultMaxStreamsClient, + streamsQuota: newQuotaPool(defaultMaxStreamsClient), streamSendQuota: defaultWindowSize, + kp: kp, + statsHandler: opts.StatsHandler, + } + // Make sure awakenKeepalive can't be written upon. + // keepalive routine will make it writable, if need be. + t.awakenKeepalive <- struct{}{} + if t.statsHandler != nil { + t.ctx = t.statsHandler.TagConn(t.ctx, &stats.ConnTagInfo{ + RemoteAddr: t.remoteAddr, + LocalAddr: t.localAddr, + }) + connBegin := &stats.ConnBegin{ + Client: true, + } + t.statsHandler.HandleConn(t.ctx, connBegin) } // Start the reader goroutine for incoming message. Each transport has // a dedicated goroutine which reads HTTP2 frame from network. Then it @@ -233,6 +278,9 @@ func newHTTP2Client(ctx context.Context, addr TargetInfo, opts ConnectOptions) ( } } go t.controller() + if t.kp.Time != infinity { + go t.keepalive() + } t.writableChan <- 0 return t, nil } @@ -266,16 +314,17 @@ func (t *http2Client) newStream(ctx context.Context, callHdr *CallHdr) *Stream { return s } -// NewStream creates a stream and register it into the transport as "active" +// NewStream creates a stream and registers it into the transport as "active" // streams. func (t *http2Client) NewStream(ctx context.Context, callHdr *CallHdr) (_ *Stream, err error) { pr := &peer.Peer{ - Addr: t.conn.RemoteAddr(), + Addr: t.remoteAddr, } // Attach Auth info if there is any. if t.authInfo != nil { pr.AuthInfo = t.authInfo } + userCtx := ctx ctx = peer.NewContext(ctx, pr) authData := make(map[string]string) for _, c := range t.creds { @@ -313,21 +362,18 @@ func (t *http2Client) NewStream(ctx context.Context, callHdr *CallHdr) (_ *Strea t.mu.Unlock() return nil, ErrConnClosing } - checkStreamsQuota := t.streamsQuota != nil t.mu.Unlock() - if checkStreamsQuota { - sq, err := wait(ctx, nil, nil, t.shutdownChan, t.streamsQuota.acquire()) - if err != nil { - return nil, err - } - // Returns the quota balance back. - if sq > 1 { - t.streamsQuota.add(sq - 1) - } + sq, err := wait(ctx, nil, nil, t.shutdownChan, t.streamsQuota.acquire()) + if err != nil { + return nil, err + } + // Returns the quota balance back. + if sq > 1 { + t.streamsQuota.add(sq - 1) } if _, err := wait(ctx, nil, nil, t.shutdownChan, t.writableChan); err != nil { // Return the quota back now because there is no stream returned to the caller. - if _, ok := err.(StreamError); ok && checkStreamsQuota { + if _, ok := err.(StreamError); ok { t.streamsQuota.add(1) } return nil, err @@ -335,9 +381,7 @@ func (t *http2Client) NewStream(ctx context.Context, callHdr *CallHdr) (_ *Strea t.mu.Lock() if t.state == draining { t.mu.Unlock() - if checkStreamsQuota { - t.streamsQuota.add(1) - } + t.streamsQuota.add(1) // Need to make t writable again so that the rpc in flight can still proceed. t.writableChan <- 0 return nil, ErrStreamDrain @@ -347,18 +391,19 @@ func (t *http2Client) NewStream(ctx context.Context, callHdr *CallHdr) (_ *Strea return nil, ErrConnClosing } s := t.newStream(ctx, callHdr) + s.clientStatsCtx = userCtx t.activeStreams[s.id] = s + // If the number of active streams change from 0 to 1, then check if keepalive + // has gone dormant. If so, wake it up. + if len(t.activeStreams) == 1 { + select { + case t.awakenKeepalive <- struct{}{}: + t.framer.writePing(false, false, [8]byte{}) + default: + } + } - // This stream is not counted when applySetings(...) initialize t.streamsQuota. - // Reset t.streamsQuota to the right value. - var reset bool - if !checkStreamsQuota && t.streamsQuota != nil { - reset = true - } t.mu.Unlock() - if reset { - t.streamsQuota.reset(-1) - } // HPACK encodes various headers. Note that once WriteField(...) is // called, the corresponding headers/continuation frame has to be sent @@ -390,29 +435,30 @@ func (t *http2Client) NewStream(ctx context.Context, callHdr *CallHdr) (_ *Strea hasMD bool endHeaders bool ) - if md, ok := metadata.FromContext(ctx); ok { + if md, ok := metadata.FromOutgoingContext(ctx); ok { hasMD = true - for k, v := range md { + for k, vv := range md { // HTTP doesn't allow you to set pseudoheaders after non pseudoheaders were set. if isReservedHeader(k) { continue } - for _, entry := range v { - t.hEnc.WriteField(hpack.HeaderField{Name: k, Value: entry}) + for _, v := range vv { + t.hEnc.WriteField(hpack.HeaderField{Name: k, Value: encodeMetadataHeader(k, v)}) } } } if md, ok := t.md.(*metadata.MD); ok { - for k, v := range *md { + for k, vv := range *md { if isReservedHeader(k) { continue } - for _, entry := range v { - t.hEnc.WriteField(hpack.HeaderField{Name: k, Value: entry}) + for _, v := range vv { + t.hEnc.WriteField(hpack.HeaderField{Name: k, Value: encodeMetadataHeader(k, v)}) } } } first := true + bufLen := t.hBuf.Len() // Sends the headers in a single batch even when they span multiple frames. for !endHeaders { size := t.hBuf.Len() @@ -447,6 +493,19 @@ func (t *http2Client) NewStream(ctx context.Context, callHdr *CallHdr) (_ *Strea return nil, connectionErrorf(true, err, "transport: %v", err) } } + s.bytesSent = true + + if t.statsHandler != nil { + outHeader := &stats.OutHeader{ + Client: true, + WireLength: bufLen, + FullMethod: callHdr.Method, + RemoteAddr: t.remoteAddr, + LocalAddr: t.localAddr, + Compression: callHdr.SendCompress, + } + t.statsHandler.HandleRPC(s.clientStatsCtx, outHeader) + } t.writableChan <- 0 return s, nil } @@ -454,15 +513,11 @@ func (t *http2Client) NewStream(ctx context.Context, callHdr *CallHdr) (_ *Strea // CloseStream clears the footprint of a stream when the stream is not needed any more. // This must not be executed in reader's goroutine. func (t *http2Client) CloseStream(s *Stream, err error) { - var updateStreams bool t.mu.Lock() if t.activeStreams == nil { t.mu.Unlock() return } - if t.streamsQuota != nil { - updateStreams = true - } delete(t.activeStreams, s.id) if t.state == draining && len(t.activeStreams) == 0 { // The transport is draining and s is the last live stream on t. @@ -471,10 +526,27 @@ func (t *http2Client) CloseStream(s *Stream, err error) { return } t.mu.Unlock() - if updateStreams { - t.streamsQuota.add(1) - } + // rstStream is true in case the stream is being closed at the client-side + // and the server needs to be intimated about it by sending a RST_STREAM + // frame. + // To make sure this frame is written to the wire before the headers of the + // next stream waiting for streamsQuota, we add to streamsQuota pool only + // after having acquired the writableChan to send RST_STREAM out (look at + // the controller() routine). + var rstStream bool + var rstError http2.ErrCode + defer func() { + // In case, the client doesn't have to send RST_STREAM to server + // we can safely add back to streamsQuota pool now. + if !rstStream { + t.streamsQuota.add(1) + return + } + t.controlBuf.put(&resetStream{s.id, rstError}) + }() s.mu.Lock() + rstStream = s.rstStream + rstError = s.rstError if q := s.fc.resetPendingData(); q > 0 { if n := t.fc.onRead(q); n > 0 { t.controlBuf.put(&windowUpdate{0, n}) @@ -490,8 +562,9 @@ func (t *http2Client) CloseStream(s *Stream, err error) { } s.state = streamDone s.mu.Unlock() - if se, ok := err.(StreamError); ok && se.Code != codes.DeadlineExceeded { - t.controlBuf.put(&resetStream{s.id, http2.ErrCodeCancel}) + if _, ok := err.(StreamError); ok { + rstStream = true + rstError = http2.ErrCodeCancel } } @@ -525,6 +598,12 @@ func (t *http2Client) Close() (err error) { s.mu.Unlock() s.write(recvMsg{err: ErrConnClosing}) } + if t.statsHandler != nil { + connEnd := &stats.ConnEnd{ + Client: true, + } + t.statsHandler.HandleConn(t.ctx, connEnd) + } return } @@ -582,19 +661,14 @@ func (t *http2Client) Write(s *Stream, data []byte, opts *Options) error { var p []byte if r.Len() > 0 { size := http2MaxFrameLen - s.sendQuotaPool.add(0) // Wait until the stream has some quota to send the data. sq, err := wait(s.ctx, s.done, s.goAway, t.shutdownChan, s.sendQuotaPool.acquire()) if err != nil { return err } - t.sendQuotaPool.add(0) // Wait until the transport has some quota to send the data. tq, err := wait(s.ctx, s.done, s.goAway, t.shutdownChan, t.sendQuotaPool.acquire()) if err != nil { - if _, ok := err.(StreamError); ok || err == io.EOF { - t.sendQuotaPool.cancel() - } return err } if sq < size { @@ -704,7 +778,7 @@ func (t *http2Client) updateWindow(s *Stream, n uint32) { } func (t *http2Client) handleData(f *http2.DataFrame) { - size := len(f.Data()) + size := f.Header().Length if err := t.fc.onData(uint32(size)); err != nil { t.notifyError(connectionErrorf(true, err, "%v", err)) return @@ -718,6 +792,11 @@ func (t *http2Client) handleData(f *http2.DataFrame) { return } if size > 0 { + if f.Header().Flags.Has(http2.FlagDataPadded) { + if w := t.fc.onRead(uint32(size) - uint32(len(f.Data()))); w > 0 { + t.controlBuf.put(&windowUpdate{0, w}) + } + } s.mu.Lock() if s.state == streamDone { s.mu.Unlock() @@ -728,22 +807,27 @@ func (t *http2Client) handleData(f *http2.DataFrame) { return } if err := s.fc.onData(uint32(size)); err != nil { - s.state = streamDone - s.statusCode = codes.Internal - s.statusDesc = err.Error() - close(s.done) + s.rstStream = true + s.rstError = http2.ErrCodeFlowControl + s.finish(status.New(codes.Internal, err.Error())) s.mu.Unlock() s.write(recvMsg{err: io.EOF}) - t.controlBuf.put(&resetStream{s.id, http2.ErrCodeFlowControl}) return } + if f.Header().Flags.Has(http2.FlagDataPadded) { + if w := s.fc.onRead(uint32(size) - uint32(len(f.Data()))); w > 0 { + t.controlBuf.put(&windowUpdate{s.id, w}) + } + } s.mu.Unlock() // TODO(bradfitz, zhaoq): A copy is required here because there is no // guarantee f.Data() is consumed before the arrival of next frame. // Can this copy be eliminated? - data := make([]byte, size) - copy(data, f.Data()) - s.write(recvMsg{data: data}) + if len(f.Data()) > 0 { + data := make([]byte, len(f.Data())) + copy(data, f.Data()) + s.write(recvMsg{data: data}) + } } // The server has closed the stream without sending trailers. Record that // the read direction is closed, and set the status appropriately. @@ -753,10 +837,7 @@ func (t *http2Client) handleData(f *http2.DataFrame) { s.mu.Unlock() return } - s.state = streamDone - s.statusCode = codes.Internal - s.statusDesc = "server closed the stream without sending trailers" - close(s.done) + s.finish(status.New(codes.Internal, "server closed the stream without sending trailers")) s.mu.Unlock() s.write(recvMsg{err: io.EOF}) } @@ -772,18 +853,16 @@ func (t *http2Client) handleRSTStream(f *http2.RSTStreamFrame) { s.mu.Unlock() return } - s.state = streamDone if !s.headerDone { close(s.headerChan) s.headerDone = true } - s.statusCode, ok = http2ErrConvTab[http2.ErrCode(f.ErrCode)] + statusCode, ok := http2ErrConvTab[http2.ErrCode(f.ErrCode)] if !ok { grpclog.Println("transport: http2Client.handleRSTStream found no mapped gRPC status for the received http2 error ", f.ErrCode) - s.statusCode = codes.Unknown + statusCode = codes.Unknown } - s.statusDesc = fmt.Sprintf("stream terminated by RST_STREAM with error code: %d", f.ErrCode) - close(s.done) + s.finish(status.Newf(statusCode, "stream terminated by RST_STREAM with error code: %d", f.ErrCode)) s.mu.Unlock() s.write(recvMsg{err: io.EOF}) } @@ -811,6 +890,9 @@ func (t *http2Client) handlePing(f *http2.PingFrame) { } func (t *http2Client) handleGoAway(f *http2.GoAwayFrame) { + if f.ErrCode == http2.ErrCodeEnhanceYourCalm { + grpclog.Printf("Client received GoAway with http2.ErrCodeEnhanceYourCalm.") + } t.mu.Lock() if t.state == reachable || t.state == draining { if f.LastStreamID > 0 && f.LastStreamID%2 != 1 { @@ -832,6 +914,7 @@ func (t *http2Client) handleGoAway(f *http2.GoAwayFrame) { t.mu.Unlock() return default: + t.setGoAwayReason(f) } t.goAwayID = f.LastStreamID close(t.goAway) @@ -839,6 +922,26 @@ func (t *http2Client) handleGoAway(f *http2.GoAwayFrame) { t.mu.Unlock() } +// setGoAwayReason sets the value of t.goAwayReason based +// on the GoAway frame received. +// It expects a lock on transport's mutext to be held by +// the caller. +func (t *http2Client) setGoAwayReason(f *http2.GoAwayFrame) { + t.goAwayReason = NoReason + switch f.ErrCode { + case http2.ErrCodeEnhanceYourCalm: + if string(f.DebugData()) == "too_many_pings" { + t.goAwayReason = TooManyPings + } + } +} + +func (t *http2Client) GetGoAwayReason() GoAwayReason { + t.mu.Lock() + defer t.mu.Unlock() + return t.goAwayReason +} + func (t *http2Client) handleWindowUpdate(f *http2.WindowUpdateFrame) { id := f.Header().StreamID incr := f.Increment @@ -857,23 +960,41 @@ func (t *http2Client) operateHeaders(frame *http2.MetaHeadersFrame) { if !ok { return } + s.bytesReceived = true var state decodeState for _, hf := range frame.Fields { - state.processHeaderField(hf) - } - if state.err != nil { - s.mu.Lock() - if !s.headerDone { - close(s.headerChan) - s.headerDone = true + if err := state.processHeaderField(hf); err != nil { + s.mu.Lock() + if !s.headerDone { + close(s.headerChan) + s.headerDone = true + } + s.mu.Unlock() + s.write(recvMsg{err: err}) + // Something wrong. Stops reading even when there is remaining. + return } - s.mu.Unlock() - s.write(recvMsg{err: state.err}) - // Something wrong. Stops reading even when there is remaining. - return } endStream := frame.StreamEnded() + var isHeader bool + defer func() { + if t.statsHandler != nil { + if isHeader { + inHeader := &stats.InHeader{ + Client: true, + WireLength: int(frame.Header().Length), + } + t.statsHandler.HandleRPC(s.clientStatsCtx, inHeader) + } else { + inTrailer := &stats.InTrailer{ + Client: true, + WireLength: int(frame.Header().Length), + } + t.statsHandler.HandleRPC(s.clientStatsCtx, inTrailer) + } + } + }() s.mu.Lock() if !endStream { @@ -885,6 +1006,7 @@ func (t *http2Client) operateHeaders(frame *http2.MetaHeadersFrame) { } close(s.headerChan) s.headerDone = true + isHeader = true } if !endStream || s.state == streamDone { s.mu.Unlock() @@ -894,10 +1016,7 @@ func (t *http2Client) operateHeaders(frame *http2.MetaHeadersFrame) { if len(state.mdata) > 0 { s.trailer = state.mdata } - s.statusCode = state.statusCode - s.statusDesc = state.statusDesc - close(s.done) - s.state = streamDone + s.finish(state.status()) s.mu.Unlock() s.write(recvMsg{err: io.EOF}) } @@ -925,6 +1044,7 @@ func (t *http2Client) reader() { t.notifyError(err) return } + atomic.CompareAndSwapUint32(&t.activity, 0, 1) sf, ok := frame.(*http2.SettingsFrame) if !ok { t.notifyError(err) @@ -935,6 +1055,7 @@ func (t *http2Client) reader() { // loop to keep reading incoming messages on this transport. for { frame, err := t.framer.readFrame() + atomic.CompareAndSwapUint32(&t.activity, 0, 1) if err != nil { // Abort an active stream if the http2.Framer returns a // http2.StreamError. This can happen only if the server's response @@ -986,21 +1107,15 @@ func (t *http2Client) applySettings(ss []http2.Setting) { s.Val = math.MaxInt32 } t.mu.Lock() - reset := t.streamsQuota != nil - if !reset { - t.streamsQuota = newQuotaPool(int(s.Val) - len(t.activeStreams)) - } ms := t.maxStreams t.maxStreams = int(s.Val) t.mu.Unlock() - if reset { - t.streamsQuota.reset(int(s.Val) - ms) - } + t.streamsQuota.add(int(s.Val) - ms) case http2.SettingInitialWindowSize: t.mu.Lock() for _, stream := range t.activeStreams { // Adjust the sending quota for each stream. - stream.sendQuotaPool.reset(int(s.Val - t.streamSendQuota)) + stream.sendQuotaPool.add(int(s.Val - t.streamSendQuota)) } t.streamSendQuota = s.Val t.mu.Unlock() @@ -1028,6 +1143,12 @@ func (t *http2Client) controller() { t.framer.writeSettings(true, i.ss...) } case *resetStream: + // If the server needs to be to intimated about stream closing, + // then we need to make sure the RST_STREAM frame is written to + // the wire before the headers of the next stream waiting on + // streamQuota. We ensure this by adding to the streamsQuota pool + // only after having acquired the writableChan to send RST_STREAM. + t.streamsQuota.add(1) t.framer.writeRSTStream(true, i.streamID, i.code) case *flushIO: t.framer.flushWrite() @@ -1047,6 +1168,61 @@ func (t *http2Client) controller() { } } +// keepalive running in a separate goroutune makes sure the connection is alive by sending pings. +func (t *http2Client) keepalive() { + p := &ping{data: [8]byte{}} + timer := time.NewTimer(t.kp.Time) + for { + select { + case <-timer.C: + if atomic.CompareAndSwapUint32(&t.activity, 1, 0) { + timer.Reset(t.kp.Time) + continue + } + // Check if keepalive should go dormant. + t.mu.Lock() + if len(t.activeStreams) < 1 && !t.kp.PermitWithoutStream { + // Make awakenKeepalive writable. + <-t.awakenKeepalive + t.mu.Unlock() + select { + case <-t.awakenKeepalive: + // If the control gets here a ping has been sent + // need to reset the timer with keepalive.Timeout. + case <-t.shutdownChan: + return + } + } else { + t.mu.Unlock() + // Send ping. + t.controlBuf.put(p) + } + + // By the time control gets here a ping has been sent one way or the other. + timer.Reset(t.kp.Timeout) + select { + case <-timer.C: + if atomic.CompareAndSwapUint32(&t.activity, 1, 0) { + timer.Reset(t.kp.Time) + continue + } + t.Close() + return + case <-t.shutdownChan: + if !timer.Stop() { + <-timer.C + } + return + } + case <-t.shutdownChan: + if !timer.Stop() { + <-timer.C + } + return + } + } +} + func (t *http2Client) Error() <-chan struct{} { return t.errorChan } diff --git a/vendor/google.golang.org/grpc/transport/http2_server.go b/vendor/google.golang.org/grpc/transport/http2_server.go index a62fb7c228f..14cd19c64c6 100644 --- a/vendor/google.golang.org/grpc/transport/http2_server.go +++ b/vendor/google.golang.org/grpc/transport/http2_server.go @@ -38,18 +38,26 @@ import ( "errors" "io" "math" + "math/rand" "net" "strconv" "sync" + "sync/atomic" + "time" + "github.com/golang/protobuf/proto" "golang.org/x/net/context" "golang.org/x/net/http2" "golang.org/x/net/http2/hpack" "google.golang.org/grpc/codes" "google.golang.org/grpc/credentials" "google.golang.org/grpc/grpclog" + "google.golang.org/grpc/keepalive" "google.golang.org/grpc/metadata" "google.golang.org/grpc/peer" + "google.golang.org/grpc/stats" + "google.golang.org/grpc/status" + "google.golang.org/grpc/tap" ) // ErrIllegalHeaderWrite indicates that setting header is illegal because of @@ -58,9 +66,13 @@ var ErrIllegalHeaderWrite = errors.New("transport: the stream is done or WriteHe // http2Server implements the ServerTransport interface with HTTP2. type http2Server struct { + ctx context.Context conn net.Conn + remoteAddr net.Addr + localAddr net.Addr maxStreamID uint32 // max stream ID ever seen authInfo credentials.AuthInfo // auth info about the connection + inTapHandle tap.ServerInHandle // writableChan synchronizes write access to the transport. // A writer acquires the write lock by receiving a value on writableChan // and releases it by sending on writableChan. @@ -82,21 +94,46 @@ type http2Server struct { // sendQuotaPool provides flow control to outbound message. sendQuotaPool *quotaPool + stats stats.Handler + + // Flag to keep track of reading activity on transport. + // 1 is true and 0 is false. + activity uint32 // Accessed atomically. + // Keepalive and max-age parameters for the server. + kp keepalive.ServerParameters + + // Keepalive enforcement policy. + kep keepalive.EnforcementPolicy + // The time instance last ping was received. + lastPingAt time.Time + // Number of times the client has violated keepalive ping policy so far. + pingStrikes uint8 + // Flag to signify that number of ping strikes should be reset to 0. + // This is set whenever data or header frames are sent. + // 1 means yes. + resetPingStrikes uint32 // Accessed atomically. + mu sync.Mutex // guard the following state transportState activeStreams map[uint32]*Stream // the per-stream outbound flow control window size set by the peer. streamSendQuota uint32 + // idle is the time instant when the connection went idle. + // This is either the begining of the connection or when the number of + // RPCs go down to 0. + // When the connection is busy, this value is set to 0. + idle time.Time } // newHTTP2Server constructs a ServerTransport based on HTTP2. ConnectionError is // returned if something goes wrong. -func newHTTP2Server(conn net.Conn, maxStreams uint32, authInfo credentials.AuthInfo) (_ ServerTransport, err error) { +func newHTTP2Server(conn net.Conn, config *ServerConfig) (_ ServerTransport, err error) { framer := newFramer(conn) // Send initial settings as connection preface to client. var settings []http2.Setting // TODO(zhaoq): Have a better way to signal "no limit" because 0 is // permitted in the HTTP2 spec. + maxStreams := config.MaxStreams if maxStreams == 0 { maxStreams = math.MaxUint32 } else { @@ -119,14 +156,40 @@ func newHTTP2Server(conn net.Conn, maxStreams uint32, authInfo credentials.AuthI return nil, connectionErrorf(true, err, "transport: %v", err) } } + kp := config.KeepaliveParams + if kp.MaxConnectionIdle == 0 { + kp.MaxConnectionIdle = defaultMaxConnectionIdle + } + if kp.MaxConnectionAge == 0 { + kp.MaxConnectionAge = defaultMaxConnectionAge + } + // Add a jitter to MaxConnectionAge. + kp.MaxConnectionAge += getJitter(kp.MaxConnectionAge) + if kp.MaxConnectionAgeGrace == 0 { + kp.MaxConnectionAgeGrace = defaultMaxConnectionAgeGrace + } + if kp.Time == 0 { + kp.Time = defaultServerKeepaliveTime + } + if kp.Timeout == 0 { + kp.Timeout = defaultServerKeepaliveTimeout + } + kep := config.KeepalivePolicy + if kep.MinTime == 0 { + kep.MinTime = defaultKeepalivePolicyMinTime + } var buf bytes.Buffer t := &http2Server{ + ctx: context.Background(), conn: conn, - authInfo: authInfo, + remoteAddr: conn.RemoteAddr(), + localAddr: conn.LocalAddr(), + authInfo: config.AuthInfo, framer: framer, hBuf: &buf, hEnc: hpack.NewEncoder(&buf), maxStreams: maxStreams, + inTapHandle: config.InTapHandle, controlBuf: newRecvBuffer(), fc: &inFlow{limit: initialConnWindowSize}, sendQuotaPool: newQuotaPool(defaultWindowSize), @@ -135,14 +198,27 @@ func newHTTP2Server(conn net.Conn, maxStreams uint32, authInfo credentials.AuthI shutdownChan: make(chan struct{}), activeStreams: make(map[uint32]*Stream), streamSendQuota: defaultWindowSize, + stats: config.StatsHandler, + kp: kp, + idle: time.Now(), + kep: kep, + } + if t.stats != nil { + t.ctx = t.stats.TagConn(t.ctx, &stats.ConnTagInfo{ + RemoteAddr: t.remoteAddr, + LocalAddr: t.localAddr, + }) + connBegin := &stats.ConnBegin{} + t.stats.HandleConn(t.ctx, connBegin) } go t.controller() + go t.keepalive() t.writableChan <- 0 return t, nil } // operateHeader takes action on the decoded headers. -func (t *http2Server) operateHeaders(frame *http2.MetaHeadersFrame, handle func(*Stream)) (close bool) { +func (t *http2Server) operateHeaders(frame *http2.MetaHeadersFrame, handle func(*Stream), traceCtx func(context.Context, string) context.Context) (close bool) { buf := newRecvBuffer() s := &Stream{ id: frame.Header().StreamID, @@ -153,13 +229,12 @@ func (t *http2Server) operateHeaders(frame *http2.MetaHeadersFrame, handle func( var state decodeState for _, hf := range frame.Fields { - state.processHeaderField(hf) - } - if err := state.err; err != nil { - if se, ok := err.(StreamError); ok { - t.controlBuf.put(&resetStream{s.id, statusCodeConvTab[se.Code]}) + if err := state.processHeaderField(hf); err != nil { + if se, ok := err.(StreamError); ok { + t.controlBuf.put(&resetStream{s.id, statusCodeConvTab[se.Code]}) + } + return } - return } if frame.StreamEnded() { @@ -168,12 +243,12 @@ func (t *http2Server) operateHeaders(frame *http2.MetaHeadersFrame, handle func( } s.recvCompress = state.encoding if state.timeoutSet { - s.ctx, s.cancel = context.WithTimeout(context.TODO(), state.timeout) + s.ctx, s.cancel = context.WithTimeout(t.ctx, state.timeout) } else { - s.ctx, s.cancel = context.WithCancel(context.TODO()) + s.ctx, s.cancel = context.WithCancel(t.ctx) } pr := &peer.Peer{ - Addr: t.conn.RemoteAddr(), + Addr: t.remoteAddr, } // Attach Auth info if there is any. if t.authInfo != nil { @@ -186,7 +261,7 @@ func (t *http2Server) operateHeaders(frame *http2.MetaHeadersFrame, handle func( s.ctx = newContextWithStream(s.ctx, s) // Attach the received metadata to the context. if len(state.mdata) > 0 { - s.ctx = metadata.NewContext(s.ctx, state.mdata) + s.ctx = metadata.NewIncomingContext(s.ctx, state.mdata) } s.dec = &recvBufferReader{ @@ -195,6 +270,18 @@ func (t *http2Server) operateHeaders(frame *http2.MetaHeadersFrame, handle func( } s.recvCompress = state.encoding s.method = state.method + if t.inTapHandle != nil { + var err error + info := &tap.Info{ + FullMethodName: state.method, + } + s.ctx, err = t.inTapHandle(s.ctx, info) + if err != nil { + // TODO: Log the real error. + t.controlBuf.put(&resetStream{s.id, http2.ErrCodeRefusedStream}) + return + } + } t.mu.Lock() if t.state != reachable { t.mu.Unlock() @@ -214,17 +301,33 @@ func (t *http2Server) operateHeaders(frame *http2.MetaHeadersFrame, handle func( t.maxStreamID = s.id s.sendQuotaPool = newQuotaPool(int(t.streamSendQuota)) t.activeStreams[s.id] = s + if len(t.activeStreams) == 1 { + t.idle = time.Time{} + } t.mu.Unlock() s.windowHandler = func(n int) { t.updateWindow(s, uint32(n)) } + s.ctx = traceCtx(s.ctx, s.method) + if t.stats != nil { + s.ctx = t.stats.TagRPC(s.ctx, &stats.RPCTagInfo{FullMethodName: s.method}) + inHeader := &stats.InHeader{ + FullMethod: s.method, + RemoteAddr: t.remoteAddr, + LocalAddr: t.localAddr, + Compression: s.recvCompress, + WireLength: int(frame.Header().Length), + } + t.stats.HandleRPC(s.ctx, inHeader) + } handle(s) return } // HandleStreams receives incoming streams using the given handler. This is // typically run in a separate goroutine. -func (t *http2Server) HandleStreams(handle func(*Stream)) { +// traceCtx attaches trace to ctx and returns the new context. +func (t *http2Server) HandleStreams(handle func(*Stream), traceCtx func(context.Context, string) context.Context) { // Check the validity of client preface. preface := make([]byte, len(clientPreface)) if _, err := io.ReadFull(t.conn, preface); err != nil { @@ -248,6 +351,7 @@ func (t *http2Server) HandleStreams(handle func(*Stream)) { t.Close() return } + atomic.StoreUint32(&t.activity, 1) sf, ok := frame.(*http2.SettingsFrame) if !ok { grpclog.Printf("transport: http2Server.HandleStreams saw invalid preface type %T from client", frame) @@ -258,6 +362,7 @@ func (t *http2Server) HandleStreams(handle func(*Stream)) { for { frame, err := t.framer.readFrame() + atomic.StoreUint32(&t.activity, 1) if err != nil { if se, ok := err.(http2.StreamError); ok { t.mu.Lock() @@ -279,7 +384,7 @@ func (t *http2Server) HandleStreams(handle func(*Stream)) { } switch frame := frame.(type) { case *http2.MetaHeadersFrame: - if t.operateHeaders(frame, handle) { + if t.operateHeaders(frame, handle, traceCtx) { t.Close() break } @@ -334,7 +439,7 @@ func (t *http2Server) updateWindow(s *Stream, n uint32) { } func (t *http2Server) handleData(f *http2.DataFrame) { - size := len(f.Data()) + size := f.Header().Length if err := t.fc.onData(uint32(size)); err != nil { grpclog.Printf("transport: http2Server %v", err) t.Close() @@ -349,6 +454,11 @@ func (t *http2Server) handleData(f *http2.DataFrame) { return } if size > 0 { + if f.Header().Flags.Has(http2.FlagDataPadded) { + if w := t.fc.onRead(uint32(size) - uint32(len(f.Data()))); w > 0 { + t.controlBuf.put(&windowUpdate{0, w}) + } + } s.mu.Lock() if s.state == streamDone { s.mu.Unlock() @@ -364,13 +474,20 @@ func (t *http2Server) handleData(f *http2.DataFrame) { t.controlBuf.put(&resetStream{s.id, http2.ErrCodeFlowControl}) return } + if f.Header().Flags.Has(http2.FlagDataPadded) { + if w := s.fc.onRead(uint32(size) - uint32(len(f.Data()))); w > 0 { + t.controlBuf.put(&windowUpdate{s.id, w}) + } + } s.mu.Unlock() // TODO(bradfitz, zhaoq): A copy is required here because there is no // guarantee f.Data() is consumed before the arrival of next frame. // Can this copy be eliminated? - data := make([]byte, size) - copy(data, f.Data()) - s.write(recvMsg{data: data}) + if len(f.Data()) > 0 { + data := make([]byte, len(f.Data())) + copy(data, f.Data()) + s.write(recvMsg{data: data}) + } } if f.Header().Flags.Has(http2.FlagDataEndStream) { // Received the end of stream from the client. @@ -404,6 +521,11 @@ func (t *http2Server) handleSettings(f *http2.SettingsFrame) { t.controlBuf.put(&settings{ack: true, ss: ss}) } +const ( + maxPingStrikes = 2 + defaultPingTimeout = 2 * time.Hour +) + func (t *http2Server) handlePing(f *http2.PingFrame) { if f.IsAck() { // Do nothing. return @@ -411,6 +533,38 @@ func (t *http2Server) handlePing(f *http2.PingFrame) { pingAck := &ping{ack: true} copy(pingAck.data[:], f.Data[:]) t.controlBuf.put(pingAck) + + now := time.Now() + defer func() { + t.lastPingAt = now + }() + // A reset ping strikes means that we don't need to check for policy + // violation for this ping and the pingStrikes counter should be set + // to 0. + if atomic.CompareAndSwapUint32(&t.resetPingStrikes, 1, 0) { + t.pingStrikes = 0 + return + } + t.mu.Lock() + ns := len(t.activeStreams) + t.mu.Unlock() + if ns < 1 && !t.kep.PermitWithoutStream { + // Keepalive shouldn't be active thus, this new ping should + // have come after atleast defaultPingTimeout. + if t.lastPingAt.Add(defaultPingTimeout).After(now) { + t.pingStrikes++ + } + } else { + // Check if keepalive policy is respected. + if t.lastPingAt.Add(t.kep.MinTime).After(now) { + t.pingStrikes++ + } + } + + if t.pingStrikes > maxPingStrikes { + // Send goaway and close the connection. + t.controlBuf.put(&goAway{code: http2.ErrCodeEnhanceYourCalm, debugData: []byte("too_many_pings")}) + } } func (t *http2Server) handleWindowUpdate(f *http2.WindowUpdateFrame) { @@ -429,6 +583,13 @@ func (t *http2Server) writeHeaders(s *Stream, b *bytes.Buffer, endStream bool) e first := true endHeaders := false var err error + defer func() { + if err == nil { + // Reset ping strikes when seding headers since that might cause the + // peer to send ping. + atomic.StoreUint32(&t.resetPingStrikes, 1) + } + }() // Sends the headers in a single batch. for !endHeaders { size := t.hBuf.Len() @@ -483,18 +644,25 @@ func (t *http2Server) WriteHeader(s *Stream, md metadata.MD) error { if s.sendCompress != "" { t.hEnc.WriteField(hpack.HeaderField{Name: "grpc-encoding", Value: s.sendCompress}) } - for k, v := range md { + for k, vv := range md { if isReservedHeader(k) { // Clients don't tolerate reading restricted headers after some non restricted ones were sent. continue } - for _, entry := range v { - t.hEnc.WriteField(hpack.HeaderField{Name: k, Value: entry}) + for _, v := range vv { + t.hEnc.WriteField(hpack.HeaderField{Name: k, Value: encodeMetadataHeader(k, v)}) } } + bufLen := t.hBuf.Len() if err := t.writeHeaders(s, t.hBuf, false); err != nil { return err } + if t.stats != nil { + outHeader := &stats.OutHeader{ + WireLength: bufLen, + } + t.stats.HandleRPC(s.Context(), outHeader) + } t.writableChan <- 0 return nil } @@ -503,7 +671,7 @@ func (t *http2Server) WriteHeader(s *Stream, md metadata.MD) error { // There is no further I/O operations being able to perform on this stream. // TODO(zhaoq): Now it indicates the end of entire stream. Revisit if early // OK is adopted. -func (t *http2Server) WriteStatus(s *Stream, statusCode codes.Code, statusDesc string) error { +func (t *http2Server) WriteStatus(s *Stream, st *status.Status) error { var headersSent, hasHeader bool s.mu.Lock() if s.state == streamDone { @@ -534,23 +702,41 @@ func (t *http2Server) WriteStatus(s *Stream, statusCode codes.Code, statusDesc s t.hEnc.WriteField( hpack.HeaderField{ Name: "grpc-status", - Value: strconv.Itoa(int(statusCode)), + Value: strconv.Itoa(int(st.Code())), }) - t.hEnc.WriteField(hpack.HeaderField{Name: "grpc-message", Value: encodeGrpcMessage(statusDesc)}) + t.hEnc.WriteField(hpack.HeaderField{Name: "grpc-message", Value: encodeGrpcMessage(st.Message())}) + + if p := st.Proto(); p != nil && len(p.Details) > 0 { + stBytes, err := proto.Marshal(p) + if err != nil { + // TODO: return error instead, when callers are able to handle it. + panic(err) + } + + t.hEnc.WriteField(hpack.HeaderField{Name: "grpc-status-details-bin", Value: encodeBinHeader(stBytes)}) + } + // Attach the trailer metadata. - for k, v := range s.trailer { + for k, vv := range s.trailer { // Clients don't tolerate reading restricted headers after some non restricted ones were sent. if isReservedHeader(k) { continue } - for _, entry := range v { - t.hEnc.WriteField(hpack.HeaderField{Name: k, Value: entry}) + for _, v := range vv { + t.hEnc.WriteField(hpack.HeaderField{Name: k, Value: encodeMetadataHeader(k, v)}) } } + bufLen := t.hBuf.Len() if err := t.writeHeaders(s, t.hBuf, true); err != nil { t.Close() return err } + if t.stats != nil { + outTrailer := &stats.OutTrailer{ + WireLength: bufLen, + } + t.stats.HandleRPC(s.Context(), outTrailer) + } t.closeStream(s) t.writableChan <- 0 return nil @@ -558,7 +744,7 @@ func (t *http2Server) WriteStatus(s *Stream, statusCode codes.Code, statusDesc s // Write converts the data into HTTP2 data frame and sends it out. Non-nil error // is returns if it fails (e.g., framing error, transport error). -func (t *http2Server) Write(s *Stream, data []byte, opts *Options) error { +func (t *http2Server) Write(s *Stream, data []byte, opts *Options) (err error) { // TODO(zhaoq): Support multi-writers for a single stream. var writeHeaderFrame bool s.mu.Lock() @@ -573,25 +759,27 @@ func (t *http2Server) Write(s *Stream, data []byte, opts *Options) error { if writeHeaderFrame { t.WriteHeader(s, nil) } + defer func() { + if err == nil { + // Reset ping strikes when sending data since this might cause + // the peer to send ping. + atomic.StoreUint32(&t.resetPingStrikes, 1) + } + }() r := bytes.NewBuffer(data) for { if r.Len() == 0 { return nil } size := http2MaxFrameLen - s.sendQuotaPool.add(0) // Wait until the stream has some quota to send the data. sq, err := wait(s.ctx, nil, nil, t.shutdownChan, s.sendQuotaPool.acquire()) if err != nil { return err } - t.sendQuotaPool.add(0) // Wait until the transport has some quota to send the data. tq, err := wait(s.ctx, nil, nil, t.shutdownChan, t.sendQuotaPool.acquire()) if err != nil { - if _, ok := err.(StreamError); ok { - t.sendQuotaPool.cancel() - } return err } if sq < size { @@ -659,7 +847,7 @@ func (t *http2Server) applySettings(ss []http2.Setting) { t.mu.Lock() defer t.mu.Unlock() for _, stream := range t.activeStreams { - stream.sendQuotaPool.reset(int(s.Val - t.streamSendQuota)) + stream.sendQuotaPool.add(int(s.Val - t.streamSendQuota)) } t.streamSendQuota = s.Val } @@ -667,6 +855,91 @@ func (t *http2Server) applySettings(ss []http2.Setting) { } } +// keepalive running in a separate goroutine does the following: +// 1. Gracefully closes an idle connection after a duration of keepalive.MaxConnectionIdle. +// 2. Gracefully closes any connection after a duration of keepalive.MaxConnectionAge. +// 3. Forcibly closes a connection after an additive period of keepalive.MaxConnectionAgeGrace over keepalive.MaxConnectionAge. +// 4. Makes sure a connection is alive by sending pings with a frequency of keepalive.Time and closes a non-resposive connection +// after an additional duration of keepalive.Timeout. +func (t *http2Server) keepalive() { + p := &ping{} + var pingSent bool + maxIdle := time.NewTimer(t.kp.MaxConnectionIdle) + maxAge := time.NewTimer(t.kp.MaxConnectionAge) + keepalive := time.NewTimer(t.kp.Time) + // NOTE: All exit paths of this function should reset their + // respecitve timers. A failure to do so will cause the + // following clean-up to deadlock and eventually leak. + defer func() { + if !maxIdle.Stop() { + <-maxIdle.C + } + if !maxAge.Stop() { + <-maxAge.C + } + if !keepalive.Stop() { + <-keepalive.C + } + }() + for { + select { + case <-maxIdle.C: + t.mu.Lock() + idle := t.idle + if idle.IsZero() { // The connection is non-idle. + t.mu.Unlock() + maxIdle.Reset(t.kp.MaxConnectionIdle) + continue + } + val := t.kp.MaxConnectionIdle - time.Since(idle) + if val <= 0 { + // The connection has been idle for a duration of keepalive.MaxConnectionIdle or more. + // Gracefully close the connection. + t.state = draining + t.mu.Unlock() + t.Drain() + // Reseting the timer so that the clean-up doesn't deadlock. + maxIdle.Reset(infinity) + return + } + t.mu.Unlock() + maxIdle.Reset(val) + case <-maxAge.C: + t.mu.Lock() + t.state = draining + t.mu.Unlock() + t.Drain() + maxAge.Reset(t.kp.MaxConnectionAgeGrace) + select { + case <-maxAge.C: + // Close the connection after grace period. + t.Close() + // Reseting the timer so that the clean-up doesn't deadlock. + maxAge.Reset(infinity) + case <-t.shutdownChan: + } + return + case <-keepalive.C: + if atomic.CompareAndSwapUint32(&t.activity, 1, 0) { + pingSent = false + keepalive.Reset(t.kp.Time) + continue + } + if pingSent { + t.Close() + // Reseting the timer so that the clean-up doesn't deadlock. + keepalive.Reset(infinity) + return + } + pingSent = true + t.controlBuf.put(p) + keepalive.Reset(t.kp.Timeout) + case <-t.shutdownChan: + return + } + } +} + // controller running in a separate goroutine takes charge of sending control // frames (e.g., window update, reset stream, setting, etc.) to the server. func (t *http2Server) controller() { @@ -698,7 +971,10 @@ func (t *http2Server) controller() { sid := t.maxStreamID t.state = draining t.mu.Unlock() - t.framer.writeGoAway(true, sid, http2.ErrCodeNo, nil) + t.framer.writeGoAway(true, sid, i.code, i.debugData) + if i.code == http2.ErrCodeEnhanceYourCalm { + t.Close() + } case *flushIO: t.framer.flushWrite() case *ping: @@ -736,6 +1012,10 @@ func (t *http2Server) Close() (err error) { for _, s := range streams { s.cancel() } + if t.stats != nil { + connEnd := &stats.ConnEnd{} + t.stats.HandleConn(t.ctx, connEnd) + } return } @@ -744,6 +1024,9 @@ func (t *http2Server) Close() (err error) { func (t *http2Server) closeStream(s *Stream) { t.mu.Lock() delete(t.activeStreams, s.id) + if len(t.activeStreams) == 0 { + t.idle = time.Now() + } if t.state == draining && len(t.activeStreams) == 0 { defer t.Close() } @@ -767,9 +1050,21 @@ func (t *http2Server) closeStream(s *Stream) { } func (t *http2Server) RemoteAddr() net.Addr { - return t.conn.RemoteAddr() + return t.remoteAddr } func (t *http2Server) Drain() { - t.controlBuf.put(&goAway{}) + t.controlBuf.put(&goAway{code: http2.ErrCodeNo}) +} + +var rgen = rand.New(rand.NewSource(time.Now().UnixNano())) + +func getJitter(v time.Duration) time.Duration { + if v == infinity { + return 0 + } + // Generate a jitter between +/- 10% of the value. + r := int64(v / 10) + j := rgen.Int63n(2*r) - r + return time.Duration(j) } diff --git a/vendor/google.golang.org/grpc/transport/http_util.go b/vendor/google.golang.org/grpc/transport/http_util.go index a3c68d4cac7..795d5d18a4f 100644 --- a/vendor/google.golang.org/grpc/transport/http_util.go +++ b/vendor/google.golang.org/grpc/transport/http_util.go @@ -36,6 +36,7 @@ package transport import ( "bufio" "bytes" + "encoding/base64" "fmt" "io" "net" @@ -44,16 +45,16 @@ import ( "sync/atomic" "time" + "github.com/golang/protobuf/proto" "golang.org/x/net/http2" "golang.org/x/net/http2/hpack" + spb "google.golang.org/genproto/googleapis/rpc/status" "google.golang.org/grpc/codes" "google.golang.org/grpc/grpclog" - "google.golang.org/grpc/metadata" + "google.golang.org/grpc/status" ) const ( - // The primary user agent - primaryUA = "grpc-go/1.0" // http2MaxFrameLen specifies the max length of a HTTP2 frame. http2MaxFrameLen = 16384 // 16KB frame // http://http2.github.io/http2-spec/#SettingValues @@ -92,13 +93,15 @@ var ( // Records the states during HPACK decoding. Must be reset once the // decoding of the entire headers are finished. type decodeState struct { - err error // first error encountered decoding - encoding string - // statusCode caches the stream status received from the trailer - // the server sent. Client side only. - statusCode codes.Code - statusDesc string + // statusGen caches the stream status received from the trailer the server + // sent. Client side only. Do not access directly. After all trailers are + // parsed, use the status method to retrieve the status. + statusGen *status.Status + // rawStatusCode and rawStatusMsg are set from the raw trailer fields and are not + // intended for direct access outside of parsing. + rawStatusCode int32 + rawStatusMsg string // Server side only fields. timeoutSet bool timeout time.Duration @@ -121,6 +124,7 @@ func isReservedHeader(hdr string) bool { "grpc-message", "grpc-status", "grpc-timeout", + "grpc-status-details-bin", "te": return true default: @@ -139,12 +143,6 @@ func isWhitelistedPseudoHeader(hdr string) bool { } } -func (d *decodeState) setErr(err error) { - if d.err == nil { - d.err = err - } -} - func validContentType(t string) bool { e := "application/grpc" if !strings.HasPrefix(t, e) { @@ -158,56 +156,91 @@ func validContentType(t string) bool { return true } -func (d *decodeState) processHeaderField(f hpack.HeaderField) { +func (d *decodeState) status() *status.Status { + if d.statusGen == nil { + // No status-details were provided; generate status using code/msg. + d.statusGen = status.New(codes.Code(d.rawStatusCode), d.rawStatusMsg) + } + return d.statusGen +} + +const binHdrSuffix = "-bin" + +func encodeBinHeader(v []byte) string { + return base64.RawStdEncoding.EncodeToString(v) +} + +func decodeBinHeader(v string) ([]byte, error) { + if len(v)%4 == 0 { + // Input was padded, or padding was not necessary. + return base64.StdEncoding.DecodeString(v) + } + return base64.RawStdEncoding.DecodeString(v) +} + +func encodeMetadataHeader(k, v string) string { + if strings.HasSuffix(k, binHdrSuffix) { + return encodeBinHeader(([]byte)(v)) + } + return v +} + +func decodeMetadataHeader(k, v string) (string, error) { + if strings.HasSuffix(k, binHdrSuffix) { + b, err := decodeBinHeader(v) + return string(b), err + } + return v, nil +} + +func (d *decodeState) processHeaderField(f hpack.HeaderField) error { switch f.Name { case "content-type": if !validContentType(f.Value) { - d.setErr(streamErrorf(codes.FailedPrecondition, "transport: received the unexpected content-type %q", f.Value)) - return + return streamErrorf(codes.FailedPrecondition, "transport: received the unexpected content-type %q", f.Value) } case "grpc-encoding": d.encoding = f.Value case "grpc-status": code, err := strconv.Atoi(f.Value) if err != nil { - d.setErr(streamErrorf(codes.Internal, "transport: malformed grpc-status: %v", err)) - return + return streamErrorf(codes.Internal, "transport: malformed grpc-status: %v", err) } - d.statusCode = codes.Code(code) + d.rawStatusCode = int32(code) case "grpc-message": - d.statusDesc = decodeGrpcMessage(f.Value) + d.rawStatusMsg = decodeGrpcMessage(f.Value) + case "grpc-status-details-bin": + v, err := decodeBinHeader(f.Value) + if err != nil { + return streamErrorf(codes.Internal, "transport: malformed grpc-status-details-bin: %v", err) + } + s := &spb.Status{} + if err := proto.Unmarshal(v, s); err != nil { + return streamErrorf(codes.Internal, "transport: malformed grpc-status-details-bin: %v", err) + } + d.statusGen = status.FromProto(s) case "grpc-timeout": d.timeoutSet = true var err error - d.timeout, err = decodeTimeout(f.Value) - if err != nil { - d.setErr(streamErrorf(codes.Internal, "transport: malformed time-out: %v", err)) - return + if d.timeout, err = decodeTimeout(f.Value); err != nil { + return streamErrorf(codes.Internal, "transport: malformed time-out: %v", err) } case ":path": d.method = f.Value default: if !isReservedHeader(f.Name) || isWhitelistedPseudoHeader(f.Name) { - if f.Name == "user-agent" { - i := strings.LastIndex(f.Value, " ") - if i == -1 { - // There is no application user agent string being set. - return - } - // Extract the application user agent string. - f.Value = f.Value[:i] - } if d.mdata == nil { d.mdata = make(map[string][]string) } - k, v, err := metadata.DecodeKeyValue(f.Name, f.Value) + v, err := decodeMetadataHeader(f.Name, f.Value) if err != nil { grpclog.Printf("Failed to decode (%q, %q): %v", f.Name, f.Value, err) - return + return nil } - d.mdata[k] = append(d.mdata[k], v) + d.mdata[f.Name] = append(d.mdata[f.Name], v) } } + return nil } type timeoutUnit uint8 @@ -379,6 +412,9 @@ func newFramer(conn net.Conn) *framer { writer: bufio.NewWriterSize(conn, http2IOBufSize), } f.fr = http2.NewFramer(f.writer, f.reader) + // Opt-in to Frame reuse API on framer to reduce garbage. + // Frames aren't safe to read from after a subsequent call to ReadFrame. + f.fr.SetReuseFrames() f.fr.ReadMetaHeaders = hpack.NewDecoder(http2InitHeaderTableSize, nil) return f } diff --git a/vendor/google.golang.org/grpc/transport/transport.go b/vendor/google.golang.org/grpc/transport/transport.go index 21f757ac64e..87dc27e5bba 100644 --- a/vendor/google.golang.org/grpc/transport/transport.go +++ b/vendor/google.golang.org/grpc/transport/transport.go @@ -45,10 +45,14 @@ import ( "sync" "golang.org/x/net/context" - "golang.org/x/net/trace" + "golang.org/x/net/http2" "google.golang.org/grpc/codes" "google.golang.org/grpc/credentials" + "google.golang.org/grpc/keepalive" "google.golang.org/grpc/metadata" + "google.golang.org/grpc/stats" + "google.golang.org/grpc/status" + "google.golang.org/grpc/tap" ) // recvMsg represents the received msg from the transport. All transport @@ -167,6 +171,11 @@ type Stream struct { id uint32 // nil for client side Stream. st ServerTransport + // clientStatsCtx keeps the user context for stats handling. + // It's only valid on client side. Server side stats context is same as s.ctx. + // All client side stats collection should use the clientStatsCtx (instead of the stream context) + // so that all the generated stats for a particular RPC can be associated in the processing phase. + clientStatsCtx context.Context // ctx is the associated context of the stream. ctx context.Context // cancel is always nil for client side Stream. @@ -204,9 +213,17 @@ type Stream struct { // true iff headerChan is closed. Used to avoid closing headerChan // multiple times. headerDone bool - // the status received from the server. - statusCode codes.Code - statusDesc string + // the status error received from the server. + status *status.Status + // rstStream indicates whether a RST_STREAM frame needs to be sent + // to the server to signify that this stream is closing. + rstStream bool + // rstError is the error that needs to be sent along with the RST_STREAM frame. + rstError http2.ErrCode + // bytesSent and bytesReceived indicates whether any bytes have been sent or + // received on this stream. + bytesSent bool + bytesReceived bool } // RecvCompress returns the compression algorithm applied to the inbound @@ -266,24 +283,14 @@ func (s *Stream) Context() context.Context { return s.ctx } -// TraceContext recreates the context of s with a trace.Trace. -func (s *Stream) TraceContext(tr trace.Trace) { - s.ctx = trace.NewContext(s.ctx, tr) -} - // Method returns the method for the stream. func (s *Stream) Method() string { return s.method } -// StatusCode returns statusCode received from the server. -func (s *Stream) StatusCode() codes.Code { - return s.statusCode -} - -// StatusDesc returns statusDesc received from the server. -func (s *Stream) StatusDesc() string { - return s.statusDesc +// Status returns the status received from the server. +func (s *Stream) Status() *status.Status { + return s.status } // SetHeader sets the header metadata. This can be called multiple times. @@ -330,6 +337,34 @@ func (s *Stream) Read(p []byte) (n int, err error) { return } +// finish sets the stream's state and status, and closes the done channel. +// s.mu must be held by the caller. st must always be non-nil. +func (s *Stream) finish(st *status.Status) { + s.status = st + s.state = streamDone + close(s.done) +} + +// BytesSent indicates whether any bytes have been sent on this stream. +func (s *Stream) BytesSent() bool { + s.mu.Lock() + defer s.mu.Unlock() + return s.bytesSent +} + +// BytesReceived indicates whether any bytes have been received on this stream. +func (s *Stream) BytesReceived() bool { + s.mu.Lock() + defer s.mu.Unlock() + return s.bytesReceived +} + +// GoString is implemented by Stream so context.String() won't +// race when printing %#v. +func (s *Stream) GoString() string { + return fmt.Sprintf("", s, s.method) +} + // The key to save transport.Stream in the context. type streamKey struct{} @@ -355,22 +390,41 @@ const ( draining ) +// ServerConfig consists of all the configurations to establish a server transport. +type ServerConfig struct { + MaxStreams uint32 + AuthInfo credentials.AuthInfo + InTapHandle tap.ServerInHandle + StatsHandler stats.Handler + KeepaliveParams keepalive.ServerParameters + KeepalivePolicy keepalive.EnforcementPolicy +} + // NewServerTransport creates a ServerTransport with conn or non-nil error // if it fails. -func NewServerTransport(protocol string, conn net.Conn, maxStreams uint32, authInfo credentials.AuthInfo) (ServerTransport, error) { - return newHTTP2Server(conn, maxStreams, authInfo) +func NewServerTransport(protocol string, conn net.Conn, config *ServerConfig) (ServerTransport, error) { + return newHTTP2Server(conn, config) } // ConnectOptions covers all relevant options for communicating with the server. type ConnectOptions struct { // UserAgent is the application user agent. UserAgent string + // Authority is the :authority pseudo-header to use. This field has no effect if + // TransportCredentials is set. + Authority string // Dialer specifies how to dial a network address. Dialer func(context.Context, string) (net.Conn, error) + // FailOnNonTempDialError specifies if gRPC fails on non-temporary dial errors. + FailOnNonTempDialError bool // PerRPCCredentials stores the PerRPCCredentials required to issue RPCs. PerRPCCredentials []credentials.PerRPCCredentials // TransportCredentials stores the Authenticator required to setup a client connection. TransportCredentials credentials.TransportCredentials + // KeepaliveParams stores the keepalive parameters. + KeepaliveParams keepalive.ClientParameters + // StatsHandler stores the handler for stats. + StatsHandler stats.Handler } // TargetInfo contains the information of the target such as network address and metadata. @@ -457,6 +511,9 @@ type ClientTransport interface { // receives the draining signal from the server (e.g., GOAWAY frame in // HTTP/2). GoAway() <-chan struct{} + + // GetGoAwayReason returns the reason why GoAway frame was received. + GetGoAwayReason() GoAwayReason } // ServerTransport is the common interface for all gRPC server-side transport @@ -466,7 +523,7 @@ type ClientTransport interface { // Write methods for a given Stream will be called serially. type ServerTransport interface { // HandleStreams receives incoming streams using the given handler. - HandleStreams(func(*Stream)) + HandleStreams(func(*Stream), func(context.Context, string) context.Context) // WriteHeader sends the header metadata for the given stream. // WriteHeader may not be called on all streams. @@ -476,10 +533,9 @@ type ServerTransport interface { // Write may not be called on all streams. Write(s *Stream, data []byte, opts *Options) error - // WriteStatus sends the status of a stream to the client. - // WriteStatus is the final call made on a stream and always - // occurs. - WriteStatus(s *Stream, statusCode codes.Code, statusDesc string) error + // WriteStatus sends the status of a stream to the client. WriteStatus is + // the final call made on a stream and always occurs. + WriteStatus(s *Stream, st *status.Status) error // Close tears down the transport. Once it is called, the transport // should not be accessed any more. All the pending streams and their @@ -545,6 +601,8 @@ var ( ErrStreamDrain = streamErrorf(codes.Unavailable, "the server stops accepting new RPCs") ) +// TODO: See if we can replace StreamError with status package errors. + // StreamError is an error that only affects one stream within a connection. type StreamError struct { Code codes.Code @@ -552,7 +610,7 @@ type StreamError struct { } func (e StreamError) Error() string { - return fmt.Sprintf("stream error: code = %d desc = %q", e.Code, e.Desc) + return fmt.Sprintf("stream error: code = %s desc = %q", e.Code, e.Desc) } // ContextErr converts the error from context package into a StreamError. @@ -593,3 +651,16 @@ func wait(ctx context.Context, done, goAway, closing <-chan struct{}, proceed <- return i, nil } } + +// GoAwayReason contains the reason for the GoAway frame received. +type GoAwayReason uint8 + +const ( + // Invalid indicates that no GoAway frame is received. + Invalid GoAwayReason = 0 + // NoReason is the default value when GoAway frame is received. + NoReason GoAwayReason = 1 + // TooManyPings indicates that a GoAway frame with ErrCodeEnhanceYourCalm + // was recieved and that the debug data said "too_many_pings". + TooManyPings GoAwayReason = 2 +)